F444744

General Info

Members Datasets Scaffolds Average Seq Length
441 345 287 373

Family's Representative Sequence

Representative Sequence 3300047472|Ga0495686_0030778|Ga0495686_0030778_1931_3112
Length 393
Sequence MTIQEAADPLGRGFRIAEMTPPTFAIRRLQAFCYRYPLSTPVVTSFGRMLNRPAVFVRVEDQDGVVGWGEVWANFPSTGAEHRARLVNEVLAPAMAGFAASEPSDVFETLTQGTSVLALQSGEPGPFAQAIAGIDLAVWDLYARRRNTALWKLLGGNRNQIRVYASGINPTGSLQMAEAALSRGHRALKLKIGFDLAADRANLASLRQLIGDGMLAADANQAWSTERALEVAPHLGEFGLAWLEEPIRADRPWQEWQHLRAGAGLPLAAGENIASRAGFEQALADDVLRVVQPDIAKWGGLSVCSDIARDILRSGKIFCPHYLGGGIGLLASAHLLAGVGGDGLLEVDSNDNPLRDLLCGAVADIRDGMVTLNDNPGLGIEPDLSSIEQYRTA

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
3 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
4 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
5 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
6 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
7 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
8 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
9 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
10 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
11 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
12 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
13 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
14 2643221651 Afipia sp. Root123D2 Isolate Unclassified
15 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
16 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
17 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
18 2791355199
19 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
20 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
21 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
22 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
23 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
24 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
25 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
26 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
27 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
28 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
29 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
30 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
31 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
32 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
33 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
34 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
35 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
36 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
37 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
38 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
39 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
40 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
41 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
42 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
43 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
44 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
45 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
46 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
47 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
48 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
49 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
50 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
51 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
52 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
53 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
54 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
55 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
56 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
57 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
58 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
59 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
60 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
61 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
62 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
63 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
64 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
65 2922368715
66 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
67 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
68 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
69 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
70 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
71 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
72 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
73 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
74 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
75 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
76 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
77 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
78 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
79 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
80 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
81 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
82 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
83 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
84 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
85 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
86 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
87 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
88 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
89 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
90 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
91 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
92 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
93 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
94 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
95 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
96 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
97 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
98 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
99 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
100 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
101 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
102 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
103 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
104 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
105 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
106 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
107 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
108 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
109 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
110 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
111 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
112 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
113 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
114 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
115 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
116 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
117 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
118 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
119 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
120 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
121 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
122 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
123 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
124 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
125 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
126 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
127 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
128 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
129 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
130 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
131 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
132 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
133 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
134 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
135 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
136 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
137 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
138 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
139 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
140 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
141 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
142 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
143 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
144 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
145 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
146 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
147 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
148 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
149 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
150 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
151 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
152 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
153 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
154 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
155 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
156 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
157 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
158 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
159 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
160 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
161 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
162 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
163 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
164 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
165 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
166 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
167 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
168 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
169 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
170 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
171 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
172 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
173 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
174 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
175 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
176 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
177 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
178 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
179 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
180 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
181 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
182 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
183 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
184 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
185 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
186 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
188 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
190 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
192 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
221 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
222 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
223 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
224 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
228 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
231 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
232 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
233 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
240 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
245 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
246 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
247 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
248 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
249 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
250 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
251 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
252 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
253 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
254 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
257 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
258 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
265 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
268 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
269 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
273 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
277 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
282 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
283 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
284 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
297 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
298 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
299 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
300 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
301 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
302 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
303 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
304 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
305 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
306 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
307 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
308 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
309 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
310 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
311 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
312 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
313 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
314 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
315 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
316 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
317 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
318 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
319 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
320 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
321 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
322 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
323 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
324 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
325 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
326 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
327 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
328 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
329 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
330 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
331 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
332 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
333 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
334 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
335 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
336 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
337 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
338 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
339 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
340 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
341 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
342 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
343 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
344 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
345 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 65.38
Metatranscriptomes 0
Isolates 34.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.19
Nodule 29.25
Rhizoplane 3.17
Rhizosphere 40.14
Stem 0
Stem Tuber 0
Unclassified 12.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000060 3300003203 Bacteria 50068
2 JGI25153J46596_10000180 3300003215 Bacteria 62334
3 JGI25160J50197_1004063 3300003354 Bacteria 6374
4 JGI25404J52841_10000476 3300003659 Bacteria 5765
5 Ga0055531_10005580 3300003794 Bacteria 7339
6 Ga0055543_1000948 3300004625 Bacteria 13290
7 Ga0065165_1000843 3300005262 Bacteria 40185
8 Ga0065165_1003837 3300005262 Bacteria 10008
9 Ga0065165_1018232 3300005262 Bacteria 2550
10 Ga0068869_100030619 3300005334 Bacteria 3779
11 Ga0070682_100046675 3300005337 Bacteria 2689
12 Ga0070682_100237877 3300005337 Bacteria 1306
13 Ga0068868_100050390 3300005338 Bacteria 3270
14 Ga0068868_100169462 3300005338 Bacteria 1807
15 Ga0070660_100163837 3300005339 Bacteria 1793
16 Ga0070668_100009888 3300005347 Bacteria 7064
17 Ga0070675_100227520 3300005354 Bacteria 1626
18 Ga0070671_100097621 3300005355 Bacteria 2464
19 Ga0070688_100060800 3300005365 Bacteria 2387
20 Ga0070659_100178272 3300005366 Bacteria 1743
21 Ga0070714_100077966 3300005435 Bacteria 2879
22 Ga0070713_100007608 3300005436 Bacteria 7621
23 Ga0070663_100030343 3300005455 Bacteria 3704
24 Ga0070663_100044360 3300005455 Bacteria 3134
25 Ga0070678_100011753 3300005456 Bacteria 5415
26 Ga0070662_100030785 3300005457 Bacteria 3759
27 Ga0070681_10022466 3300005458 Bacteria 6334
28 Ga0070679_100266890 3300005530 Bacteria 1666
29 Ga0070679_100283456 3300005530 Bacteria 1609
30 Ga0068853_100061213 3300005539 Bacteria 3255
31 Ga0070665_100003516 3300005548 Bacteria 16661
32 Ga0070665_100097149 3300005548 Bacteria 2950
33 Ga0070665_100114776 3300005548 Bacteria 2696
34 Ga0070665_100137947 3300005548 Bacteria 2442
35 Ga0070665_100157410 3300005548 Bacteria 2273
36 Ga0068855_100524502 3300005563 Bacteria 1285
37 Ga0070664_100203585 3300005564 Bacteria 1767
38 Ga0068856_100180054 3300005614 Bacteria 2126
39 Ga0068852_100037389 3300005616 Bacteria 4069
40 Ga0068852_100083039 3300005616 Bacteria 2849
41 Ga0068852_100146929 3300005616 Bacteria 2188
42 Ga0068861_100019659 3300005719 Bacteria 4825
43 Ga0068861_100057019 3300005719 Bacteria 2983
44 Ga0068860_100037802 3300005843 Bacteria 4619
45 Ga0068862_100057188 3300005844 Bacteria 3343
46 Ga0068862_100100218 3300005844 Bacteria 2533
47 Ga0068862_100132178 3300005844 Bacteria 2208
48 Ga0081455_10003998 3300005937 Bacteria 16738
49 Ga0081538_10053227 3300005981 Bacteria 2408
50 Ga0081540_1000862 3300005983 Bacteria 27458
51 Ga0081540_1012325 3300005983 Bacteria 5641
52 Ga0081540_1044255 3300005983 Bacteria 2275
53 Ga0081539_10000003 3300005985 Bacteria 594833
54 Ga0075365_10007492 3300006038 Bacteria 6117
55 Ga0075365_10182552 3300006038 Bacteria 1467
56 Ga0075368_10008346 3300006042 Bacteria 3685
57 Ga0075363_100023494 3300006048 Bacteria 3125
58 Ga0075367_10050098 3300006178 Bacteria 2465
59 Ga0075367_10069482 3300006178 Bacteria 2115
60 Ga0075367_10117834 3300006178 Bacteria 1634
61 Ga0075366_10022340 3300006195 Bacteria 3679
62 Ga0075370_10012818 3300006353 Bacteria 4440
63 Ga0068871_100129957 3300006358 Bacteria 2135
64 Ga0068865_100051552 3300006881 Bacteria 2849
65 Ga0075436_100059896 3300006914 Bacteria 2630
66 Ga0099824_1018069 3300006942 Bacteria 5893
67 Ga0099822_1002451 3300006943 Bacteria 23110
68 Ga0099823_1000008 3300006944 Bacteria 105646
69 Ga0099794_10008174 3300007265 Bacteria 4336
70 Ga0105245_10036606 3300009098 Bacteria 4360
71 Ga0105245_10129889 3300009098 Bacteria 2362
72 Ga0105248_10098806 3300009177 Bacteria 3288
73 Ga0105249_10099753 3300009553 Bacteria 2730
74 Ga0099796_10040339 3300010159 Unclassified 1576
75 Ga0105246_10026343 3300011119 Bacteria 3797
76 Ga0105246_10037493 3300011119 Bacteria 3254
77 Ga0157369_10005626 3300013105 Bacteria 14557
78 Ga0157378_10221392 3300013297 Bacteria 1799
79 Ga0163162_10057676 3300013306 Bacteria 3911
80 Ga0157372_10606359 3300013307 Bacteria 1276
81 Ga0157375_10199359 3300013308 Bacteria 2157
82 Ga0157377_10010415 3300014745 Bacteria 4599
83 Ga0157379_10158937 3300014968 Bacteria 2040
84 Ga0214544_1000035 3300021320 Bacteria 146874
85 Ga0214542_1000790 3300021321 Bacteria 60657
86 Ga0214545_1000555 3300021324 Bacteria 60657
87 Ga0214543_1003298 3300021327 Bacteria 31425
88 Ga0209563_101355 3300025230 Bacteria 6648
89 Ga0209677_100241 3300025253 Bacteria 37674
90 Ga0209677_101299 3300025253 Bacteria 11115
91 Ga0209455_1002355 3300025272 Bacteria 7368
92 Ga0209758_1000024 3300025297 Bacteria 591966
93 Ga0209758_1000838 3300025297 Bacteria 42919
94 Ga0209758_1000857 3300025297 Bacteria 42282
95 Ga0209758_1019226 3300025297 Bacteria 3304
96 Ga0209758_1028880 3300025297 Bacteria 2334
97 Ga0209256_1006209 3300025299 Bacteria 6441
98 Ga0207426_1002185 3300025302 Bacteria 13211
99 Ga0207426_1009136 3300025302 Bacteria 3942
100 Ga0209257_1001471 3300025304 Bacteria 27722
101 Ga0207647_10100163 3300025904 Bacteria 1720
102 Ga0207643_10092547 3300025908 Bacteria 1764
103 Ga0207654_10108345 3300025911 Bacteria 1724
104 Ga0207707_10045716 3300025912 Bacteria 3815
105 Ga0207671_10033512 3300025914 Bacteria 3820
106 Ga0207657_10001491 3300025919 Bacteria 25043
107 Ga0207657_10143468 3300025919 Bacteria 1950
108 Ga0207652_10123896 3300025921 Bacteria 2301
109 Ga0207687_10071482 3300025927 Bacteria 2479
110 Ga0207700_10005496 3300025928 Bacteria 7600
111 Ga0207644_10044368 3300025931 Bacteria 3159
112 Ga0207690_10220343 3300025932 Bacteria 1451
113 Ga0207706_10004262 3300025933 Bacteria 13461
114 Ga0207669_10153189 3300025937 Bacteria 1618
115 Ga0207704_10034678 3300025938 Bacteria 2882
116 Ga0207689_10004916 3300025942 Bacteria 12036
117 Ga0207667_10152275 3300025949 Bacteria 2380
118 Ga0207667_10429102 3300025949 Bacteria 1344
119 Ga0207712_10045668 3300025961 Bacteria 3034
120 Ga0207668_10026654 3300025972 Bacteria 3755
121 Ga0207668_10149544 3300025972 Bacteria 1806
122 Ga0207658_10076760 3300025986 Bacteria 2547
123 Ga0207677_10143633 3300026023 Bacteria 1831
124 Ga0207639_10218204 3300026041 Bacteria 1646
125 Ga0207639_10241654 3300026041 Bacteria 1570
126 Ga0207678_10005947 3300026067 Bacteria 10864
127 Ga0207678_10060567 3300026067 Bacteria 3256
128 Ga0207678_10074942 3300026067 Bacteria 2899
129 Ga0207678_10193526 3300026067 Bacteria 1738
130 Ga0207676_10089245 3300026095 Bacteria 2526
131 Ga0207674_10074126 3300026116 Bacteria 3416
132 Ga0207675_100007890 3300026118 Bacteria 10039
133 Ga0207675_100008391 3300026118 Bacteria 9742
134 Ga0207683_10029523 3300026121 Bacteria 4747
135 Ga0207683_10033435 3300026121 Bacteria 4465
136 Ga0207683_10209975 3300026121 Bacteria 1772
137 Ga0207698_10095545 3300026142 Bacteria 2447
138 Ga0207698_10168495 3300026142 Bacteria 1925
139 Ga0209389_1000032 3300027296 Bacteria 134064
140 Ga0209389_1000156 3300027296 Bacteria 57387
141 Ga0209589_1000001 3300027357 Bacteria 794224
142 Ga0209489_100001 3300027361 Bacteria 794224
143 Ga0209489_100035 3300027361 Bacteria 168255
144 Ga0209700_100001 3300027363 Bacteria 794224
145 Ga0209700_100005 3300027363 Bacteria 573969
146 Ga0209700_100030 3300027363 Bacteria 212982
147 Ga0209588_1009814 3300027671 Bacteria 2867
148 Ga0268266_10004611 3300028379 Bacteria 13155
149 Ga0268266_10129337 3300028379 Bacteria 2257
150 Ga0268266_10196501 3300028379 Bacteria 1844
151 Ga0268266_10202215 3300028379 Bacteria 1818
152 Ga0268265_10009331 3300028380 Bacteria 6631
153 Ga0307517_10116978 3300028786 Bacteria 1993
154 Ga0307408_100086408 3300031548 Bacteria 2358
155 Ga0307410_10228990 3300031852 Bacteria 1434
156 Ga0316583_10029849 3300032133 Unclassified 1943
157 Ga0307510_10011409 3300033180 Bacteria 10556
158 Ga0315911_1000007 3300033442 Bacteria 413725
159 Ga0395899_0108144 3300037312 Bacteria 2001
160 Ga0395900_0001627 3300037418 Bacteria 26397
161 Ga0395898_0089089 3300037466 Bacteria 2970
162 Ga0395898_0348916 3300037466 Bacteria 1411
163 Ga0395905_0006705 3300037471 Bacteria 11530
164 Ga0395905_0007148 3300037471 Bacteria 11158
165 Ga0395905_0039184 3300037471 Bacteria 4446
166 Ga0395901_0002678 3300038443 Bacteria 17967
167 Ga0395901_0148994 3300038443 Bacteria 2459
168 Ga0395901_0256979 3300038443 Bacteria 1819
169 Ga0436365_1356994 3300039437 Bacteria 1772
170 Ga0451802_0236898 3300041460 Bacteria 1255
171 Ga0466965_0045495 3300044683 Bacteria 2171
172 Ga0466965_0052008 3300044683 Bacteria 2033
173 Ga0466957_0022040 3300044842 Bacteria 3756
174 Ga0466967_0018209 3300045976 Bacteria 5604
175 Ga0495603_0001392 3300046455 Bacteria 14054
176 Ga0495638_0051422 3300046460 Bacteria 2569
177 Ga0495641_0055778 3300046461 Bacteria 1793
178 Ga0495605_0042868 3300046474 Bacteria 2246
179 Ga0495585_0039401 3300046492 Bacteria 2656
180 Ga0495648_0057208 3300046524 Bacteria 2341
181 Ga0495648_0082749 3300046524 Bacteria 1821
182 Ga0495622_0002979 3300046557 Bacteria 8050
183 Ga0495622_0035845 3300046557 Bacteria 2313
184 Ga0495611_0097527 3300046648 Bacteria 1362
185 Ga0495625_0026215 3300046660 Bacteria 4407
186 Ga0495625_0150414 3300046660 Bacteria 1565
187 Ga0495588_0000856 3300046674 Bacteria 13487
188 Ga0495589_0058207 3300046794 Bacteria 1900
189 Ga0495686_0030778 3300047472 Bacteria 3484
190 Ga0496102_0099751 3300048905 Bacteria 2696
191 Ga0496102_0100533 3300048905 Bacteria 2686
192 Ga0496104_0008771 3300048907 Bacteria 8990
193 Ga0496104_0072073 3300048907 Bacteria 3285
194 Ga0496104_0274015 3300048907 Bacteria 1600
195 Ga0496105_0029961 3300048908 Bacteria 4456
196 Ga0496106_0072910 3300048909 Bacteria 2626
197 Ga0496106_0194457 3300048909 Bacteria 1613
198 Ga0496110_0020412 3300048913 Bacteria 5596
199 Ga0496112_0006407 3300048915 Bacteria 10328
200 Ga0496113_0316671 3300048916 Bacteria 1250
201 Ga0496114_0045854 3300048917 Bacteria 3632
202 Ga0496115_0078991 3300048918 Bacteria 2678
203 Ga0496118_0066224 3300048921 Bacteria 2638
204 Ga0496118_0089776 3300048921 Bacteria 2120
205 Ga0496119_0046846 3300048922 Bacteria 2695
206 Ga0496121_0000285 3300048924 Bacteria 104880
207 Ga0496121_0063201 3300048924 Bacteria 3027
208 Ga0496124_0296324 3300048927 Bacteria 1171
209 Ga0496126_0001378 3300048929 Bacteria 38419
210 Ga0496126_0008408 3300048929 Bacteria 11135
211 Ga0496126_0050365 3300048929 Bacteria 3796
212 Ga0496126_0053533 3300048929 Bacteria 3661
213 Ga0501031_0000106 3300049568 Bacteria 44638
214 Ga0501032_0000086 3300049569 Bacteria 81788
215 Ga0501033_0002698 3300049570 Bacteria 14883
216 Ga0501033_0109854 3300049570 Bacteria 2008
217 Ga0501034_0000108 3300049571 Bacteria 152258
218 Ga0501034_0265657 3300049571 Bacteria 1658
219 Ga0501036_0000065 3300049572 Bacteria 68031
220 Ga0501036_0058915 3300049572 Bacteria 3254
221 Ga0501037_0000173 3300049573 Bacteria 61084
222 Ga0501038_0000076 3300049574 Bacteria 81908
223 Ga0501039_0006739 3300049575 Bacteria 8740
224 Ga0501043_0000459 3300049579 Bacteria 36316
225 Ga0501043_0028558 3300049579 Bacteria 4379
226 Ga0501043_0090773 3300049579 Bacteria 2402
227 Ga0501046_0000744 3300049580 Bacteria 31562
228 Ga0501047_0001887 3300049581 Bacteria 20141
229 Ga0501048_0000271 3300049582 Bacteria 34755
230 Ga0501067_0000176 3300049583 Bacteria 35984
231 Ga0501068_0005298 3300049584 Bacteria 7044
232 Ga0501069_0006051 3300049585 Bacteria 6318
233 Ga0501069_0056679 3300049585 Bacteria 2184
234 Ga0501070_0026936 3300049586 Bacteria 4820
235 Ga0501070_0027625 3300049586 Bacteria 4760
236 Ga0501070_0107530 3300049586 Unclassified 2305
237 Ga0501071_0007508 3300049587 Bacteria 7169
238 Ga0501072_0014497 3300049588 Bacteria 6041
239 Ga0501073_0000058 3300049589 Bacteria 70421
240 Ga0501079_0004672 3300049741 Bacteria 10145
241 Ga0501080_0002986 3300049742 Bacteria 14898
242 Ga0501080_0150864 3300049742 Bacteria 2148
243 Ga0501083_0017843 3300049744 Bacteria 4950
244 Ga0501035_0000079 3300049822 Bacteria 118194
245 Ga0501044_0000085 3300049823 Bacteria 114339
246 Ga0501044_0011028 3300049823 Bacteria 9807
247 Ga0501045_0024196 3300049824 Bacteria 4359
248 nmdc:mga03n38_763_c2 3300050490 Bacteria 3236
249 nmdc:mga0yw44_12912_c1 3300050492 Bacteria 4374
250 nmdc:mga0yw44_15465_c1 3300050492 Bacteria 4089
251 nmdc:mga0yw44_221429_c1 3300050492 Bacteria 1254
252 nmdc:mga0yw44_4052_c1 3300050492 Bacteria 6632
253 nmdc:mga0k408_103522_c1 3300050493 Bacteria 1679
254 nmdc:mga04h51_5011_c1 3300050495 Bacteria 3345
255 nmdc:mga0sz30_69587_c1 3300050516 Bacteria 1513
256 Ga0500643_000007 3300053087 Bacteria 462836
257 Ga0500647_0119564 3300053091 Bacteria 1248
258 Ga0500651_0004111 3300053093 Bacteria 8106
259 Ga0500640_042984 3300053095 Bacteria 1984
260 Ga0500641_0013196 3300053096 Bacteria 3033
261 Ga0500641_0084636 3300053096 Bacteria 1349
262 Ga0500555_000904 3300053103 Bacteria 10536
263 Ga0500556_0004067 3300053104 Bacteria 4202
264 Ga0500572_000443 3300053111 Bacteria 14511
265 Ga0500572_000504 3300053111 Bacteria 13408
266 Ga0500595_001362 3300053119 Bacteria 13149
267 Ga0500595_001888 3300053119 Bacteria 10797
268 Ga0500595_009136 3300053119 Bacteria 4016
269 Ga0500595_028591 3300053119 Bacteria 1900
270 Ga0500608_002577 3300053122 Bacteria 6630
271 Ga0500642_0000059 3300053130 Bacteria 65182
272 Ga0500642_0006971 3300053130 Bacteria 3767
273 Ga0500658_0016263 3300053134 Bacteria 2770
274 Ga0500559_0000120 3300053136 Bacteria 61423
275 Ga0500559_0001477 3300053136 Bacteria 13272
276 Ga0500568_0055306 3300053139 Bacteria 1549
277 Ga0500590_032989 3300053148 Bacteria 2685
278 Ga0500604_0003903 3300053151 Bacteria 3984
279 Ga0500627_0082722 3300053158 Bacteria 1432
280 Ga0500636_0000014 3300053177 Bacteria 124740
281 Ga0500637_0052009 3300053178 Bacteria 2336
282 Ga0500576_061430 3300053725 Bacteria 1642
283 Ga0500596_002398 3300053735 Bacteria 3694
284 Ga0500596_003410 3300053735 Bacteria 3026
285 Ga0500601_000201 3300053737 Bacteria 12146
286 Ga0501084_0026023 3300054114 Bacteria 4880
287 Ga0501082_0039902 3300060353 Bacteria 4050

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 8016511872 8016519772 314
2 iso_pu_bacteria 8016566248 8016572612 322
3 iso_pu_bacteria 8016539877 8016547498 328
4 3300044683 Ga0466965_0045495 Ga0466965_0045495_28_1035 335
5 iso_pu_bacteria 8019687851 8019693840 344
6 3300060353 Ga0501082_0039902 Ga0501082_0039902_29_1066 345
7 iso_pu_bacteria 2922368715 2922376831 348
8 3300048916 Ga0496113_0316671 Ga0496113_0316671_185_1240 351
9 iso_pu_bacteria 8016603502 8016609726 360
10 3300037466 Ga0395898_0348916 Ga0395898_0348916_201_1328 367
11 iso_pu_bacteria 2879110137 2879119124 368
12 iso_pu_bacteria 2513237092 2513622259 370
13 iso_pu_bacteria 2513237102 2513704877 370
14 iso_pu_bacteria 2824600985 2824605273 370
15 iso_pu_bacteria 2824609381 2824616785 370
16 iso_pu_bacteria 2824617872 2824624250 370
17 iso_pu_bacteria 2824626560 2824632979 370
18 iso_pu_bacteria 2824635225 2824639806 370
19 iso_pu_bacteria 2824644064 2824646814 370
20 iso_pu_bacteria 2824653114 2824656918 370
21 iso_pu_bacteria 2824704595 2824708638 370
22 iso_pu_bacteria 2824714736 2824717129 370
23 iso_pu_bacteria 2824723954 2824727309 370
24 iso_pu_bacteria 2824753945 2824761561 370
25 iso_pu_bacteria 2824763712 2824766934 370
26 iso_pu_bacteria 2847930680 2847936940 370
27 iso_pu_bacteria 2849076700 2849078806 370
28 iso_pu_bacteria 2857509624 2857516778 370
29 iso_pu_bacteria 2874612657 2874617436 370
30 iso_pu_bacteria 2879083081 2879087791 370
31 iso_pu_bacteria 2879099564 2879106234 370
32 iso_pu_bacteria 2881665667 2881667688 370
33 iso_pu_bacteria 2888419890 2888425166 370
34 iso_pu_bacteria 2904711408 2904712462 370
35 iso_pu_bacteria 2906643746 2906646829 370
36 iso_pu_bacteria 2932809354 2932815884 370
37 iso_pu_bacteria 2932818245 2932824772 370
38 iso_pu_bacteria 2935760218 2935767269 370
39 iso_pu_bacteria 2935810662 2935817634 370
40 iso_pu_bacteria 2936037263 2936044465 370
41 iso_pu_bacteria 2941531003 2941536621 370
42 iso_pu_bacteria 3005506211 3005507939 370
43 iso_pu_bacteria 3005594810 3005596834 370
44 iso_pu_bacteria 3005718088 3005723876 370
45 iso_pu_bacteria 8056967851 8056976368 370
46 iso_pu_bacteria 2507262055 2507510501 371
47 iso_pu_bacteria 2513237094 2513641378 371
48 iso_pu_bacteria 2513237096 2513658632 371
49 iso_pu_bacteria 2513237101 2513698255 371
50 iso_pu_bacteria 2513237137 2513859837 371
51 iso_pu_bacteria 2513237139 2513878909 371
52 iso_pu_bacteria 2513237145 2513920804 371
53 iso_pu_bacteria 2513237161 2514009877 371
54 iso_pu_bacteria 2517572143 2517895033 371
55 iso_pu_bacteria 2528768022 2528852184 371
56 iso_pu_bacteria 2617270735 2617346303 371
57 iso_pu_bacteria 2617270735 2617347269 371
58 iso_pu_bacteria 2643221651 2644289112 371
59 iso_pu_bacteria 2721755755 2723848588 371
60 iso_pu_bacteria 2728368998 2728749469 371
61 iso_pu_bacteria 2791355196 2793062820 371
62 iso_pu_bacteria 2791355199 2793081313 371
63 iso_pu_bacteria 2802429603 2805918233 371
64 iso_pu_bacteria 2824600985 2824604100 371
65 iso_pu_bacteria 2824609381 2824610369 371
66 iso_pu_bacteria 2824653114 2824654111 371
67 iso_pu_bacteria 2824661429 2824665502 371
68 iso_pu_bacteria 2824671348 2824672105 371
69 iso_pu_bacteria 2824687955 2824688704 371
70 iso_pu_bacteria 2824696289 2824697568 371
71 iso_pu_bacteria 2824773399 2824774296 371
72 iso_pu_bacteria 2838122688 2838122821 371
73 iso_pu_bacteria 2838122688 2838123112 371
74 iso_pu_bacteria 2841941048 2841946871 371
75 iso_pu_bacteria 2841941048 2841948177 371
76 iso_pu_bacteria 2841949485 2841950915 371
77 iso_pu_bacteria 2841949485 2841954370 371
78 iso_pu_bacteria 2841966195 2841969758 371
79 iso_pu_bacteria 2841974524 2841978810 371
80 iso_pu_bacteria 2841983080 2841984063 371
81 iso_pu_bacteria 2841983080 2841988889 371
82 iso_pu_bacteria 2842038055 2842038822 371
83 iso_pu_bacteria 2842045827 2842048233 371
84 iso_pu_bacteria 2847939898 2847947267 371
85 iso_pu_bacteria 2849076700 2849077989 371
86 iso_pu_bacteria 2874604998 2874606230 371
87 iso_pu_bacteria 2874620515 2874627593 371
88 iso_pu_bacteria 2874628541 2874631560 371
89 iso_pu_bacteria 2888388044 2888393312 371
90 iso_pu_bacteria 2888419890 2888425030 371
91 iso_pu_bacteria 2904666416 2904673087 371
92 iso_pu_bacteria 2906635258 2906639690 371
93 iso_pu_bacteria 2906643746 2906645094 371
94 iso_pu_bacteria 2906660503 2906660567 371
95 iso_pu_bacteria 2929615660 2929621487 371
96 iso_pu_bacteria 2929624759 2929631698 371
97 iso_pu_bacteria 2932784394 2932790210 371
98 iso_pu_bacteria 2932828146 2932833331 371
99 iso_pu_bacteria 2933577622 2933583488 371
100 iso_pu_bacteria 2935616580 2935621394 371
101 iso_pu_bacteria 2935638405 2935644744 371
102 iso_pu_bacteria 2935648319 2935652575 371
103 iso_pu_bacteria 2935656913 2935661157 371
104 iso_pu_bacteria 2935665750 2935672348 371
105 iso_pu_bacteria 2935675223 2935682787 371
106 iso_pu_bacteria 2935684952 2935693306 371
107 iso_pu_bacteria 2935694250 2935702194 371
108 iso_pu_bacteria 2935703347 2935710887 371
109 iso_pu_bacteria 2935713505 2935720905 371
110 iso_pu_bacteria 2935722832 2935730608 371
111 iso_pu_bacteria 2935732158 2935740627 371
112 iso_pu_bacteria 2935741537 2935749899 371
113 iso_pu_bacteria 2935750917 2935759281 371
114 iso_pu_bacteria 2935769743 2935769858 371
115 iso_pu_bacteria 2935777560 2935782122 371
116 iso_pu_bacteria 2935785616 2935785900 371
117 iso_pu_bacteria 2935793552 2935794172 371
118 iso_pu_bacteria 2935801545 2935808837 371
119 iso_pu_bacteria 2935827899 2935833994 371
120 iso_pu_bacteria 2935837841 2935845515 371
121 iso_pu_bacteria 2935855204 2935859413 371
122 iso_pu_bacteria 2935864058 2935869944 371
123 iso_pu_bacteria 2935873716 2935880906 371
124 iso_pu_bacteria 2935908558 2935912492 371
125 iso_pu_bacteria 2935916978 2935921673 371
126 iso_pu_bacteria 2935926038 2935929619 371
127 iso_pu_bacteria 2935934488 2935938851 371
128 iso_pu_bacteria 2935942939 2935948314 371
129 iso_pu_bacteria 2935951376 2935955038 371
130 iso_pu_bacteria 2935959822 2935960088 371
131 iso_pu_bacteria 2935967501 2935971928 371
132 iso_pu_bacteria 2935992306 2935998319 371
133 iso_pu_bacteria 2936002035 2936009220 371
134 iso_pu_bacteria 2936011229 2936015214 371
135 iso_pu_bacteria 2936019824 2936023359 371
136 iso_pu_bacteria 2936028420 2936032188 371
137 iso_pu_bacteria 2936046547 2936050049 371
138 iso_pu_bacteria 2936055302 2936061849 371
139 iso_pu_bacteria 2940556831 2940565193 371
140 iso_pu_bacteria 2941538514 2941542881 371
141 iso_pu_bacteria 8006994254 8006999561 371
142 iso_pu_bacteria 8016522445 8016529071 371
143 iso_pu_bacteria 8016530956 8016534271 371
144 iso_pu_bacteria 8016548790 8016554642 371
145 iso_pu_bacteria 8016557553 8016563010 371
146 iso_pu_bacteria 8016575299 8016576779 371
147 iso_pu_bacteria 8016595262 8016600777 371
148 iso_pu_bacteria 8016613128 8016615207 371
149 iso_pu_bacteria 8016622563 8016626002 371
150 iso_pu_bacteria 8017057580 8017065766 371
151 iso_pu_bacteria 8019530166 8019534041 371
152 iso_pu_bacteria 8019538911 8019545633 371
153 iso_pu_bacteria 8019586578 8019593168 371
154 iso_pu_bacteria 8019597564 8019598297 371
155 iso_pu_bacteria 8019608314 8019610081 371
156 iso_pu_bacteria 8055742211 8055744310 371
157 iso_pu_bacteria 8056681323 8056685594 371
158 3300005337 Ga0070682_100046675 Ga0070682_1000466752 372
159 3300005455 Ga0070663_100044360 Ga0070663_1000443602 372
160 3300005548 Ga0070665_100003516 Ga0070665_1000035169 372
161 3300005983 Ga0081540_1012325 Ga0081540_10123253 372
162 3300006038 Ga0075365_10007492 Ga0075365_100074926 372
163 3300006042 Ga0075368_10008346 Ga0075368_100083464 372
164 3300006048 Ga0075363_100023494 Ga0075363_1000234942 372
165 3300006178 Ga0075367_10050098 Ga0075367_100500982 372
166 3300006195 Ga0075366_10022340 Ga0075366_100223404 372
167 3300006353 Ga0075370_10012818 Ga0075370_100128184 372
168 3300025297 Ga0209758_1028880 Ga0209758_10288802 372
169 3300026067 Ga0207678_10060567 Ga0207678_100605672 372
170 3300028379 Ga0268266_10004611 Ga0268266_100046113 372
171 3300028379 Ga0268266_10202215 Ga0268266_102022151 372
172 3300028786 Ga0307517_10116978 Ga0307517_101169781 372
173 3300033180 Ga0307510_10011409 Ga0307510_100114094 372
174 3300046455 Ga0495603_0001392 Ga0495603_0001392_8357_9475 372
175 3300046460 Ga0495638_0051422 Ga0495638_0051422_815_1933 372
176 3300046461 Ga0495641_0055778 Ga0495641_0055778_572_1690 372
177 3300046492 Ga0495585_0039401 Ga0495585_0039401_297_1415 372
178 3300046524 Ga0495648_0057208 Ga0495648_0057208_134_1252 372
179 3300046557 Ga0495622_0035845 Ga0495622_0035845_461_1579 372
180 3300046648 Ga0495611_0097527 Ga0495611_0097527_30_1148 372
181 3300046660 Ga0495625_0150414 Ga0495625_0150414_32_1150 372
182 3300046794 Ga0495589_0058207 Ga0495589_0058207_35_1153 372
183 3300048905 Ga0496102_0100533 Ga0496102_0100533_867_1985 372
184 3300048909 Ga0496106_0072910 Ga0496106_0072910_606_1724 372
185 3300048918 Ga0496115_0078991 Ga0496115_0078991_860_1978 372
186 3300048927 Ga0496124_0296324 Ga0496124_0296324_22_1140 372
187 3300048929 Ga0496126_0001378 Ga0496126_0001378_1292_2410 372
188 3300048929 Ga0496126_0053533 Ga0496126_0053533_2129_3271 372
189 3300050490 nmdc:mga03n38_763_c2 nmdc:mga03n38_763_c2_483_1601 372
190 3300050492 nmdc:mga0yw44_15465_c1 nmdc:mga0yw44_15465_c1_2855_3973 372
191 3300050493 nmdc:mga0k408_103522_c1 nmdc:mga0k408_103522_c1_435_1553 372
192 3300050495 nmdc:mga04h51_5011_c1 nmdc:mga04h51_5011_c1_177_1295 372
193 3300053130 Ga0500642_0006971 Ga0500642_0006971_2480_3598 372
194 3300053158 Ga0500627_0082722 Ga0500627_0082722_73_1215 372
195 3300025908 Ga0207643_10092547 Ga0207643_100925471 373
196 3300003215 JGI25153J46596_10000180 JGI25153J46596_1000018014 374
197 3300003354 JGI25160J50197_1004063 JGI25160J50197_10040635 374
198 3300003659 JGI25404J52841_10000476 JGI25404J52841_100004763 374
199 3300003794 Ga0055531_10005580 Ga0055531_100055803 374
200 3300004625 Ga0055543_1000948 Ga0055543_10009483 374
201 3300005262 Ga0065165_1000843 Ga0065165_100084314 374
202 3300005262 Ga0065165_1003837 Ga0065165_10038378 374
203 3300005262 Ga0065165_1018232 Ga0065165_10182322 374
204 3300005337 Ga0070682_100237877 Ga0070682_1002378771 374
205 3300005458 Ga0070681_10022466 Ga0070681_100224662 374
206 3300005530 Ga0070679_100266890 Ga0070679_1002668902 374
207 3300005614 Ga0068856_100180054 Ga0068856_1001800542 374
208 3300005616 Ga0068852_100146929 Ga0068852_1001469291 374
209 3300005844 Ga0068862_100100218 Ga0068862_1001002182 374
210 3300005983 Ga0081540_1000862 Ga0081540_10008624 374
211 3300021320 Ga0214544_1000035 Ga0214544_1000035132 374
212 3300021321 Ga0214542_1000790 Ga0214542_100079040 374
213 3300021324 Ga0214545_1000555 Ga0214545_100055521 374
214 3300021327 Ga0214543_1003298 Ga0214543_100329825 374
215 3300025253 Ga0209677_100241 Ga0209677_10024129 374
216 3300025272 Ga0209455_1002355 Ga0209455_10023556 374
217 3300025297 Ga0209758_1000024 Ga0209758_1000024440 374
218 3300025297 Ga0209758_1000857 Ga0209758_10008575 374
219 3300025297 Ga0209758_1019226 Ga0209758_10192262 374
220 3300025299 Ga0209256_1006209 Ga0209256_10062093 374
221 3300025302 Ga0207426_1002185 Ga0207426_10021852 374
222 3300025302 Ga0207426_1009136 Ga0207426_10091362 374
223 3300025304 Ga0209257_1001471 Ga0209257_100147119 374
224 3300025912 Ga0207707_10045716 Ga0207707_100457163 374
225 3300025919 Ga0207657_10001491 Ga0207657_1000149115 374
226 3300025921 Ga0207652_10123896 Ga0207652_101238962 374
227 3300025972 Ga0207668_10149544 Ga0207668_101495442 374
228 3300026041 Ga0207639_10218204 Ga0207639_102182042 374
229 3300026142 Ga0207698_10095545 Ga0207698_100955451 374
230 3300026142 Ga0207698_10168495 Ga0207698_101684952 374
231 3300027296 Ga0209389_1000156 Ga0209389_100015630 374
232 3300027363 Ga0209700_100030 Ga0209700_100030106 374
233 3300039437 Ga0436365_1356994 Ga0436365_1356994_337_1461 374
234 3300046524 Ga0495648_0082749 Ga0495648_0082749_609_1733 374
235 3300046557 Ga0495622_0002979 Ga0495622_0002979_5285_6409 374
236 3300046660 Ga0495625_0026215 Ga0495625_0026215_657_1781 374
237 3300046674 Ga0495588_0000856 Ga0495588_0000856_10631_11755 374
238 3300048907 Ga0496104_0008771 Ga0496104_0008771_5148_6272 374
239 3300048908 Ga0496105_0029961 Ga0496105_0029961_1603_2727 374
240 3300048913 Ga0496110_0020412 Ga0496110_0020412_151_1275 374
241 3300048917 Ga0496114_0045854 Ga0496114_0045854_1246_2370 374
242 3300048921 Ga0496118_0089776 Ga0496118_0089776_135_1262 374
243 3300049570 Ga0501033_0109854 Ga0501033_0109854_90_1214 374
244 3300049572 Ga0501036_0058915 Ga0501036_0058915_186_1310 374
245 3300049579 Ga0501043_0028558 Ga0501043_0028558_1099_2223 374
246 3300049585 Ga0501069_0056679 Ga0501069_0056679_61_1227 374
247 3300049586 Ga0501070_0107530 Ga0501070_0107530_1019_2185 374
248 3300049823 Ga0501044_0011028 Ga0501044_0011028_508_1632 374
249 3300050492 nmdc:mga0yw44_4052_c1 nmdc:mga0yw44_4052_c1_3599_4723 374
250 3300053091 Ga0500647_0119564 Ga0500647_0119564_75_1199 374
251 3300053095 Ga0500640_042984 Ga0500640_042984_284_1408 374
252 3300053104 Ga0500556_0004067 Ga0500556_0004067_2424_3548 374
253 3300053111 Ga0500572_000443 Ga0500572_000443_8282_9406 374
254 3300053122 Ga0500608_002577 Ga0500608_002577_2036_3160 374
255 3300053130 Ga0500642_0000059 Ga0500642_0000059_52967_54091 374
256 3300053136 Ga0500559_0001477 Ga0500559_0001477_6929_8053 374
257 3300053148 Ga0500590_032989 Ga0500590_032989_54_1178 374
258 3300053177 Ga0500636_0000014 Ga0500636_0000014_43485_44609 374
259 3300053178 Ga0500637_0052009 Ga0500637_0052009_991_2115 374
260 3300053725 Ga0500576_061430 Ga0500576_061430_20_1144 374
261 3300053735 Ga0500596_003410 Ga0500596_003410_706_1830 374
262 3300053737 Ga0500601_000201 Ga0500601_000201_2646_3770 374
263 3300003203 JGI25406J46586_10000060 JGI25406J46586_100000606 375
264 3300005334 Ga0068869_100030619 Ga0068869_1000306192 375
265 3300005338 Ga0068868_100050390 Ga0068868_1000503902 375
266 3300005338 Ga0068868_100169462 Ga0068868_1001694622 375
267 3300005339 Ga0070660_100163837 Ga0070660_1001638372 375
268 3300005347 Ga0070668_100009888 Ga0070668_1000098883 375
269 3300005354 Ga0070675_100227520 Ga0070675_1002275201 375
270 3300005355 Ga0070671_100097621 Ga0070671_1000976212 375
271 3300005365 Ga0070688_100060800 Ga0070688_1000608001 375
272 3300005366 Ga0070659_100178272 Ga0070659_1001782721 375
273 3300005435 Ga0070714_100077966 Ga0070714_1000779663 375
274 3300005436 Ga0070713_100007608 Ga0070713_1000076083 375
275 3300005455 Ga0070663_100030343 Ga0070663_1000303432 375
276 3300005456 Ga0070678_100011753 Ga0070678_1000117532 375
277 3300005457 Ga0070662_100030785 Ga0070662_1000307852 375
278 3300005530 Ga0070679_100283456 Ga0070679_1002834562 375
279 3300005539 Ga0068853_100061213 Ga0068853_1000612132 375
280 3300005548 Ga0070665_100097149 Ga0070665_1000971492 375
281 3300005548 Ga0070665_100114776 Ga0070665_1001147763 375
282 3300005548 Ga0070665_100137947 Ga0070665_1001379472 375
283 3300005548 Ga0070665_100157410 Ga0070665_1001574102 375
284 3300005563 Ga0068855_100524502 Ga0068855_1005245021 375
285 3300005564 Ga0070664_100203585 Ga0070664_1002035852 375
286 3300005616 Ga0068852_100037389 Ga0068852_1000373893 375
287 3300005616 Ga0068852_100083039 Ga0068852_1000830392 375
288 3300005719 Ga0068861_100019659 Ga0068861_1000196593 375
289 3300005719 Ga0068861_100057019 Ga0068861_1000570192 375
290 3300005843 Ga0068860_100037802 Ga0068860_1000378024 375
291 3300005844 Ga0068862_100057188 Ga0068862_1000571882 375
292 3300005844 Ga0068862_100132178 Ga0068862_1001321782 375
293 3300005937 Ga0081455_10003998 Ga0081455_100039982 375
294 3300005981 Ga0081538_10053227 Ga0081538_100532273 375
295 3300005983 Ga0081540_1044255 Ga0081540_10442552 375
296 3300005985 Ga0081539_10000003 Ga0081539_10000003280 375
297 3300006038 Ga0075365_10182552 Ga0075365_101825522 375
298 3300006178 Ga0075367_10069482 Ga0075367_100694822 375
299 3300006178 Ga0075367_10117834 Ga0075367_101178341 375
300 3300006358 Ga0068871_100129957 Ga0068871_1001299573 375
301 3300006881 Ga0068865_100051552 Ga0068865_1000515522 375
302 3300006914 Ga0075436_100059896 Ga0075436_1000598963 375
303 3300006942 Ga0099824_1018069 Ga0099824_10180692 375
304 3300006943 Ga0099822_1002451 Ga0099822_100245119 375
305 3300006944 Ga0099823_1000008 Ga0099823_100000827 375
306 3300007265 Ga0099794_10008174 Ga0099794_100081742 375
307 3300009098 Ga0105245_10036606 Ga0105245_100366062 375
308 3300009098 Ga0105245_10129889 Ga0105245_101298892 375
309 3300009177 Ga0105248_10098806 Ga0105248_100988062 375
310 3300009553 Ga0105249_10099753 Ga0105249_100997532 375
311 3300010159 Ga0099796_10040339 Ga0099796_100403392 375
312 3300011119 Ga0105246_10026343 Ga0105246_100263432 375
313 3300011119 Ga0105246_10037493 Ga0105246_100374933 375
314 3300013105 Ga0157369_10005626 Ga0157369_100056264 375
315 3300013297 Ga0157378_10221392 Ga0157378_102213921 375
316 3300013306 Ga0163162_10057676 Ga0163162_100576762 375
317 3300013307 Ga0157372_10606359 Ga0157372_106063591 375
318 3300013308 Ga0157375_10199359 Ga0157375_101993592 375
319 3300014745 Ga0157377_10010415 Ga0157377_100104154 375
320 3300014968 Ga0157379_10158937 Ga0157379_101589372 375
321 3300025230 Ga0209563_101355 Ga0209563_1013554 375
322 3300025253 Ga0209677_101299 Ga0209677_10129910 375
323 3300025297 Ga0209758_1000838 Ga0209758_100083814 375
324 3300025904 Ga0207647_10100163 Ga0207647_101001632 375
325 3300025911 Ga0207654_10108345 Ga0207654_101083451 375
326 3300025914 Ga0207671_10033512 Ga0207671_100335122 375
327 3300025919 Ga0207657_10143468 Ga0207657_101434681 375
328 3300025927 Ga0207687_10071482 Ga0207687_100714822 375
329 3300025928 Ga0207700_10005496 Ga0207700_100054967 375
330 3300025931 Ga0207644_10044368 Ga0207644_100443683 375
331 3300025932 Ga0207690_10220343 Ga0207690_102203432 375
332 3300025933 Ga0207706_10004262 Ga0207706_1000426212 375
333 3300025937 Ga0207669_10153189 Ga0207669_101531892 375
334 3300025938 Ga0207704_10034678 Ga0207704_100346782 375
335 3300025942 Ga0207689_10004916 Ga0207689_1000491612 375
336 3300025949 Ga0207667_10152275 Ga0207667_101522752 375
337 3300025949 Ga0207667_10429102 Ga0207667_104291022 375
338 3300025961 Ga0207712_10045668 Ga0207712_100456683 375
339 3300025972 Ga0207668_10026654 Ga0207668_100266542 375
340 3300025986 Ga0207658_10076760 Ga0207658_100767602 375
341 3300026023 Ga0207677_10143633 Ga0207677_101436332 375
342 3300026041 Ga0207639_10241654 Ga0207639_102416542 375
343 3300026067 Ga0207678_10005947 Ga0207678_100059475 375
344 3300026067 Ga0207678_10074942 Ga0207678_100749422 375
345 3300026067 Ga0207678_10193526 Ga0207678_101935262 375
346 3300026095 Ga0207676_10089245 Ga0207676_100892452 375
347 3300026116 Ga0207674_10074126 Ga0207674_100741262 375
348 3300026118 Ga0207675_100007890 Ga0207675_1000078909 375
349 3300026118 Ga0207675_100008391 Ga0207675_1000083917 375
350 3300026121 Ga0207683_10029523 Ga0207683_100295232 375
351 3300026121 Ga0207683_10033435 Ga0207683_100334354 375
352 3300026121 Ga0207683_10209975 Ga0207683_102099751 375
353 3300027296 Ga0209389_1000032 Ga0209389_100003286 375
354 3300027357 Ga0209589_1000001 Ga0209589_1000001601 375
355 3300027361 Ga0209489_100001 Ga0209489_100001601 375
356 3300027361 Ga0209489_100035 Ga0209489_10003593 375
357 3300027363 Ga0209700_100001 Ga0209700_100001601 375
358 3300027363 Ga0209700_100005 Ga0209700_10000596 375
359 3300027671 Ga0209588_1009814 Ga0209588_10098144 375
360 3300028379 Ga0268266_10129337 Ga0268266_101293372 375
361 3300028379 Ga0268266_10196501 Ga0268266_101965011 375
362 3300028380 Ga0268265_10009331 Ga0268265_100093317 375
363 3300031548 Ga0307408_100086408 Ga0307408_1000864082 375
364 3300031852 Ga0307410_10228990 Ga0307410_102289901 375
365 3300032133 Ga0316583_10029849 Ga0316583_100298491 375
366 3300033442 Ga0315911_1000007 Ga0315911_1000007289 375
367 3300037312 Ga0395899_0108144 Ga0395899_0108144_663_1790 375
368 3300037418 Ga0395900_0001627 Ga0395900_0001627_22728_23855 375
369 3300037466 Ga0395898_0089089 Ga0395898_0089089_1673_2800 375
370 3300037471 Ga0395905_0006705 Ga0395905_0006705_9393_10520 375
371 3300037471 Ga0395905_0007148 Ga0395905_0007148_8857_9984 375
372 3300037471 Ga0395905_0039184 Ga0395905_0039184_1764_2891 375
373 3300038443 Ga0395901_0002678 Ga0395901_0002678_14201_15328 375
374 3300038443 Ga0395901_0148994 Ga0395901_0148994_1295_2422 375
375 3300038443 Ga0395901_0256979 Ga0395901_0256979_616_1743 375
376 3300041460 Ga0451802_0236898 Ga0451802_0236898_106_1233 375
377 3300044683 Ga0466965_0052008 Ga0466965_0052008_310_1437 375
378 3300044842 Ga0466957_0022040 Ga0466957_0022040_912_2039 375
379 3300045976 Ga0466967_0018209 Ga0466967_0018209_4285_5454 375
380 3300046474 Ga0495605_0042868 Ga0495605_0042868_604_1731 375
381 3300047472 Ga0495686_0030778 Ga0495686_0030778_1931_3112 375
382 3300048905 Ga0496102_0099751 Ga0496102_0099751_1479_2606 375
383 3300048907 Ga0496104_0072073 Ga0496104_0072073_142_1269 375
384 3300048907 Ga0496104_0274015 Ga0496104_0274015_13_1140 375
385 3300048909 Ga0496106_0194457 Ga0496106_0194457_242_1369 375
386 3300048915 Ga0496112_0006407 Ga0496112_0006407_5493_6620 375
387 3300048921 Ga0496118_0066224 Ga0496118_0066224_1157_2284 375
388 3300048922 Ga0496119_0046846 Ga0496119_0046846_1214_2341 375
389 3300048924 Ga0496121_0000285 Ga0496121_0000285_31738_32919 375
390 3300048924 Ga0496121_0063201 Ga0496121_0063201_1567_2697 375
391 3300048929 Ga0496126_0008408 Ga0496126_0008408_3019_4146 375
392 3300048929 Ga0496126_0050365 Ga0496126_0050365_2371_3498 375
393 3300049568 Ga0501031_0000106 Ga0501031_0000106_26143_27270 375
394 3300049569 Ga0501032_0000086 Ga0501032_0000086_49658_50785 375
395 3300049570 Ga0501033_0002698 Ga0501033_0002698_4482_5609 375
396 3300049571 Ga0501034_0000108 Ga0501034_0000108_13503_14630 375
397 3300049571 Ga0501034_0265657 Ga0501034_0265657_446_1573 375
398 3300049572 Ga0501036_0000065 Ga0501036_0000065_1714_2841 375
399 3300049573 Ga0501037_0000173 Ga0501037_0000173_54794_55921 375
400 3300049574 Ga0501038_0000076 Ga0501038_0000076_58035_59162 375
401 3300049575 Ga0501039_0006739 Ga0501039_0006739_839_1966 375
402 3300049579 Ga0501043_0000459 Ga0501043_0000459_23226_24353 375
403 3300049579 Ga0501043_0090773 Ga0501043_0090773_952_2079 375
404 3300049580 Ga0501046_0000744 Ga0501046_0000744_14346_15473 375
405 3300049581 Ga0501047_0001887 Ga0501047_0001887_6898_8025 375
406 3300049582 Ga0501048_0000271 Ga0501048_0000271_27661_28788 375
407 3300049583 Ga0501067_0000176 Ga0501067_0000176_28191_29318 375
408 3300049584 Ga0501068_0005298 Ga0501068_0005298_5350_6477 375
409 3300049585 Ga0501069_0006051 Ga0501069_0006051_4395_5522 375
410 3300049586 Ga0501070_0026936 Ga0501070_0026936_2180_3307 375
411 3300049586 Ga0501070_0027625 Ga0501070_0027625_459_1586 375
412 3300049587 Ga0501071_0007508 Ga0501071_0007508_5340_6467 375
413 3300049588 Ga0501072_0014497 Ga0501072_0014497_4717_5844 375
414 3300049589 Ga0501073_0000058 Ga0501073_0000058_46069_47196 375
415 3300049741 Ga0501079_0004672 Ga0501079_0004672_1417_2544 375
416 3300049742 Ga0501080_0002986 Ga0501080_0002986_7732_8859 375
417 3300049742 Ga0501080_0150864 Ga0501080_0150864_896_2023 375
418 3300049744 Ga0501083_0017843 Ga0501083_0017843_2944_4071 375
419 3300049822 Ga0501035_0000079 Ga0501035_0000079_12285_13412 375
420 3300049823 Ga0501044_0000085 Ga0501044_0000085_106954_108081 375
421 3300049824 Ga0501045_0024196 Ga0501045_0024196_2219_3346 375
422 3300050492 nmdc:mga0yw44_12912_c1 nmdc:mga0yw44_12912_c1_2917_4044 375
423 3300050492 nmdc:mga0yw44_221429_c1 nmdc:mga0yw44_221429_c1_105_1232 375
424 3300050516 nmdc:mga0sz30_69587_c1 nmdc:mga0sz30_69587_c1_48_1175 375
425 3300053087 Ga0500643_000007 Ga0500643_000007_194468_195595 375
426 3300053093 Ga0500651_0004111 Ga0500651_0004111_630_1757 375
427 3300053096 Ga0500641_0013196 Ga0500641_0013196_1197_2324 375
428 3300053096 Ga0500641_0084636 Ga0500641_0084636_49_1176 375
429 3300053103 Ga0500555_000904 Ga0500555_000904_7068_8195 375
430 3300053111 Ga0500572_000504 Ga0500572_000504_1412_2539 375
431 3300053119 Ga0500595_001362 Ga0500595_001362_5431_6612 375
432 3300053119 Ga0500595_001888 Ga0500595_001888_6647_7774 375
433 3300053119 Ga0500595_009136 Ga0500595_009136_2273_3400 375
434 3300053119 Ga0500595_028591 Ga0500595_028591_42_1169 375
435 3300053134 Ga0500658_0016263 Ga0500658_0016263_1543_2670 375
436 3300053136 Ga0500559_0000120 Ga0500559_0000120_41747_42874 375
437 3300053139 Ga0500568_0055306 Ga0500568_0055306_273_1400 375
438 3300053151 Ga0500604_0003903 Ga0500604_0003903_1570_2697 375
439 3300053735 Ga0500596_002398 Ga0500596_002398_1907_3034 375
440 3300054114 Ga0501084_0026023 Ga0501084_0026023_867_1994 375
441 iso_pu_bacteria 2885383462 2885385210 375

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13378

MR_MLE_C

Enolase C-terminal domain-like

173

386

0.95

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

26

155

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ddm-assembly1.cif.gz_A crystal structure of mandelate racemase/muconate lactonizing enzyme from bordetella bronchiseptica rb50 0.9622 5 372
3ddm-assembly1.cif.gz_A crystal structure of mandelate racemase/muconate lactonizing enzyme from bordetella bronchiseptica rb50 0.9544 5 372
3ck5-assembly2.cif.gz_D crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium 0.9199 7 371
3ck5-assembly2.cif.gz_D crystal structure of a racemase from streptomyces coelicolor a3(2) with bound magnesium 0.9146 7 371
5olc-assembly1.cif.gz_F crystal structure of the 3,6-anhydro-d-galactonate cycloisomerase from zobellia galactanivorans 0.905 7 375
ID Description Score Start End Superfamily
3ddmA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9755 131 363 3.20.20.120
3ddmA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9695 5 128 3.30.390.10
3ddmA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9514 131 363 3.20.20.120
4hpnA01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9188 7 128 3.30.390.10
3ck5D02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9079 130 365 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A1Z8NUM1-F1-model_v4 Mandelate racemase 0.9675 8 375 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-A0A3D3LHX9-F1-model_v4 Mandelate racemase 0.9674 107 308 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-A0A7Y6NK70-F1-model_v4 Mandelate racemase/muconate lactonizing enzyme family protein 0.9646 1 372 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-A0A6M1Q435-F1-model_v4 deleted 0.9623 2 375
AF-A0A2Z2NZI1-F1-model_v4 L-talarate/galactarate dehydratase (EC 4.2.1.156) 0.9604 2 375 GO:0000287
GO:0016052
GO:0016836

Feature Viewer

pLDDT pTM Quality
93.19 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map