F444714

General Info

Members Datasets Scaffolds Average Seq Length
441 308 373 259

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0246126|Ga0451577_0246126_681_1490
Length 269
Sequence VYKTDVPAFDGAKQKFSGVGMIHFTAVNKWFDKLHVLNDINLHVKSGEVVVVCGPSGSGKSTLIRTINQLEPIDNGKLIVDGMDLSDKKTDINKLRAEIGFVFQQFNLYPHLSVIRNITLAPTKLRGLSQKEANEQAMQLLSRVGLAEKRDAFPAQLSGGQQQRVAIARGLAMKPRIMLFDEPTSALDPEMIGEVLAVMQDLARSGMTMVVVTHEMGFAREVAHRVVFMDAGTILEEAPPADFFCNPQHDRAKQFLNQLLTPMHGALCA

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
4 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
5 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
6 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
7 2643221647 Streptomyces sp. Root369 Isolate Unclassified
8 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
9 2643221714 Streptomyces sp. Root264 Isolate Unclassified
10 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
11 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
12 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
13 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
14 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
15 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
16 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
17 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
18 2808606448 Streptomyces sp. 193411 Isolate Unclassified
19 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
20 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
21 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
22 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
23 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
24 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
25 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
26 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
27 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
28 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
29 2862574272 Streptomyces sp. AcE210 Isolate Nodule
30 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
31 2867428634 Streptomyces sp. RP5T Isolate Unclassified
32 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
33 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
34 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
35 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
36 2904504865 Serratia marcescens 1822 Isolate Unclassified
37 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
38 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
39 2919150387 Rahnella aceris 1817 Isolate Unclassified
40 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
41 2927143783 Rahnella sp. 2050 Isolate Unclassified
42 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
43 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
44 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
45 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
46 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
47 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
48 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
49 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
50 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
51 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
52 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
53 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
54 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
55 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
56 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
57 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
58 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
59 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
60 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
61 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
62 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
63 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
64 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
65 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
66 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
67 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
68 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
69 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
71 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
72 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
73 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
74 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
75 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
76 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
77 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
78 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
79 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
80 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
81 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
104 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
107 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
108 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
112 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
113 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
114 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
128 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
129 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
130 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
131 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
132 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
133 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
134 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
135 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
136 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
141 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
142 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
143 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
146 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
151 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
152 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
153 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
154 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
155 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
156 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
157 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
158 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
159 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
160 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
161 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
162 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
163 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
164 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
165 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
170 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
171 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
172 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
173 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
174 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
175 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
176 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
177 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
185 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
186 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
189 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
190 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
191 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
192 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
200 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
201 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
202 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
203 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
209 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
212 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
213 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
214 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
215 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
216 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
220 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
224 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
225 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
226 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
232 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
233 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
236 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
237 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
238 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
239 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
240 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
241 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
242 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
243 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
244 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
250 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
255 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
256 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
257 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
258 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
259 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
275 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
280 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
281 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
282 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
283 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
284 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
286 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
287 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
290 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
293 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
294 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
295 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
296 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
297 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
298 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
299 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
300 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
301 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
303 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
304 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
305 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
306 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
307 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
308 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.35
Metatranscriptomes 0.23
Isolates 15.42

Biome Distribution

Category Percentage (%)
Aerial Root 0.45
Bulb 0
Endosphere 11.11
Nodule 0.68
Rhizoplane 1.13
Rhizosphere 70.29
Stem 0
Stem Tuber 0.23
Unclassified 16.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_285185 2162886007 Bacteria 4091
2 JGI24739J22299_10015397 3300001989 Bacteria 2778
3 JGI24735J21928_10019033 3300002067 Bacteria 2114
4 JGI24738J21930_10016298 3300002075 Bacteria 1571
5 JGI25163J39215_1000070 3300002771 Bacteria 46438
6 JGI25164J39214_1000218 3300002772 Bacteria 46437
7 JGI25406J46586_10028011 3300003203 Bacteria 2152
8 JGI25160J50197_1019415 3300003354 Bacteria 2084
9 Ga0006562J51391_1148475 3300003578 Bacteria 6820
10 Ga0055538_1000154 3300003751 Bacteria 46437
11 Ga0055539_1000204 3300003752 Bacteria 46437
12 Ga0055533_1000206 3300003756 Bacteria 46437
13 Ga0055525_1000283 3300003759 Bacteria 46437
14 Ga0055541_1000132 3300003841 Bacteria 46437
15 Ga0065704_10002096 3300005289 Bacteria 6979
16 Ga0065704_10200465 3300005289 Bacteria 1149
17 Ga0065707_10125789 3300005295 Bacteria 2005
18 Ga0070667_100079721 3300005367 Bacteria 2799
19 Ga0070685_10109678 3300005466 Bacteria 1698
20 Ga0070707_100029642 3300005468 Bacteria 5209
21 Ga0068857_100280640 3300005577 Bacteria 1532
22 Ga0068863_100188299 3300005841 Bacteria 1983
23 Ga0068860_100045816 3300005843 Bacteria 4170
24 Ga0081455_10029505 3300005937 Bacteria 5001
25 Ga0081539_10001842 3300005985 Bacteria 33429
26 Ga0075365_10149710 3300006038 Bacteria 1623
27 Ga0075365_10175508 3300006038 Bacteria 1497
28 Ga0075365_10369065 3300006038 Bacteria 1012
29 Ga0075363_100009871 3300006048 Bacteria 4505
30 Ga0075363_100159740 3300006048 Bacteria 1276
31 Ga0075363_100198274 3300006048 Bacteria 1146
32 Ga0075364_10118408 3300006051 Bacteria 1771
33 Ga0075364_10241006 3300006051 Bacteria 1228
34 Ga0075367_10000989 3300006178 Bacteria 11639
35 Ga0075367_10060949 3300006178 Bacteria 2251
36 Ga0075367_10131641 3300006178 Bacteria 1546
37 Ga0075367_10203695 3300006178 Bacteria 1236
38 Ga0075369_10033456 3300006186 Bacteria 2179
39 Ga0097621_100616666 3300006237 Bacteria 993
40 Ga0105244_10004293 3300009036 Bacteria 9866
41 Ga0105244_10237879 3300009036 Bacteria 851
42 Ga0105250_10000017 3300009092 Bacteria 255998
43 Ga0105250_10000100 3300009092 Bacteria 77155
44 Ga0105250_10000467 3300009092 Bacteria 28775
45 Ga0105240_10199245 3300009093 Bacteria 2348
46 Ga0114129_10202254 3300009147 Bacteria 2689
47 Ga0105243_10142509 3300009148 Bacteria 2046
48 Ga0105246_10023195 3300011119 Bacteria 4012
49 Ga0157369_10110440 3300013105 Bacteria 2923
50 Ga0157378_10279203 3300013297 Bacteria 1609
51 Ga0163162_10199290 3300013306 Bacteria 2130
52 Ga0163163_10032922 3300014325 Bacteria 5009
53 Ga0163163_10159297 3300014325 Bacteria 2302
54 Ga0182008_10002609 3300014497 Bacteria 11192
55 Ga0182006_1029229 3300015261 Bacteria 2234
56 Ga0182007_10001697 3300015262 Bacteria 11631
57 Ga0183367_1006 3300015688 Bacteria 648044
58 Ga0209760_100137 3300025207 Bacteria 46738
59 Ga0209784_100001 3300025224 Bacteria 3600592
60 Ga0209566_100001 3300025225 Bacteria 3600765
61 Ga0209674_100002 3300025226 Bacteria 3600592
62 Ga0209563_100008 3300025230 Bacteria 1554545
63 Ga0207427_100231 3300025231 Bacteria 46613
64 Ga0209437_100007 3300025233 Bacteria 938377
65 Ga0209677_100004 3300025253 Bacteria 1554545
66 Ga0209233_1001965 3300025261 Bacteria 7821
67 Ga0207696_1000013 3300025711 Bacteria 524881
68 Ga0207696_1000561 3300025711 Bacteria 29454
69 Ga0207655_1000227 3300025728 Bacteria 94083
70 Ga0207647_10040035 3300025904 Bacteria 2953
71 Ga0207646_10187892 3300025922 Bacteria 1866
72 Ga0207709_10148073 3300025935 Bacteria 1622
73 Ga0207691_10144696 3300025940 Bacteria 2093
74 Ga0207703_10281842 3300026035 Bacteria 1509
75 Ga0207639_10654835 3300026041 Bacteria 972
76 Ga0207641_10073901 3300026088 Bacteria 2939
77 Ga0207674_10373641 3300026116 Bacteria 1378
78 Ga0209371_1004107 3300027312 Bacteria 6543
79 Ga0209371_1019900 3300027312 Bacteria 1664
80 Ga0265319_1008140 3300028563 Bacteria 4624
81 Ga0307517_10067484 3300028786 Bacteria 3273
82 Ga0307515_10000695 3300028794 Bacteria 77582
83 Ga0307515_10071694 3300028794 Bacteria 4690
84 Ga0265324_10036759 3300029957 Bacteria 1702
85 Ga0268256_1003851 3300030500 Bacteria 6543
86 Ga0268256_1022291 3300030500 Bacteria 1664
87 Ga0307511_10005119 3300030521 Bacteria 13360
88 Ga0307512_10002125 3300030522 Bacteria 26015
89 Ga0307512_10017988 3300030522 Bacteria 6467
90 Ga0265330_10085503 3300031235 Bacteria 1356
91 Ga0265325_10005163 3300031241 Bacteria 8119
92 Ga0265339_10007492 3300031249 Bacteria 7046
93 Ga0265339_10067196 3300031249 Bacteria 1918
94 Ga0265316_10025803 3300031344 Bacteria 4898
95 Ga0307513_10010282 3300031456 Bacteria 11746
96 Ga0307513_10026799 3300031456 Bacteria 6630
97 Ga0307509_10020845 3300031507 Bacteria 7432
98 Ga0307509_10028168 3300031507 Bacteria 6248
99 Ga0307509_10209092 3300031507 Bacteria 1778
100 Ga0307509_10324822 3300031507 Bacteria 1273
101 Ga0265313_10073803 3300031595 Bacteria 1565
102 Ga0307508_10006797 3300031616 Bacteria 10706
103 Ga0307508_10050388 3300031616 Bacteria 3706
104 Ga0307508_10092707 3300031616 Bacteria 2610
105 Ga0307508_10225425 3300031616 Bacteria 1473
106 Ga0307514_10028537 3300031649 Bacteria 4499
107 Ga0307514_10048955 3300031649 Bacteria 3288
108 Ga0307514_10270889 3300031649 Bacteria 983
109 Ga0265342_10147146 3300031712 Bacteria 1311
110 Ga0307516_10006238 3300031730 Bacteria 14019
111 Ga0307516_10027584 3300031730 Bacteria 5758
112 Ga0307516_10118919 3300031730 Bacteria 2436
113 Ga0307516_10157449 3300031730 Bacteria 2025
114 Ga0307518_10016762 3300031838 Bacteria 5254
115 Ga0307518_10219553 3300031838 Bacteria 1242
116 Ga0307410_10364424 3300031852 Bacteria 1158
117 Ga0307410_10409994 3300031852 Bacteria 1097
118 Ga0307409_100454135 3300031995 Bacteria 1237
119 Ga0307409_100507307 3300031995 Bacteria 1176
120 Ga0307409_100712459 3300031995 Bacteria 1004
121 Ga0307510_10034504 3300033180 Bacteria 5663
122 Ga0307510_10066029 3300033180 Bacteria 3657
123 Ga0307510_10075816 3300033180 Bacteria 3312
124 Ga0395900_0034960 3300037418 Bacteria 5176
125 Ga0395900_0539745 3300037418 Bacteria 1112
126 Ga0395898_0011860 3300037466 Bacteria 9027
127 Ga0395898_0347306 3300037466 Bacteria 1415
128 Ga0395905_0062378 3300037471 Bacteria 3487
129 Ga0395901_0013117 3300038443 Bacteria 8411
130 Ga0439436_0004952 3300041404 Bacteria 4081
131 Ga0439439_0002506 3300041406 Bacteria 3915
132 Ga0439466_0095179 3300041411 Bacteria 932
133 Ga0451837_1542949 3300041494 Bacteria 5007
134 Ga0451853_0422748 3300041512 Bacteria 3329
135 Ga0451853_0924574 3300041512 Bacteria 2555
136 Ga0451853_1070113 3300041512 Bacteria 4117
137 Ga0439433_0000214 3300041999 Bacteria 9465
138 Ga0439433_0005455 3300041999 Bacteria 2731
139 Ga0439449_0000445 3300042007 Bacteria 15371
140 Ga0439449_0155131 3300042007 Bacteria 854
141 Ga0439455_0000658 3300042012 Bacteria 5062
142 Ga0439457_001001 3300042014 Bacteria 8517
143 Ga0439457_001663 3300042014 Bacteria 6605
144 Ga0450903_000659 3300042138 Bacteria 6954
145 Ga0439458_0028322 3300042157 Bacteria 1326
146 Ga0450901_011456 3300042533 Bacteria 921
147 Ga0451577_0000098 3300042876 Bacteria 192790
148 Ga0451577_0000455 3300042876 Bacteria 71135
149 Ga0451577_0002227 3300042876 Bacteria 23587
150 Ga0451577_0246126 3300042876 Bacteria 1618
151 Ga0466969_0006926 3300044656 Bacteria 6032
152 Ga0466972_0002637 3300044658 Bacteria 8887
153 Ga0466972_0038943 3300044658 Bacteria 2322
154 Ga0466972_0061055 3300044658 Bacteria 1808
155 Ga0453683_0000001 3300044673 Bacteria 1384965
156 Ga0453683_0047397 3300044673 Bacteria 2695
157 Ga0453683_0068615 3300044673 Bacteria 2217
158 Ga0453683_0349894 3300044673 Bacteria 949
159 Ga0466965_0019514 3300044683 Bacteria 3254
160 Ga0466966_0072631 3300044684 Bacteria 2153
161 Ga0466966_0144811 3300044684 Bacteria 1451
162 Ga0466961_0043778 3300044693 Bacteria 2866
163 Ga0466963_0003713 3300044694 Bacteria 8780
164 Ga0466963_0008281 3300044694 Bacteria 6229
165 Ga0466963_0021409 3300044694 Bacteria 4079
166 Ga0466964_0004493 3300044706 Bacteria 5152
167 Ga0466964_0049442 3300044706 Bacteria 1722
168 Ga0453684_0000347 3300044712 Bacteria 192636
169 Ga0453684_0006412 3300044712 Bacteria 22402
170 Ga0453684_0006961 3300044712 Bacteria 21161
171 Ga0453684_0017389 3300044712 Bacteria 11142
172 Ga0453684_0046303 3300044712 Bacteria 5786
173 Ga0453684_0055575 3300044712 Bacteria 5146
174 Ga0453684_0324640 3300044712 Bacteria 1742
175 Ga0466971_0002360 3300044719 Bacteria 7968
176 Ga0466971_0234691 3300044719 Bacteria 871
177 Ga0466968_0003383 3300044735 Bacteria 5897
178 Ga0466970_0000631 3300044765 Bacteria 17315
179 Ga0466970_0014632 3300044765 Bacteria 4030
180 Ga0466970_0026282 3300044765 Bacteria 3051
181 Ga0466957_0002961 3300044842 Bacteria 9208
182 Ga0466960_0004911 3300044901 Bacteria 5262
183 Ga0466959_0020530 3300045049 Bacteria 4868
184 Ga0451576_0004285 3300045051 Bacteria 18682
185 Ga0451576_0673181 3300045051 Bacteria 1087
186 Ga0466967_0003334 3300045976 Bacteria 10436
187 Ga0466967_0147826 3300045976 Bacteria 2193
188 Ga0495592_0004983 3300046454 Bacteria 9772
189 Ga0495592_0021458 3300046454 Bacteria 4911
190 Ga0495603_0009584 3300046455 Bacteria 5855
191 Ga0495603_0037617 3300046455 Bacteria 2903
192 Ga0495603_0074075 3300046455 Bacteria 1999
193 Ga0495590_0015322 3300046457 Bacteria 2784
194 Ga0495629_0004693 3300046459 Bacteria 10238
195 Ga0495629_0008009 3300046459 Bacteria 7774
196 Ga0495629_0012941 3300046459 Bacteria 6034
197 Ga0495629_0018900 3300046459 Bacteria 4926
198 Ga0495629_0228317 3300046459 Bacteria 1283
199 Ga0495638_0069795 3300046460 Bacteria 2153
200 Ga0495638_0070162 3300046460 Bacteria 2146
201 Ga0495638_0163483 3300046460 Bacteria 1282
202 Ga0495651_0001366 3300046462 Bacteria 18879
203 Ga0495653_0157207 3300046463 Bacteria 1582
204 Ga0495650_0000090 3300046471 Bacteria 232897
205 Ga0495580_0344402 3300046472 Bacteria 1010
206 Ga0495605_0008776 3300046474 Bacteria 5703
207 Ga0495662_0003922 3300046476 Bacteria 7501
208 Ga0495662_0149474 3300046476 Bacteria 1150
209 Ga0495662_0176018 3300046476 Bacteria 1054
210 Ga0495664_0001072 3300046477 Bacteria 14156
211 Ga0495585_0137744 3300046492 Bacteria 1280
212 Ga0495594_0004485 3300046499 Bacteria 7177
213 Ga0495594_0006434 3300046499 Bacteria 6043
214 Ga0495594_0215272 3300046499 Bacteria 1095
215 Ga0495596_0040131 3300046500 Bacteria 1848
216 Ga0495607_0041439 3300046501 Bacteria 2735
217 Ga0495583_0093374 3300046506 Bacteria 1292
218 Ga0495606_0020908 3300046507 Bacteria 4807
219 Ga0495608_0066237 3300046511 Bacteria 2365
220 Ga0495610_0011233 3300046512 Bacteria 5490
221 Ga0495616_0034184 3300046513 Bacteria 2642
222 Ga0495618_0004000 3300046514 Bacteria 9090
223 Ga0495618_0138368 3300046514 Bacteria 1557
224 Ga0495620_0063015 3300046515 Bacteria 1538
225 Ga0495620_0066605 3300046515 Bacteria 1483
226 Ga0495628_0070771 3300046516 Bacteria 2719
227 Ga0495630_0036560 3300046517 Bacteria 3671
228 Ga0495643_0132398 3300046522 Bacteria 1250
229 Ga0495643_0132530 3300046522 Bacteria 1250
230 Ga0495648_0018669 3300046524 Bacteria 4898
231 Ga0495666_0007728 3300046526 Bacteria 5380
232 Ga0495642_0032772 3300046528 Bacteria 2086
233 Ga0495652_0007882 3300046529 Bacteria 9779
234 Ga0495652_0064255 3300046529 Bacteria 3087
235 Ga0495640_0030457 3300046533 Bacteria 3864
236 Ga0495640_0043369 3300046533 Bacteria 3133
237 Ga0495609_0086873 3300046538 Bacteria 1363
238 Ga0495597_0080131 3300046542 Bacteria 1397
239 Ga0495645_0010337 3300046543 Bacteria 6542
240 Ga0495622_0017815 3300046557 Bacteria 3306
241 Ga0495633_0041612 3300046558 Bacteria 2184
242 Ga0495656_0122217 3300046615 Bacteria 1230
243 Ga0495668_0025816 3300046616 Bacteria 3336
244 Ga0495634_0000693 3300046642 Bacteria 32807
245 Ga0495634_0088603 3300046642 Bacteria 2012
246 Ga0495611_0021902 3300046648 Bacteria 2762
247 Ga0495625_0016445 3300046660 Bacteria 5823
248 Ga0495625_0021660 3300046660 Bacteria 4944
249 Ga0495635_0004008 3300046663 Bacteria 10226
250 Ga0495635_0073848 3300046663 Bacteria 2336
251 Ga0495661_0179173 3300046665 Bacteria 1124
252 Ga0495588_0007085 3300046674 Bacteria 5081
253 Ga0495657_0001931 3300046675 Bacteria 17665
254 Ga0495657_0030582 3300046675 Bacteria 3769
255 Ga0495657_0102519 3300046675 Bacteria 1821
256 Ga0495657_0173288 3300046675 Bacteria 1327
257 Ga0495658_0346688 3300046683 Bacteria 944
258 Ga0495613_0000959 3300046689 Bacteria 22049
259 Ga0495613_0025905 3300046689 Bacteria 4369
260 Ga0495613_0044569 3300046689 Bacteria 3281
261 Ga0495624_0239859 3300046690 Bacteria 1097
262 Ga0495671_0001940 3300046692 Bacteria 13261
263 Ga0495649_0065591 3300046694 Bacteria 1949
264 Ga0495649_0124221 3300046694 Bacteria 1363
265 Ga0495589_0032181 3300046794 Bacteria 2637
266 Ga0495589_0034073 3300046794 Bacteria 2556
267 Ga0495589_0118991 3300046794 Bacteria 1272
268 Ga0495600_0061967 3300046809 Bacteria 2443
269 Ga0495660_0000028 3300046810 Bacteria 244534
270 Ga0495581_0012215 3300047315 Bacteria 4973
271 Ga0495581_0147352 3300047315 Bacteria 1374
272 Ga0495604_0001488 3300047317 Bacteria 19319
273 Ga0495636_0001145 3300047318 Bacteria 9999
274 Ga0495636_0073374 3300047318 Bacteria 1464
275 Ga0495674_0053929 3300047319 Bacteria 3532
276 Ga0495674_0087164 3300047319 Bacteria 2672
277 Ga0495676_0031181 3300047321 Bacteria 4511
278 Ga0495676_0061441 3300047321 Bacteria 2938
279 Ga0495676_0235264 3300047321 Bacteria 1256
280 Ga0495676_0270779 3300047321 Bacteria 1152
281 Ga0495680_0006340 3300047322 Bacteria 11010
282 Ga0495687_003341 3300047443 Bacteria 11727
283 Ga0495687_010785 3300047443 Bacteria 4974
284 Ga0495687_113596 3300047443 Bacteria 990
285 Ga0495685_001588 3300047447 Bacteria 7000
286 Ga0495685_048832 3300047447 Bacteria 1438
287 Ga0495685_054707 3300047447 Bacteria 1350
288 Ga0495681_0001099 3300047470 Bacteria 20532
289 Ga0495681_0102873 3300047470 Bacteria 1246
290 Ga0495681_0137054 3300047470 Bacteria 1037
291 Ga0495684_0055472 3300047471 Bacteria 3022
292 Ga0495686_0072013 3300047472 Bacteria 2126
293 Ga0495593_0001353 3300047673 Bacteria 14304
294 Ga0495602_0077127 3300048088 Bacteria 2821
295 Ga0495602_0180560 3300048088 Bacteria 1628
296 Ga0495614_0019223 3300048089 Bacteria 2956
297 Ga0495626_0104860 3300048091 Bacteria 1229
298 Ga0496102_0000115 3300048905 Bacteria 114224
299 Ga0496103_0000008 3300048906 Bacteria 340474
300 Ga0496104_0001929 3300048907 Bacteria 17981
301 Ga0496108_0000149 3300048911 Bacteria 67412
302 Ga0496116_0000613 3300048919 Bacteria 47094
303 Ga0496117_0023140 3300048920 Bacteria 4962
304 Ga0496118_0008108 3300048921 Bacteria 10944
305 Ga0496119_0039344 3300048922 Bacteria 3040
306 Ga0496120_0006609 3300048923 Bacteria 8845
307 Ga0496122_0000058 3300048925 Bacteria 248805
308 Ga0496122_0064172 3300048925 Bacteria 2674
309 Ga0496123_0000044 3300048926 Bacteria 253396
310 Ga0496124_0000092 3300048927 Bacteria 189213
311 Ga0496125_0000103 3300048928 Bacteria 201675
312 Ga0496125_0070665 3300048928 Bacteria 2732
313 Ga0496126_0002455 3300048929 Bacteria 25034
314 Ga0496126_0037720 3300048929 Bacteria 4506
315 Ga0495678_059675 3300049459 Bacteria 1437
316 Ga0501032_0020351 3300049569 Bacteria 4622
317 Ga0501032_0184027 3300049569 Bacteria 1367
318 Ga0501033_0001126 3300049570 Bacteria 24221
319 Ga0501033_0023936 3300049570 Bacteria 4607
320 Ga0501034_0002960 3300049571 Bacteria 19682
321 Ga0501034_0011637 3300049571 Bacteria 9108
322 Ga0501034_0033456 3300049571 Bacteria 5215
323 Ga0501036_0000215 3300049572 Bacteria 38553
324 Ga0501036_0048208 3300049572 Bacteria 3607
325 Ga0501036_0068556 3300049572 Bacteria 3002
326 Ga0501037_0001797 3300049573 Bacteria 15585
327 Ga0501037_0074997 3300049573 Bacteria 2457
328 Ga0501038_0010940 3300049574 Bacteria 8289
329 Ga0501038_0062241 3300049574 Bacteria 3188
330 Ga0501038_0103742 3300049574 Bacteria 2364
331 Ga0501039_0003900 3300049575 Bacteria 11202
332 Ga0501040_0037536 3300049576 Bacteria 3292
333 Ga0501042_0093680 3300049578 Bacteria 2157
334 Ga0501043_0024747 3300049579 Bacteria 4708
335 Ga0501043_0037536 3300049579 Bacteria 3811
336 Ga0501046_0004066 3300049580 Bacteria 13343
337 Ga0501046_0077702 3300049580 Bacteria 2569
338 Ga0501047_0026264 3300049581 Bacteria 5602
339 Ga0501047_0253402 3300049581 Bacteria 1608
340 Ga0501048_0002036 3300049582 Bacteria 15354
341 Ga0501048_0031486 3300049582 Bacteria 3837
342 Ga0501070_0003339 3300049586 Bacteria 13931
343 Ga0501072_0139154 3300049588 Bacteria 1935
344 Ga0501074_0004622 3300049590 Bacteria 9855
345 Ga0501080_0137494 3300049742 Bacteria 2260
346 Ga0501035_0000861 3300049822 Bacteria 32362
347 Ga0501035_0013980 3300049822 Bacteria 7405
348 Ga0501035_0201739 3300049822 Bacteria 1705
349 Ga0501044_0016162 3300049823 Bacteria 8021
350 Ga0501044_0245189 3300049823 Bacteria 1734
351 Ga0501044_0326664 3300049823 Bacteria 1457
352 Ga0501045_0313034 3300049824 Bacteria 1168
353 nmdc:mga03n38_50825_c1 3300050490 Bacteria 1849
354 nmdc:mga03n38_95417_c1 3300050490 Bacteria 1425
355 nmdc:mga00v17_129250_c1 3300050491 Bacteria 1613
356 nmdc:mga00v17_176320_c1 3300050491 Bacteria 1379
357 nmdc:mga00v17_56576_c1 3300050491 Bacteria 2398
358 nmdc:mga00v17_66526_c1 3300050491 Bacteria 2225
359 nmdc:mga06z11_3595_c1 3300050494 Bacteria 6009
360 nmdc:mga04h51_145161_c1 3300050495 Bacteria 903
361 nmdc:mga07m45_118792_c1 3300050496 Bacteria 1526
362 Ga0495601_0167729 3300053077 Bacteria 1435
363 Ga0500610_0047104 3300053079 Bacteria 2240
364 Ga0500583_0127172 3300053092 Bacteria 1263
365 Ga0500640_006446 3300053095 Bacteria 4482
366 Ga0500641_0049931 3300053096 Bacteria 1718
367 Ga0500560_000116 3300053107 Bacteria 8366
368 Ga0500572_010892 3300053111 Bacteria 2187
369 Ga0500618_005766 3300053125 Bacteria 3724
370 Ga0500573_0116954 3300053140 Bacteria 1487
371 Ga0500600_0037731 3300053149 Bacteria 2800
372 Ga0500624_004967 3300053157 Bacteria 1760
373 Ga0466962_0001024 3300061719 Bacteria 12785

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041512 Ga0451853_0924574 Ga0451853_0924574_1892_2545 214
2 3300005466 Ga0070685_10109678 Ga0070685_101096782 233
3 3300041411 Ga0439466_0095179 Ga0439466_0095179_200_907 233
4 iso_pu_bacteria 2984527788 2984527847 238
5 iso_pu_bacteria 2984532647 2984533958 238
6 iso_pu_bacteria 2751185782 2753268954 239
7 3300001989 JGI24739J22299_10015397 JGI24739J22299_100153973 240
8 3300002067 JGI24735J21928_10019033 JGI24735J21928_100190332 240
9 3300002075 JGI24738J21930_10016298 JGI24738J21930_100162982 240
10 3300003354 JGI25160J50197_1019415 JGI25160J50197_10194153 240
11 3300003578 Ga0006562J51391_1148475 Ga0006562J51391_11484756 240
12 3300005577 Ga0068857_100280640 Ga0068857_1002806402 240
13 3300005937 Ga0081455_10029505 Ga0081455_100295056 240
14 3300006048 Ga0075363_100009871 Ga0075363_1000098711 240
15 3300006048 Ga0075363_100198274 Ga0075363_1001982742 240
16 3300006178 Ga0075367_10000989 Ga0075367_100009893 240
17 3300006178 Ga0075367_10203695 Ga0075367_102036952 240
18 3300009036 Ga0105244_10237879 Ga0105244_102378791 240
19 3300009092 Ga0105250_10000017 Ga0105250_1000001764 240
20 3300009148 Ga0105243_10142509 Ga0105243_101425093 240
21 3300011119 Ga0105246_10023195 Ga0105246_100231954 240
22 3300013105 Ga0157369_10110440 Ga0157369_101104402 240
23 3300014497 Ga0182008_10002609 Ga0182008_100026092 240
24 3300015261 Ga0182006_1029229 Ga0182006_10292293 240
25 3300015262 Ga0182007_10001697 Ga0182007_1000169711 240
26 3300015688 Ga0183367_1006 Ga0183367_1006214 240
27 3300025904 Ga0207647_10040035 Ga0207647_100400353 240
28 3300025935 Ga0207709_10148073 Ga0207709_101480733 240
29 3300025940 Ga0207691_10144696 Ga0207691_101446962 240
30 3300026041 Ga0207639_10654835 Ga0207639_106548351 240
31 3300027312 Ga0209371_1019900 Ga0209371_10199002 240
32 3300028786 Ga0307517_10067484 Ga0307517_100674842 240
33 3300028794 Ga0307515_10000695 Ga0307515_1000069562 240
34 3300028794 Ga0307515_10071694 Ga0307515_100716944 240
35 3300030500 Ga0268256_1022291 Ga0268256_10222912 240
36 3300030521 Ga0307511_10005119 Ga0307511_100051199 240
37 3300030522 Ga0307512_10002125 Ga0307512_100021256 240
38 3300030522 Ga0307512_10017988 Ga0307512_100179884 240
39 3300031456 Ga0307513_10026799 Ga0307513_100267996 240
40 3300031507 Ga0307509_10020845 Ga0307509_100208456 240
41 3300031507 Ga0307509_10209092 Ga0307509_102090922 240
42 3300031507 Ga0307509_10324822 Ga0307509_103248221 240
43 3300031616 Ga0307508_10006797 Ga0307508_100067979 240
44 3300031616 Ga0307508_10050388 Ga0307508_100503882 240
45 3300031616 Ga0307508_10092707 Ga0307508_100927073 240
46 3300031616 Ga0307508_10225425 Ga0307508_102254252 240
47 3300031649 Ga0307514_10028537 Ga0307514_100285374 240
48 3300031649 Ga0307514_10048955 Ga0307514_100489552 240
49 3300031649 Ga0307514_10270889 Ga0307514_102708891 240
50 3300031730 Ga0307516_10006238 Ga0307516_1000623811 240
51 3300031730 Ga0307516_10027584 Ga0307516_100275842 240
52 3300031730 Ga0307516_10118919 Ga0307516_101189192 240
53 3300031730 Ga0307516_10157449 Ga0307516_101574492 240
54 3300031838 Ga0307518_10016762 Ga0307518_100167623 240
55 3300031838 Ga0307518_10219553 Ga0307518_102195532 240
56 3300031852 Ga0307410_10409994 Ga0307410_104099941 240
57 3300031995 Ga0307409_100712459 Ga0307409_1007124592 240
58 3300033180 Ga0307510_10034504 Ga0307510_100345046 240
59 3300033180 Ga0307510_10066029 Ga0307510_100660293 240
60 3300033180 Ga0307510_10075816 Ga0307510_100758164 240
61 3300037418 Ga0395900_0034960 Ga0395900_0034960_844_1626 240
62 3300037418 Ga0395900_0539745 Ga0395900_0539745_29_850 240
63 3300037466 Ga0395898_0011860 Ga0395898_0011860_8063_8845 240
64 3300037471 Ga0395905_0062378 Ga0395905_0062378_1500_2282 240
65 3300038443 Ga0395901_0013117 Ga0395901_0013117_595_1377 240
66 3300041404 Ga0439436_0004952 Ga0439436_0004952_2793_3617 240
67 3300041406 Ga0439439_0002506 Ga0439439_0002506_2108_2932 240
68 3300041494 Ga0451837_1542949 Ga0451837_1542949_2977_3807 240
69 3300041512 Ga0451853_0422748 Ga0451853_0422748_2101_2877 240
70 3300041512 Ga0451853_1070113 Ga0451853_1070113_2581_3357 240
71 3300041999 Ga0439433_0000214 Ga0439433_0000214_1471_2295 240
72 3300041999 Ga0439433_0005455 Ga0439433_0005455_575_1372 240
73 3300042007 Ga0439449_0000445 Ga0439449_0000445_37_819 240
74 3300042007 Ga0439449_0155131 Ga0439449_0155131_62_844 240
75 3300042012 Ga0439455_0000658 Ga0439455_0000658_3254_4030 240
76 3300042014 Ga0439457_001001 Ga0439457_001001_4126_4950 240
77 3300042014 Ga0439457_001663 Ga0439457_001663_1113_1910 240
78 3300042138 Ga0450903_000659 Ga0450903_000659_1731_2507 240
79 3300042157 Ga0439458_0028322 Ga0439458_0028322_240_1016 240
80 3300042533 Ga0450901_011456 Ga0450901_011456_46_822 240
81 3300044656 Ga0466969_0006926 Ga0466969_0006926_3275_4063 240
82 3300044658 Ga0466972_0002637 Ga0466972_0002637_889_1665 240
83 3300044658 Ga0466972_0038943 Ga0466972_0038943_901_1683 240
84 3300044658 Ga0466972_0061055 Ga0466972_0061055_999_1775 240
85 3300044683 Ga0466965_0019514 Ga0466965_0019514_958_1746 240
86 3300044684 Ga0466966_0072631 Ga0466966_0072631_757_1545 240
87 3300044693 Ga0466961_0043778 Ga0466961_0043778_242_1018 240
88 3300044694 Ga0466963_0003713 Ga0466963_0003713_2577_3380 240
89 3300044694 Ga0466963_0008281 Ga0466963_0008281_854_1642 240
90 3300044694 Ga0466963_0021409 Ga0466963_0021409_203_979 240
91 3300044706 Ga0466964_0004493 Ga0466964_0004493_776_1564 240
92 3300044706 Ga0466964_0049442 Ga0466964_0049442_213_995 240
93 3300044719 Ga0466971_0002360 Ga0466971_0002360_3534_4322 240
94 3300044719 Ga0466971_0234691 Ga0466971_0234691_49_825 240
95 3300044735 Ga0466968_0003383 Ga0466968_0003383_1684_2460 240
96 3300044765 Ga0466970_0000631 Ga0466970_0000631_10914_11702 240
97 3300044765 Ga0466970_0026282 Ga0466970_0026282_1071_1853 240
98 3300044842 Ga0466957_0002961 Ga0466957_0002961_1101_1889 240
99 3300044901 Ga0466960_0004911 Ga0466960_0004911_2275_3057 240
100 3300045049 Ga0466959_0020530 Ga0466959_0020530_2897_3685 240
101 3300045976 Ga0466967_0003334 Ga0466967_0003334_8555_9337 240
102 3300045976 Ga0466967_0147826 Ga0466967_0147826_1039_1842 240
103 3300046454 Ga0495592_0004983 Ga0495592_0004983_437_1234 240
104 3300046454 Ga0495592_0021458 Ga0495592_0021458_2016_2831 240
105 3300046455 Ga0495603_0009584 Ga0495603_0009584_1900_2667 240
106 3300046455 Ga0495603_0037617 Ga0495603_0037617_661_1476 240
107 3300046455 Ga0495603_0074075 Ga0495603_0074075_927_1703 240
108 3300046457 Ga0495590_0015322 Ga0495590_0015322_378_1208 240
109 3300046459 Ga0495629_0004693 Ga0495629_0004693_9092_9889 240
110 3300046459 Ga0495629_0008009 Ga0495629_0008009_4846_5655 240
111 3300046459 Ga0495629_0012941 Ga0495629_0012941_4671_5519 240
112 3300046459 Ga0495629_0018900 Ga0495629_0018900_3658_4455 240
113 3300046459 Ga0495629_0228317 Ga0495629_0228317_429_1259 240
114 3300046460 Ga0495638_0069795 Ga0495638_0069795_1300_2076 240
115 3300046460 Ga0495638_0070162 Ga0495638_0070162_143_898 240
116 3300046460 Ga0495638_0163483 Ga0495638_0163483_421_1236 240
117 3300046462 Ga0495651_0001366 Ga0495651_0001366_2765_3562 240
118 3300046463 Ga0495653_0157207 Ga0495653_0157207_683_1513 240
119 3300046472 Ga0495580_0344402 Ga0495580_0344402_108_923 240
120 3300046474 Ga0495605_0008776 Ga0495605_0008776_1793_2569 240
121 3300046476 Ga0495662_0003922 Ga0495662_0003922_6330_7178 240
122 3300046476 Ga0495662_0149474 Ga0495662_0149474_219_1049 240
123 3300046476 Ga0495662_0176018 Ga0495662_0176018_174_983 240
124 3300046477 Ga0495664_0001072 Ga0495664_0001072_3096_3893 240
125 3300046492 Ga0495585_0137744 Ga0495585_0137744_230_1045 240
126 3300046499 Ga0495594_0004485 Ga0495594_0004485_4296_5072 240
127 3300046499 Ga0495594_0006434 Ga0495594_0006434_5281_6024 240
128 3300046499 Ga0495594_0215272 Ga0495594_0215272_205_981 240
129 3300046500 Ga0495596_0040131 Ga0495596_0040131_826_1602 240
130 3300046501 Ga0495607_0041439 Ga0495607_0041439_824_1600 240
131 3300046506 Ga0495583_0093374 Ga0495583_0093374_390_1166 240
132 3300046507 Ga0495606_0020908 Ga0495606_0020908_3979_4755 240
133 3300046511 Ga0495608_0066237 Ga0495608_0066237_1333_2148 240
134 3300046512 Ga0495610_0011233 Ga0495610_0011233_1033_1863 240
135 3300046513 Ga0495616_0034184 Ga0495616_0034184_1729_2505 240
136 3300046514 Ga0495618_0004000 Ga0495618_0004000_5758_6555 240
137 3300046514 Ga0495618_0138368 Ga0495618_0138368_549_1364 240
138 3300046515 Ga0495620_0063015 Ga0495620_0063015_582_1397 240
139 3300046515 Ga0495620_0066605 Ga0495620_0066605_173_949 240
140 3300046516 Ga0495628_0070771 Ga0495628_0070771_239_1054 240
141 3300046517 Ga0495630_0036560 Ga0495630_0036560_495_1292 240
142 3300046522 Ga0495643_0132398 Ga0495643_0132398_251_1081 240
143 3300046522 Ga0495643_0132530 Ga0495643_0132530_390_1166 240
144 3300046524 Ga0495648_0018669 Ga0495648_0018669_826_1656 240
145 3300046526 Ga0495666_0007728 Ga0495666_0007728_4309_5085 240
146 3300046528 Ga0495642_0032772 Ga0495642_0032772_993_1823 240
147 3300046529 Ga0495652_0007882 Ga0495652_0007882_6051_6848 240
148 3300046529 Ga0495652_0064255 Ga0495652_0064255_1649_2464 240
149 3300046533 Ga0495640_0030457 Ga0495640_0030457_37_834 240
150 3300046533 Ga0495640_0043369 Ga0495640_0043369_988_1818 240
151 3300046538 Ga0495609_0086873 Ga0495609_0086873_516_1331 240
152 3300046542 Ga0495597_0080131 Ga0495597_0080131_113_889 240
153 3300046543 Ga0495645_0010337 Ga0495645_0010337_4646_5443 240
154 3300046557 Ga0495622_0017815 Ga0495622_0017815_297_1073 240
155 3300046558 Ga0495633_0041612 Ga0495633_0041612_911_1678 240
156 3300046615 Ga0495656_0122217 Ga0495656_0122217_307_1095 240
157 3300046616 Ga0495668_0025816 Ga0495668_0025816_188_964 240
158 3300046642 Ga0495634_0000693 Ga0495634_0000693_25860_26657 240
159 3300046642 Ga0495634_0088603 Ga0495634_0088603_252_1067 240
160 3300046648 Ga0495611_0021902 Ga0495611_0021902_1744_2559 240
161 3300046660 Ga0495625_0016445 Ga0495625_0016445_4635_5444 240
162 3300046660 Ga0495625_0021660 Ga0495625_0021660_2217_3014 240
163 3300046663 Ga0495635_0004008 Ga0495635_0004008_4910_5707 240
164 3300046663 Ga0495635_0073848 Ga0495635_0073848_428_1288 240
165 3300046665 Ga0495661_0179173 Ga0495661_0179173_45_821 240
166 3300046674 Ga0495588_0007085 Ga0495588_0007085_4012_4848 240
167 3300046675 Ga0495657_0001931 Ga0495657_0001931_1296_2093 240
168 3300046675 Ga0495657_0030582 Ga0495657_0030582_2457_3317 240
169 3300046675 Ga0495657_0102519 Ga0495657_0102519_166_981 240
170 3300046675 Ga0495657_0173288 Ga0495657_0173288_326_1156 240
171 3300046683 Ga0495658_0346688 Ga0495658_0346688_102_899 240
172 3300046689 Ga0495613_0000959 Ga0495613_0000959_11572_12369 240
173 3300046689 Ga0495613_0025905 Ga0495613_0025905_1975_2805 240
174 3300046689 Ga0495613_0044569 Ga0495613_0044569_2278_3138 240
175 3300046690 Ga0495624_0239859 Ga0495624_0239859_141_938 240
176 3300046692 Ga0495671_0001940 Ga0495671_0001940_3385_4182 240
177 3300046694 Ga0495649_0065591 Ga0495649_0065591_998_1780 240
178 3300046694 Ga0495649_0124221 Ga0495649_0124221_162_938 240
179 3300046794 Ga0495589_0032181 Ga0495589_0032181_507_1322 240
180 3300046794 Ga0495589_0034073 Ga0495589_0034073_784_1599 240
181 3300046794 Ga0495589_0118991 Ga0495589_0118991_293_1123 240
182 3300046809 Ga0495600_0061967 Ga0495600_0061967_496_1293 240
183 3300047315 Ga0495581_0012215 Ga0495581_0012215_2228_3025 240
184 3300047315 Ga0495581_0147352 Ga0495581_0147352_341_1108 240
185 3300047317 Ga0495604_0001488 Ga0495604_0001488_11120_11917 240
186 3300047318 Ga0495636_0001145 Ga0495636_0001145_9091_9915 240
187 3300047318 Ga0495636_0073374 Ga0495636_0073374_223_999 240
188 3300047319 Ga0495674_0053929 Ga0495674_0053929_197_1027 240
189 3300047321 Ga0495676_0031181 Ga0495676_0031181_3658_4455 240
190 3300047321 Ga0495676_0061441 Ga0495676_0061441_1428_2243 240
191 3300047321 Ga0495676_0235264 Ga0495676_0235264_218_994 240
192 3300047321 Ga0495676_0270779 Ga0495676_0270779_274_1089 240
193 3300047322 Ga0495680_0006340 Ga0495680_0006340_7192_8007 240
194 3300047443 Ga0495687_003341 Ga0495687_003341_6878_7654 240
195 3300047443 Ga0495687_010785 Ga0495687_010785_3041_3796 240
196 3300047443 Ga0495687_113596 Ga0495687_113596_56_886 240
197 3300047447 Ga0495685_001588 Ga0495685_001588_5004_5780 240
198 3300047447 Ga0495685_048832 Ga0495685_048832_450_1226 240
199 3300047447 Ga0495685_054707 Ga0495685_054707_444_1268 240
200 3300047470 Ga0495681_0001099 Ga0495681_0001099_4890_5687 240
201 3300047470 Ga0495681_0102873 Ga0495681_0102873_232_954 240
202 3300047470 Ga0495681_0137054 Ga0495681_0137054_57_833 240
203 3300047471 Ga0495684_0055472 Ga0495684_0055472_1735_2532 240
204 3300047472 Ga0495686_0072013 Ga0495686_0072013_868_1644 240
205 3300047673 Ga0495593_0001353 Ga0495593_0001353_7212_8009 240
206 3300048088 Ga0495602_0077127 Ga0495602_0077127_875_1690 240
207 3300048088 Ga0495602_0180560 Ga0495602_0180560_506_1303 240
208 3300048089 Ga0495614_0019223 Ga0495614_0019223_472_1269 240
209 3300048091 Ga0495626_0104860 Ga0495626_0104860_181_957 240
210 3300049459 Ga0495678_059675 Ga0495678_059675_14_790 240
211 3300049569 Ga0501032_0020351 Ga0501032_0020351_2489_3319 240
212 3300049569 Ga0501032_0184027 Ga0501032_0184027_500_1303 240
213 3300049570 Ga0501033_0001126 Ga0501033_0001126_21336_22118 240
214 3300049570 Ga0501033_0023936 Ga0501033_0023936_2578_3408 240
215 3300049571 Ga0501034_0002960 Ga0501034_0002960_7977_8759 240
216 3300049571 Ga0501034_0011637 Ga0501034_0011637_1953_2783 240
217 3300049571 Ga0501034_0033456 Ga0501034_0033456_1218_1994 240
218 3300049572 Ga0501036_0000215 Ga0501036_0000215_17705_18487 240
219 3300049572 Ga0501036_0048208 Ga0501036_0048208_424_1254 240
220 3300049572 Ga0501036_0068556 Ga0501036_0068556_1035_1811 240
221 3300049573 Ga0501037_0001797 Ga0501037_0001797_1663_2493 240
222 3300049573 Ga0501037_0074997 Ga0501037_0074997_1350_2153 240
223 3300049574 Ga0501038_0010940 Ga0501038_0010940_6212_6994 240
224 3300049574 Ga0501038_0062241 Ga0501038_0062241_1429_2205 240
225 3300049574 Ga0501038_0103742 Ga0501038_0103742_206_1036 240
226 3300049575 Ga0501039_0003900 Ga0501039_0003900_5862_6644 240
227 3300049578 Ga0501042_0093680 Ga0501042_0093680_697_1527 240
228 3300049579 Ga0501043_0024747 Ga0501043_0024747_3712_4542 240
229 3300049579 Ga0501043_0037536 Ga0501043_0037536_3017_3799 240
230 3300049580 Ga0501046_0004066 Ga0501046_0004066_2476_3306 240
231 3300049580 Ga0501046_0077702 Ga0501046_0077702_1200_2003 240
232 3300049581 Ga0501047_0026264 Ga0501047_0026264_3788_4591 240
233 3300049581 Ga0501047_0253402 Ga0501047_0253402_135_911 240
234 3300049582 Ga0501048_0002036 Ga0501048_0002036_14460_15290 240
235 3300049582 Ga0501048_0031486 Ga0501048_0031486_1817_2620 240
236 3300049586 Ga0501070_0003339 Ga0501070_0003339_2520_3302 240
237 3300049590 Ga0501074_0004622 Ga0501074_0004622_177_959 240
238 3300049742 Ga0501080_0137494 Ga0501080_0137494_1437_2213 240
239 3300049822 Ga0501035_0000861 Ga0501035_0000861_9828_10610 240
240 3300049822 Ga0501035_0013980 Ga0501035_0013980_4452_5282 240
241 3300049822 Ga0501035_0201739 Ga0501035_0201739_38_814 240
242 3300049823 Ga0501044_0016162 Ga0501044_0016162_1890_2672 240
243 3300049823 Ga0501044_0245189 Ga0501044_0245189_777_1553 240
244 3300049823 Ga0501044_0326664 Ga0501044_0326664_622_1425 240
245 3300049824 Ga0501045_0313034 Ga0501045_0313034_133_963 240
246 3300050494 nmdc:mga06z11_3595_c1 nmdc:mga06z11_3595_c1_2070_2846 240
247 3300050495 nmdc:mga04h51_145161_c1 nmdc:mga04h51_145161_c1_114_890 240
248 3300050496 nmdc:mga07m45_118792_c1 nmdc:mga07m45_118792_c1_667_1452 240
249 3300053077 Ga0495601_0167729 Ga0495601_0167729_19_816 240
250 3300053079 Ga0500610_0047104 Ga0500610_0047104_1400_2197 240
251 3300053095 Ga0500640_006446 Ga0500640_006446_1502_2299 240
252 3300053096 Ga0500641_0049931 Ga0500641_0049931_950_1693 240
253 3300053107 Ga0500560_000116 Ga0500560_000116_5645_6442 240
254 3300053111 Ga0500572_010892 Ga0500572_010892_792_1589 240
255 3300053140 Ga0500573_0116954 Ga0500573_0116954_400_1197 240
256 3300053149 Ga0500600_0037731 Ga0500600_0037731_811_1587 240
257 3300053157 Ga0500624_004967 Ga0500624_004967_305_1102 240
258 3300061719 Ga0466962_0001024 Ga0466962_0001024_1020_1808 240
259 iso_pu_bacteria 2547132111 2547407059 240
260 iso_pu_bacteria 2554235005 2554258363 240
261 iso_pu_bacteria 2582581313 2585311526 240
262 iso_pu_bacteria 2582581314 2585315823 240
263 iso_pu_bacteria 2616644814 2616697571 240
264 iso_pu_bacteria 2643221647 2644264621 240
265 iso_pu_bacteria 2643221678 2644436629 240
266 iso_pu_bacteria 2643221714 2644625544 240
267 iso_pu_bacteria 2784132148 2784588093 240
268 iso_pu_bacteria 2784746763 2785343969 240
269 iso_pu_bacteria 2784746768 2785368858 240
270 iso_pu_bacteria 2786546132 2786670045 240
271 iso_pu_bacteria 2802429296 2804847602 240
272 iso_pu_bacteria 2808606359 2808841521 240
273 iso_pu_bacteria 2808606448 2809231698 240
274 iso_pu_bacteria 2808606982 2811848486 240
275 iso_pu_bacteria 2811994879 2812358723 240
276 iso_pu_bacteria 2811994917 2812481029 240
277 iso_pu_bacteria 2852635781 2852642445 240
278 iso_pu_bacteria 2862178590 2862184693 240
279 iso_pu_bacteria 2862281513 2862287856 240
280 iso_pu_bacteria 2862290372 2862296968 240
281 iso_pu_bacteria 2862382967 2862383275 240
282 iso_pu_bacteria 2862507626 2862511493 240
283 iso_pu_bacteria 2862574272 2862579770 240
284 iso_pu_bacteria 2863404153 2863405254 240
285 iso_pu_bacteria 2867428634 2867429050 240
286 iso_pu_bacteria 2873151551 2873156287 240
287 iso_pu_bacteria 2877676314 2877681658 240
288 iso_pu_bacteria 2912715099 2912720620 240
289 iso_pu_bacteria 2912723979 2912724788 240
290 iso_pu_bacteria 2919468124 2919473479 240
291 iso_pu_bacteria 2946064051 2946067156 240
292 iso_pu_bacteria 2946072368 2946075435 240
293 iso_pu_bacteria 2947224130 2947230087 240
294 iso_pu_bacteria 2954002825 2954003290 240
295 iso_pu_bacteria 2954380949 2954386801 240
296 iso_pu_bacteria 2954673503 2954676387 240
297 iso_pu_bacteria 2954682443 2954687781 240
298 iso_pu_bacteria 2954691527 2954697617 240
299 iso_pu_bacteria 2954701450 2954704597 240
300 iso_pu_bacteria 2954711539 2954716759 240
301 iso_pu_bacteria 2954721474 2954726706 240
302 iso_pu_bacteria 2954731030 2954735089 240
303 iso_pu_bacteria 2954740390 2954745629 240
304 iso_pu_bacteria 2954749733 2954753960 240
305 iso_pu_bacteria 2954759201 2954764603 240
306 iso_pu_bacteria 2990059506 2990060735 240
307 iso_pu_bacteria 3006393351 3006394225 240
308 iso_pu_bacteria 3006493962 3006496385 240
309 iso_pu_bacteria 8008558824 8008559822 240
310 iso_pu_bacteria 8008574985 8008579337 240
311 iso_pu_bacteria 8023623736 8023631091 240
312 iso_pu_bacteria 8025413630 8025417340 240
313 iso_pu_bacteria 8048406513 8048413267 240
314 iso_pu_bacteria 8056829672 8056830293 240
315 3300026116 Ga0207674_10373641 Ga0207674_103736412 241
316 3300027312 Ga0209371_1004107 Ga0209371_10041074 241
317 3300030500 Ga0268256_1003851 Ga0268256_10038516 241
318 3300048925 Ga0496122_0064172 Ga0496122_0064172_1642_2382 241
319 iso_pu_bacteria 2667528173 2671109902 241
320 iso_pu_bacteria 2854601825 2854601884 241
321 iso_pu_bacteria 2891048133 2891048736 241
322 iso_pu_bacteria 2904474040 2904478236 241
323 iso_pu_bacteria 2904504865 2904508420 241
324 iso_pu_bacteria 2919150387 2919155484 241
325 iso_pu_bacteria 2927143783 2927147924 241
326 iso_pu_bacteria 2969079654 2969083897 241
327 iso_pu_bacteria 2995392953 2995396453 241
328 2162886007 SwRhRL2b_contig_285185 SwRhRL2b_0292.00005030 242
329 3300002771 JGI25163J39215_1000070 JGI25163J39215_100007039 242
330 3300002772 JGI25164J39214_1000218 JGI25164J39214_100021839 242
331 3300003203 JGI25406J46586_10028011 JGI25406J46586_100280112 242
332 3300003751 Ga0055538_1000154 Ga0055538_100015439 242
333 3300003752 Ga0055539_1000204 Ga0055539_100020439 242
334 3300003756 Ga0055533_1000206 Ga0055533_100020639 242
335 3300003759 Ga0055525_1000283 Ga0055525_100028339 242
336 3300003841 Ga0055541_1000132 Ga0055541_100013239 242
337 3300005289 Ga0065704_10002096 Ga0065704_100020966 242
338 3300005289 Ga0065704_10200465 Ga0065704_102004651 242
339 3300005295 Ga0065707_10125789 Ga0065707_101257892 242
340 3300005367 Ga0070667_100079721 Ga0070667_1000797214 242
341 3300005468 Ga0070707_100029642 Ga0070707_1000296422 242
342 3300005841 Ga0068863_100188299 Ga0068863_1001882992 242
343 3300005843 Ga0068860_100045816 Ga0068860_1000458165 242
344 3300005985 Ga0081539_10001842 Ga0081539_1000184232 242
345 3300006038 Ga0075365_10149710 Ga0075365_101497102 242
346 3300006038 Ga0075365_10175508 Ga0075365_101755082 242
347 3300006038 Ga0075365_10369065 Ga0075365_103690651 242
348 3300006048 Ga0075363_100159740 Ga0075363_1001597402 242
349 3300006051 Ga0075364_10118408 Ga0075364_101184083 242
350 3300006051 Ga0075364_10241006 Ga0075364_102410062 242
351 3300006178 Ga0075367_10060949 Ga0075367_100609493 242
352 3300006178 Ga0075367_10131641 Ga0075367_101316412 242
353 3300006186 Ga0075369_10033456 Ga0075369_100334562 242
354 3300006237 Ga0097621_100616666 Ga0097621_1006166661 242
355 3300009036 Ga0105244_10004293 Ga0105244_100042935 242
356 3300009092 Ga0105250_10000100 Ga0105250_1000010063 242
357 3300009092 Ga0105250_10000467 Ga0105250_1000046723 242
358 3300009093 Ga0105240_10199245 Ga0105240_101992452 242
359 3300009147 Ga0114129_10202254 Ga0114129_102022542 242
360 3300013297 Ga0157378_10279203 Ga0157378_102792032 242
361 3300013306 Ga0163162_10199290 Ga0163162_101992903 242
362 3300014325 Ga0163163_10032922 Ga0163163_100329222 242
363 3300014325 Ga0163163_10159297 Ga0163163_101592973 242
364 3300025207 Ga0209760_100137 Ga0209760_1001379 242
365 3300025224 Ga0209784_100001 Ga0209784_1000011367 242
366 3300025225 Ga0209566_100001 Ga0209566_1000011367 242
367 3300025226 Ga0209674_100002 Ga0209674_1000021367 242
368 3300025230 Ga0209563_100008 Ga0209563_1000081370 242
369 3300025231 Ga0207427_100231 Ga0207427_1002319 242
370 3300025233 Ga0209437_100007 Ga0209437_100007822 242
371 3300025253 Ga0209677_100004 Ga0209677_1000041370 242
372 3300025261 Ga0209233_1001965 Ga0209233_10019657 242
373 3300025711 Ga0207696_1000013 Ga0207696_100001356 242
374 3300025711 Ga0207696_1000561 Ga0207696_10005617 242
375 3300025728 Ga0207655_1000227 Ga0207655_100022738 242
376 3300025922 Ga0207646_10187892 Ga0207646_101878922 242
377 3300026035 Ga0207703_10281842 Ga0207703_102818421 242
378 3300026088 Ga0207641_10073901 Ga0207641_100739014 242
379 3300028563 Ga0265319_1008140 Ga0265319_10081406 242
380 3300029957 Ga0265324_10036759 Ga0265324_100367592 242
381 3300031235 Ga0265330_10085503 Ga0265330_100855032 242
382 3300031241 Ga0265325_10005163 Ga0265325_100051636 242
383 3300031249 Ga0265339_10007492 Ga0265339_100074922 242
384 3300031249 Ga0265339_10067196 Ga0265339_100671962 242
385 3300031344 Ga0265316_10025803 Ga0265316_100258032 242
386 3300031456 Ga0307513_10010282 Ga0307513_100102822 242
387 3300031507 Ga0307509_10028168 Ga0307509_100281683 242
388 3300031595 Ga0265313_10073803 Ga0265313_100738032 242
389 3300031712 Ga0265342_10147146 Ga0265342_101471462 242
390 3300031852 Ga0307410_10364424 Ga0307410_103644242 242
391 3300031995 Ga0307409_100454135 Ga0307409_1004541352 242
392 3300031995 Ga0307409_100507307 Ga0307409_1005073072 242
393 3300037466 Ga0395898_0347306 Ga0395898_0347306_119_865 242
394 3300042876 Ga0451577_0000098 Ga0451577_0000098_112933_113682 242
395 3300042876 Ga0451577_0000455 Ga0451577_0000455_42395_43129 242
396 3300042876 Ga0451577_0002227 Ga0451577_0002227_20985_21734 242
397 3300042876 Ga0451577_0246126 Ga0451577_0246126_681_1490 242
398 3300044673 Ga0453683_0000001 Ga0453683_0000001_1338710_1339459 242
399 3300044673 Ga0453683_0047397 Ga0453683_0047397_1924_2673 242
400 3300044673 Ga0453683_0068615 Ga0453683_0068615_715_1449 242
401 3300044673 Ga0453683_0349894 Ga0453683_0349894_135_869 242
402 3300044684 Ga0466966_0144811 Ga0466966_0144811_309_1067 242
403 3300044712 Ga0453684_0000347 Ga0453684_0000347_78936_79685 242
404 3300044712 Ga0453684_0006412 Ga0453684_0006412_14468_15217 242
405 3300044712 Ga0453684_0006961 Ga0453684_0006961_1862_2596 242
406 3300044712 Ga0453684_0017389 Ga0453684_0017389_5400_6134 242
407 3300044712 Ga0453684_0046303 Ga0453684_0046303_4891_5625 242
408 3300044712 Ga0453684_0055575 Ga0453684_0055575_1902_2651 242
409 3300044712 Ga0453684_0324640 Ga0453684_0324640_694_1443 242
410 3300044765 Ga0466970_0014632 Ga0466970_0014632_1947_2705 242
411 3300045051 Ga0451576_0004285 Ga0451576_0004285_2779_3528 242
412 3300045051 Ga0451576_0673181 Ga0451576_0673181_314_1063 242
413 3300046471 Ga0495650_0000090 Ga0495650_0000090_20046_20774 242
414 3300046810 Ga0495660_0000028 Ga0495660_0000028_115370_116098 242
415 3300047319 Ga0495674_0087164 Ga0495674_0087164_731_1459 242
416 3300048905 Ga0496102_0000115 Ga0496102_0000115_69920_70669 242
417 3300048906 Ga0496103_0000008 Ga0496103_0000008_76945_77694 242
418 3300048907 Ga0496104_0001929 Ga0496104_0001929_10601_11329 242
419 3300048911 Ga0496108_0000149 Ga0496108_0000149_53879_54619 242
420 3300048919 Ga0496116_0000613 Ga0496116_0000613_39712_40440 242
421 3300048920 Ga0496117_0023140 Ga0496117_0023140_2074_2802 242
422 3300048921 Ga0496118_0008108 Ga0496118_0008108_6954_7682 242
423 3300048922 Ga0496119_0039344 Ga0496119_0039344_412_1140 242
424 3300048923 Ga0496120_0006609 Ga0496120_0006609_3266_3994 242
425 3300048925 Ga0496122_0000058 Ga0496122_0000058_6418_7146 242
426 3300048926 Ga0496123_0000044 Ga0496123_0000044_6418_7146 242
427 3300048927 Ga0496124_0000092 Ga0496124_0000092_164872_165600 242
428 3300048928 Ga0496125_0000103 Ga0496125_0000103_161478_162206 242
429 3300048928 Ga0496125_0070665 Ga0496125_0070665_476_1270 242
430 3300048929 Ga0496126_0002455 Ga0496126_0002455_6286_7014 242
431 3300048929 Ga0496126_0037720 Ga0496126_0037720_349_1077 242
432 3300049576 Ga0501040_0037536 Ga0501040_0037536_2419_3231 242
433 3300049588 Ga0501072_0139154 Ga0501072_0139154_49_798 242
434 3300050490 nmdc:mga03n38_50825_c1 nmdc:mga03n38_50825_c1_848_1597 242
435 3300050490 nmdc:mga03n38_95417_c1 nmdc:mga03n38_95417_c1_179_928 242
436 3300050491 nmdc:mga00v17_129250_c1 nmdc:mga00v17_129250_c1_770_1519 242
437 3300050491 nmdc:mga00v17_176320_c1 nmdc:mga00v17_176320_c1_553_1323 242
438 3300050491 nmdc:mga00v17_56576_c1 nmdc:mga00v17_56576_c1_886_1635 242
439 3300050491 nmdc:mga00v17_66526_c1 nmdc:mga00v17_66526_c1_1247_2017 242
440 3300053092 Ga0500583_0127172 Ga0500583_0127172_358_1098 242
441 3300053125 Ga0500618_005766 Ga0500618_005766_784_1512 242

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

37

185

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9903 1 238
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9868 2 241
4yms-assembly1.cif.gz_A crystal structure of an amino acid abc transporter 0.9781 1 238
3c41-assembly1.cif.gz_K abc protein artp in complex with amp-pnp/mg2+ 0.9767 1 239
4u00-assembly1.cif.gz_A crystal structure of ttha1159 in complex with adp 0.9747 2 241
ID Description Score Start End Superfamily
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.99 1 238 3.40.50.300
4ymtJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9778 1 238 3.40.50.300
af_A0A1D6Q2V7_231_304_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9593 2 65 3.40.50.300
af_P33360_1_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.955 1 239 3.40.50.300
af_P0AAF6_1_241_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9505 2 236 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A6A5KSE3-F1-model_v4 deleted 0.9991 1 242
AF-G3A0C1-F1-model_v4 Glutamate/aspartate transport protein ABC superfamily, atp_binding component (EC 3.6.3.28) 0.9991 1 239 GO:0005524
GO:0005886
GO:0016887
AF-A0A2T5G7R1-F1-model_v4 Glutamine transport ATP-binding protein GlnQ 0.9986 1 241 GO:0005524
GO:0015424
GO:0016887
AF-A0A2K4VU34-F1-model_v4 deleted 0.9982 1 242
AF-A0A1F0F7W3-F1-model_v4 Polar amino acid ABC transporter ATP-binding protein 0.9982 1 210 GO:0005524
GO:0005886
GO:0015424
GO:0016887

Feature Viewer

pLDDT pTM Quality
94.87 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map