F444648

General Info

Members Datasets Scaffolds Average Seq Length
441 283 882 200

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10657198|Ga0105239_106571982
Length 246
Sequence LLTTRRQFQRLAATTFLAAASGSPIPGAGTGFADQANTSQKKGDDTMALELPALPYAYDALAPYMSKETLEFHHDKHHQAYVTNGNNLLKDSPLAKESLSKIVKAAYKEKNAGLINNVGQHYNHLHFWQWMKKGGGGKKLPAKLQKAVDSDLGGYDKMRADFINAGTTQFGSGWAWIAVKNGKLEIQKTPNGENPLMHGSQPILGVDVWEHSYYIDYRNARPKYLEAWFDNLVNWDHVAFLLEEAK

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
62 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
94 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
134 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
135 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
136 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
152 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
153 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
166 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
167 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
168 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
169 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
170 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
171 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
174 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
175 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
180 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
181 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
182 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
183 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
198 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
199 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
203 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
204 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
205 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
206 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
207 3300049526 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control Metagenome Rhizosphere
208 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
232 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
239 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
240 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
241 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
242 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
245 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
246 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
247 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
248 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
249 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
250 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
254 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
255 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
256 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
257 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
258 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
259 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
260 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
261 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
262 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
263 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
272 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
273 2534681786 Brucella suis 92/29 Isolate Unclassified
274 2751185800 Brucella pituitosa AA2 Isolate Unclassified
275 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
276 2854911287 Brucella lupini LUP21 Isolate Unclassified
277 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
278 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
279 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
280 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
281 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
282 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
283 8054558443 Rhizobium alarense TRM95111 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.24
Metatranscriptomes 2.27
Isolates 2.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.84
Nodule 0.45
Rhizoplane 5.9
Rhizosphere 79.59
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10657198 3300010375 Bacteria 1197
2 JGI24737J22298_10025898 3300001990 Bacteria 1852
3 Ga0065712_10077039 3300005290 Bacteria 3560
4 Ga0065715_10123431 3300005293 Bacteria 2178
5 Ga0065707_10281874 3300005295 Bacteria 1046
6 Ga0070658_10048709 3300005327 Bacteria 3431
7 Ga0070658_10122343 3300005327 Bacteria 2163
8 Ga0070676_10077896 3300005328 Bacteria 2004
9 Ga0070676_10168224 3300005328 Bacteria 1416
10 Ga0070683_100161210 3300005329 Bacteria 2128
11 Ga0070670_100216981 3300005331 Bacteria 1664
12 Ga0070670_100667843 3300005331 Bacteria 933
13 Ga0068869_100078895 3300005334 Bacteria 2453
14 Ga0068868_100119356 3300005338 Bacteria 2150
15 Ga0070691_10012364 3300005341 Bacteria 3909
16 Ga0070692_10446289 3300005345 Bacteria 827
17 Ga0070668_100060276 3300005347 Bacteria 2938
18 Ga0070668_100288927 3300005347 Bacteria 1372
19 Ga0070675_100057137 3300005354 Bacteria 3216
20 Ga0070675_100756166 3300005354 Bacteria 887
21 Ga0070674_100000967 3300005356 Bacteria 14966
22 Ga0070673_100126522 3300005364 Bacteria 2139
23 Ga0070688_100576764 3300005365 Bacteria 858
24 Ga0070703_10001257 3300005406 Bacteria 7708
25 Ga0070701_10016207 3300005438 Bacteria 3459
26 Ga0070711_100937069 3300005439 Bacteria 740
27 Ga0070705_100000029 3300005440 Bacteria 74892
28 Ga0070700_100001253 3300005441 Bacteria 12585
29 Ga0070694_100000919 3300005444 Bacteria 16687
30 Ga0070663_100067669 3300005455 Bacteria 2592
31 Ga0070662_100101578 3300005457 Bacteria 2177
32 Ga0070662_100520859 3300005457 Bacteria 993
33 Ga0070662_100640395 3300005457 Bacteria 896
34 Ga0070681_10593495 3300005458 Bacteria 1022
35 Ga0070706_100045939 3300005467 Bacteria 4032
36 Ga0070707_100032638 3300005468 Bacteria 4961
37 Ga0070707_100141544 3300005468 Bacteria 2341
38 Ga0070698_100036918 3300005471 Bacteria 5041
39 Ga0070698_100245097 3300005471 Bacteria 1725
40 Ga0070699_100000435 3300005518 Bacteria 40050
41 Ga0070679_100154653 3300005530 Bacteria 2269
42 Ga0070697_100082446 3300005536 Bacteria 2651
43 Ga0068853_100009480 3300005539 Bacteria 7844
44 Ga0068853_101123750 3300005539 Bacteria 758
45 Ga0070672_100060563 3300005543 Bacteria 2981
46 Ga0070686_100578795 3300005544 Bacteria 882
47 Ga0070695_100008573 3300005545 Bacteria 6072
48 Ga0070695_100009413 3300005545 Bacteria 5817
49 Ga0070696_100001054 3300005546 Bacteria 17828
50 Ga0070665_100291345 3300005548 Bacteria 1635
51 Ga0070665_101232179 3300005548 Bacteria 759
52 Ga0070704_100001516 3300005549 Bacteria 12519
53 Ga0070704_100420764 3300005549 Bacteria 1144
54 Ga0068855_100060201 3300005563 Bacteria 4441
55 Ga0070664_100269233 3300005564 Bacteria 1534
56 Ga0068857_100000953 3300005577 Bacteria 22082
57 Ga0070702_100191696 3300005615 Bacteria 1346
58 Ga0070702_100244935 3300005615 Bacteria 1212
59 Ga0068852_100027702 3300005616 Bacteria 4622
60 Ga0068859_100002557 3300005617 Bacteria 18467
61 Ga0068859_101758329 3300005617 Bacteria 685
62 Ga0068864_100362084 3300005618 Bacteria 1371
63 Ga0068861_101329671 3300005719 Bacteria 700
64 Ga0068858_100256114 3300005842 Bacteria 1663
65 Ga0068860_100021821 3300005843 Bacteria 6195
66 Ga0068860_100063513 3300005843 Bacteria 3507
67 Ga0068860_100838600 3300005843 Bacteria 934
68 Ga0068862_100000866 3300005844 Bacteria 29635
69 Ga0068862_101316576 3300005844 Bacteria 724
70 Ga0081455_10000334 3300005937 Bacteria 61844
71 Ga0081455_10038998 3300005937 Bacteria 4202
72 Ga0081540_1113036 3300005983 Bacteria 1143
73 Ga0081539_10033841 3300005985 Bacteria 3103
74 Ga0075365_10008945 3300006038 Bacteria 5722
75 Ga0075365_10016530 3300006038 Bacteria 4490
76 Ga0075365_10147881 3300006038 Bacteria 1633
77 Ga0075365_10328627 3300006038 Bacteria 1077
78 Ga0075368_10010378 3300006042 Bacteria 3367
79 Ga0075368_10018115 3300006042 Bacteria 2643
80 Ga0075368_10031433 3300006042 Bacteria 2059
81 Ga0075363_100067147 3300006048 Bacteria 1942
82 Ga0075363_100087997 3300006048 Bacteria 1707
83 Ga0075364_10006124 3300006051 Bacteria 7044
84 Ga0070712_100623882 3300006175 Bacteria 914
85 Ga0075362_10002172 3300006177 Bacteria 6499
86 Ga0075362_10101368 3300006177 Bacteria 1346
87 Ga0075367_10014480 3300006178 Bacteria 4270
88 Ga0075367_10101706 3300006178 Bacteria 1757
89 Ga0075369_10121678 3300006186 Bacteria 1182
90 Ga0075370_10480594 3300006353 Bacteria 749
91 Ga0075428_100037447 3300006844 Bacteria 5340
92 Ga0075428_100066076 3300006844 Bacteria 3961
93 Ga0075428_100336680 3300006844 Bacteria 1621
94 Ga0075428_100496133 3300006844 Bacteria 1306
95 Ga0075428_100538335 3300006844 Bacteria 1249
96 Ga0075430_100029034 3300006846 Bacteria 4695
97 Ga0075430_100067007 3300006846 Bacteria 3014
98 Ga0075430_100067157 3300006846 Bacteria 3011
99 Ga0075431_100002086 3300006847 Bacteria 19086
100 Ga0075431_100008815 3300006847 Bacteria 10107
101 Ga0075431_100026676 3300006847 Bacteria 5926
102 Ga0075431_100066146 3300006847 Bacteria 3732
103 Ga0075431_100073374 3300006847 Bacteria 3530
104 Ga0075431_100178775 3300006847 Bacteria 2178
105 Ga0075433_10274457 3300006852 Bacteria 1494
106 Ga0075433_10794742 3300006852 Bacteria 827
107 Ga0075434_100003360 3300006871 Bacteria 14318
108 Ga0075434_100123337 3300006871 Bacteria 2607
109 Ga0075434_100440140 3300006871 Bacteria 1325
110 Ga0075434_100505628 3300006871 Bacteria 1229
111 Ga0075434_100590533 3300006871 Bacteria 1130
112 Ga0075429_100051963 3300006880 Bacteria 3565
113 Ga0097620_100002557 3300006931 Bacteria 18467
114 Ga0097620_101758601 3300006931 Bacteria 685
115 Ga0075435_100010582 3300007076 Bacteria 6751
116 Ga0111539_10029483 3300009094 Bacteria 6683
117 Ga0111539_10205584 3300009094 Bacteria 2295
118 Ga0105245_10085116 3300009098 Bacteria 2898
119 Ga0105247_10056261 3300009101 Bacteria 2429
120 Ga0114129_10082335 3300009147 Bacteria 4472
121 Ga0114129_10082355 3300009147 Bacteria 4471
122 Ga0114129_10085939 3300009147 Bacteria 4364
123 Ga0114129_10421116 3300009147 Bacteria 1756
124 Ga0105243_10250959 3300009148 Bacteria 1579
125 Ga0105242_10260333 3300009176 Bacteria 1567
126 Ga0105237_10224731 3300009545 Bacteria 1878
127 Ga0105238_10274143 3300009551 Bacteria 1668
128 Ga0105239_10219314 3300010375 Bacteria 2133
129 Ga0105246_10754635 3300011119 Bacteria 859
130 Ga0157374_10381111 3300013296 Bacteria 1405
131 Ga0157378_10133625 3300013297 Bacteria 2299
132 Ga0163162_10560279 3300013306 Bacteria 1270
133 Ga0163162_11253980 3300013306 Bacteria 842
134 Ga0157375_10305674 3300013308 Bacteria 1754
135 Ga0163163_10575006 3300014325 Bacteria 1190
136 Ga0157380_10015316 3300014326 Bacteria 5634
137 Ga0157380_10025971 3300014326 Bacteria 4445
138 Ga0157380_10146716 3300014326 Bacteria 2034
139 Ga0182008_10189662 3300014497 Bacteria 1043
140 Ga0157379_10159425 3300014968 Bacteria 2036
141 Ga0157379_10666014 3300014968 Bacteria 975
142 Ga0157376_10531905 3300014969 Bacteria 1160
143 Ga0182005_1004314 3300015265 Bacteria 4620
144 Ga0163161_10067311 3300017792 Bacteria 2616
145 Ga0224712_10375820 3300022467 Bacteria 675
146 Ga0209025_1000165 3300025294 Bacteria 164692
147 Ga0209025_1038046 3300025294 Bacteria 2123
148 Ga0207653_10001895 3300025885 Bacteria 6694
149 Ga0207647_10076169 3300025904 Bacteria 2018
150 Ga0207647_10150537 3300025904 Bacteria 1360
151 Ga0207699_10093702 3300025906 Bacteria 1890
152 Ga0207645_10044357 3300025907 Bacteria 2845
153 Ga0207645_10146653 3300025907 Bacteria 1539
154 Ga0207705_10021634 3300025909 Bacteria 4589
155 Ga0207705_10093351 3300025909 Bacteria 2206
156 Ga0207684_10062385 3300025910 Bacteria 3165
157 Ga0207654_10125291 3300025911 Bacteria 1619
158 Ga0207707_10133844 3300025912 Bacteria 2168
159 Ga0207695_10513740 3300025913 Bacteria 1080
160 Ga0207660_10008659 3300025917 Bacteria 6580
161 Ga0207662_10217879 3300025918 Bacteria 1242
162 Ga0207652_10162451 3300025921 Bacteria 2002
163 Ga0207646_10035437 3300025922 Bacteria 4507
164 Ga0207646_10494677 3300025922 Bacteria 1102
165 Ga0207694_10272642 3300025924 Bacteria 1388
166 Ga0207659_10079738 3300025926 Bacteria 2416
167 Ga0207659_10601548 3300025926 Bacteria 937
168 Ga0207706_10066498 3300025933 Bacteria 3172
169 Ga0207706_10192753 3300025933 Bacteria 1788
170 Ga0207669_10029387 3300025937 Bacteria 3039
171 Ga0207669_10215587 3300025937 Bacteria 1405
172 Ga0207704_10110935 3300025938 Bacteria 1854
173 Ga0207661_10127906 3300025944 Bacteria 2172
174 Ga0207679_10266584 3300025945 Bacteria 1463
175 Ga0207667_11083998 3300025949 Bacteria 785
176 Ga0207651_10009947 3300025960 Bacteria 5241
177 Ga0207668_10374841 3300025972 Bacteria 1196
178 Ga0207640_10016699 3300025981 Bacteria 4277
179 Ga0207640_10506276 3300025981 Bacteria 1007
180 Ga0207703_10204924 3300026035 Bacteria 1755
181 Ga0207678_10011542 3300026067 Bacteria 7760
182 Ga0207678_10090861 3300026067 Bacteria 2610
183 Ga0207678_10387275 3300026067 Bacteria 1209
184 Ga0207708_10001278 3300026075 Bacteria 18901
185 Ga0207708_10074299 3300026075 Bacteria 2605
186 Ga0207641_10121936 3300026088 Bacteria 2328
187 Ga0207674_10001858 3300026116 Bacteria 26888
188 Ga0207674_10005474 3300026116 Bacteria 15085
189 Ga0207674_10982776 3300026116 Bacteria 813
190 Ga0207675_100028598 3300026118 Bacteria 5191
191 Ga0207675_100084069 3300026118 Bacteria 2986
192 Ga0207675_100131734 3300026118 Bacteria 2371
193 Ga0207698_10125562 3300026142 Bacteria 2181
194 Ga0209969_1027353 3300027360 Bacteria 864
195 Ga0209999_1042030 3300027543 Bacteria 857
196 Ga0209813_10001093 3300027866 Bacteria 6071
197 Ga0209813_10016979 3300027866 Bacteria 1993
198 Ga0207428_10031105 3300027907 Bacteria 4410
199 Ga0207428_10164627 3300027907 Bacteria 1682
200 Ga0207428_10230459 3300027907 Bacteria 1386
201 Ga0268266_10316171 3300028379 Bacteria 1460
202 Ga0268266_10323433 3300028379 Bacteria 1444
203 Ga0268265_10038400 3300028380 Bacteria 3522
204 Ga0268264_10014186 3300028381 Bacteria 6551
205 Ga0268264_10279408 3300028381 Bacteria 1563
206 Ga0268264_10793264 3300028381 Bacteria 946
207 Ga0265338_10045039 3300028800 Bacteria 4063
208 Ga0265330_10027748 3300031235 Bacteria 2556
209 Ga0265325_10004404 3300031241 Bacteria 8902
210 Ga0265339_10000328 3300031249 Bacteria 38123
211 Ga0265331_10021153 3300031250 Bacteria 3332
212 Ga0307408_100026573 3300031548 Bacteria 3979
213 Ga0265313_10001539 3300031595 Bacteria 21444
214 Ga0265342_10016182 3300031712 Bacteria 4881
215 Ga0307516_10088888 3300031730 Bacteria 2921
216 Ga0307405_10201106 3300031731 Bacteria 1447
217 Ga0307413_10187809 3300031824 Bacteria 1481
218 Ga0307413_10305337 3300031824 Bacteria 1209
219 Ga0307407_10286235 3300031903 Bacteria 1144
220 Ga0307409_101532777 3300031995 Bacteria 694
221 Ga0307416_100383961 3300032002 Bacteria 1436
222 Ga0307416_100681417 3300032002 Bacteria 1116
223 Ga0307414_10013224 3300032004 Bacteria 4908
224 Ga0307411_10643340 3300032005 Bacteria 917
225 Ga0307411_10872113 3300032005 Bacteria 798
226 Ga0307415_100065456 3300032126 Bacteria 2533
227 Ga0373940_0009432 3300035088 Bacteria 2270
228 Ga0373923_0137835 3300035111 Bacteria 1101
229 Ga0373953_0220807 3300035117 Bacteria 821
230 Ga0373956_0127132 3300035119 Bacteria 1192
231 Ga0373955_0008162 3300035172 Bacteria 4847
232 Ga0373961_0081042 3300035241 Bacteria 1021
233 Ga0316574_0146921 3300035398 Bacteria 1520
234 Ga0373931_0002249 3300035691 Bacteria 8529
235 Ga0373933_0111554 3300035724 Bacteria 1706
236 Ga0373937_0279139 3300036401 Bacteria 1577
237 Ga0373925_0276793 3300037068 Bacteria 1351
238 Ga0395899_0014569 3300037312 Bacteria 6002
239 Ga0395900_0004160 3300037418 Bacteria 15400
240 Ga0395898_0114407 3300037466 Bacteria 2585
241 Ga0395905_0336907 3300037471 Bacteria 1399
242 Ga0395901_0872941 3300038443 Bacteria 883
243 Ga0436365_1630323 3300039437 Bacteria 1333
244 Ga0439466_0074072 3300041411 Bacteria 1081
245 Ga0451835_0380250 3300041492 Bacteria 571
246 Ga0451843_0143008 3300041509 Bacteria 658
247 Ga0451843_0754311 3300041509 Bacteria 766
248 Ga0439435_0129459 3300042436 Bacteria 796
249 Ga0439464_0048828 3300042439 Bacteria 1220
250 Ga0439440_0100812 3300042993 Bacteria 786
251 Ga0466961_0628264 3300044693 Bacteria 645
252 Ga0495651_0572347 3300046462 Bacteria 715
253 Ga0495639_0439006 3300046475 Bacteria 662
254 Ga0495643_0338778 3300046522 Bacteria 676
255 Ga0495652_0162045 3300046529 Bacteria 1735
256 Ga0495667_0440822 3300046559 Bacteria 819
257 Ga0495611_0253356 3300046648 Bacteria 816
258 Ga0495659_0030442 3300046664 Bacteria 1879
259 Ga0495604_0256896 3300047317 Bacteria 1189
260 Ga0495636_0247137 3300047318 Bacteria 824
261 Ga0495675_0240151 3300047444 Bacteria 1091
262 Ga0495686_0041004 3300047472 Bacteria 2949
263 Ga0495686_0091014 3300047472 Bacteria 1852
264 Ga0496100_0089431 3300048903 Bacteria 2098
265 Ga0496101_0358746 3300048904 Bacteria 1146
266 Ga0496102_0092484 3300048905 Bacteria 2801
267 Ga0496102_0376179 3300048905 Bacteria 1337
268 Ga0496102_0712457 3300048905 Bacteria 926
269 Ga0496102_0722038 3300048905 Bacteria 919
270 Ga0496103_0327631 3300048906 Bacteria 985
271 Ga0496104_0002884 3300048907 Bacteria 14818
272 Ga0496104_1006882 3300048907 Bacteria 737
273 Ga0496105_0120793 3300048908 Bacteria 2160
274 Ga0496105_0385308 3300048908 Bacteria 1115
275 Ga0496106_0016061 3300048909 Bacteria 5536
276 Ga0496107_0065836 3300048910 Bacteria 2627
277 Ga0496107_0258678 3300048910 Bacteria 1295
278 Ga0496107_0388726 3300048910 Bacteria 1038
279 Ga0496108_0027937 3300048911 Bacteria 4665
280 Ga0496108_0396706 3300048911 Bacteria 1205
281 Ga0496109_0094991 3300048912 Bacteria 2760
282 Ga0496110_0038828 3300048913 Bacteria 4144
283 Ga0496110_0062587 3300048913 Bacteria 3287
284 Ga0496112_0400878 3300048915 Bacteria 1312
285 Ga0496112_0671181 3300048915 Bacteria 965
286 Ga0496113_0106585 3300048916 Bacteria 2177
287 Ga0496114_0950050 3300048917 Bacteria 742
288 Ga0496115_0008059 3300048918 Bacteria 7779
289 Ga0496115_0410672 3300048918 Bacteria 1098
290 Ga0496117_0002204 3300048920 Bacteria 25295
291 Ga0496119_0002314 3300048922 Bacteria 21021
292 Ga0496121_0152795 3300048924 Bacteria 1697
293 Ga0496121_0445407 3300048924 Bacteria 836
294 Ga0496122_0000205 3300048925 Bacteria 131755
295 Ga0496122_0076809 3300048925 Bacteria 2348
296 Ga0496123_0000103 3300048926 Bacteria 168232
297 Ga0496123_0026920 3300048926 Bacteria 4295
298 Ga0496124_0005072 3300048927 Bacteria 15019
299 Ga0496125_0000879 3300048928 Bacteria 47630
300 Ga0496125_0039027 3300048928 Bacteria 4098
301 Ga0496126_0003996 3300048929 Bacteria 18008
302 Ga0496126_0212314 3300048929 Bacteria 1629
303 Ga0501303_015198 3300049526 Bacteria 768
304 Ga0501320_018885 3300049536 Bacteria 782
305 Ga0501031_0091962 3300049568 Bacteria 1979
306 Ga0501031_0144489 3300049568 Bacteria 1554
307 Ga0501032_0029999 3300049569 Bacteria 3730
308 Ga0501032_0185102 3300049569 Bacteria 1362
309 Ga0501033_0069412 3300049570 Bacteria 2590
310 Ga0501034_0017478 3300049571 Bacteria 7356
311 Ga0501034_0101388 3300049571 Bacteria 2872
312 Ga0501034_0102961 3300049571 Bacteria 2848
313 Ga0501034_0383928 3300049571 Bacteria 1329
314 Ga0501034_0449881 3300049571 Bacteria 1206
315 Ga0501034_1168524 3300049571 Bacteria 649
316 Ga0501036_0019863 3300049572 Bacteria 5641
317 Ga0501037_0087142 3300049573 Bacteria 2259
318 Ga0501037_0234616 3300049573 Bacteria 1287
319 Ga0501038_0069701 3300049574 Bacteria 2986
320 Ga0501039_0155020 3300049575 Bacteria 1799
321 Ga0501040_0059002 3300049576 Bacteria 2636
322 Ga0501040_0501563 3300049576 Bacteria 875
323 Ga0501041_0048099 3300049577 Bacteria 2597
324 Ga0501041_0156666 3300049577 Bacteria 1423
325 Ga0501041_0187019 3300049577 Bacteria 1297
326 Ga0501041_0628845 3300049577 Bacteria 686
327 Ga0501042_0167934 3300049578 Bacteria 1583
328 Ga0501043_0064400 3300049579 Bacteria 2878
329 Ga0501043_0079662 3300049579 Bacteria 2573
330 Ga0501046_0000011 3300049580 Bacteria 326457
331 Ga0501046_0428190 3300049580 Bacteria 953
332 Ga0501046_0468539 3300049580 Bacteria 905
333 Ga0501047_0041580 3300049581 Bacteria 4441
334 Ga0501048_0022293 3300049582 Bacteria 4634
335 Ga0501048_0023706 3300049582 Bacteria 4482
336 Ga0501067_0012495 3300049583 Bacteria 4710
337 Ga0501069_0627443 3300049585 Bacteria 646
338 Ga0501070_0247518 3300049586 Bacteria 1458
339 Ga0501070_0993947 3300049586 Bacteria 651
340 Ga0501072_0002293 3300049588 Bacteria 14324
341 Ga0501072_0993620 3300049588 Bacteria 654
342 Ga0501073_0120426 3300049589 Bacteria 1819
343 Ga0501073_0137309 3300049589 Bacteria 1694
344 Ga0501073_0324550 3300049589 Bacteria 1063
345 Ga0501074_0257190 3300049590 Bacteria 1242
346 Ga0501074_0331512 3300049590 Bacteria 1080
347 Ga0501075_0208810 3300049591 Bacteria 1489
348 Ga0501076_0078877 3300049592 Bacteria 2642
349 Ga0501076_0079112 3300049592 Bacteria 2639
350 Ga0501077_0268327 3300049593 Bacteria 1086
351 Ga0501077_0375277 3300049593 Bacteria 908
352 Ga0501079_0001202 3300049741 Bacteria 18135
353 Ga0501080_0067800 3300049742 Bacteria 3319
354 Ga0501080_0550421 3300049742 Bacteria 1028
355 Ga0501081_0049087 3300049743 Bacteria 2905
356 Ga0501081_0210987 3300049743 Bacteria 1410
357 Ga0501035_0144508 3300049822 Bacteria 2066
358 Ga0501035_0206142 3300049822 Bacteria 1684
359 Ga0501035_0288107 3300049822 Bacteria 1386
360 Ga0501035_0522476 3300049822 Bacteria 975
361 Ga0501044_0377143 3300049823 Bacteria 1334
362 Ga0501044_0417845 3300049823 Bacteria 1251
363 Ga0501044_0481225 3300049823 Bacteria 1144
364 Ga0501044_0575434 3300049823 Bacteria 1021
365 Ga0501045_0041355 3300049824 Bacteria 3354
366 nmdc:mga03683_31848_c1 3300050489 Bacteria 2118
367 nmdc:mga03n38_56224_c1 3300050490 Bacteria 1775
368 nmdc:mga03n38_57538_c1 3300050490 Bacteria 1758
369 nmdc:mga00v17_135889_c1 3300050491 Bacteria 1574
370 nmdc:mga0yw44_349125_c1 3300050492 Bacteria 996
371 nmdc:mga0yw44_59470_c1 3300050492 Bacteria 2338
372 nmdc:mga0k408_27138_c1 3300050493 Bacteria 3251
373 nmdc:mga0k408_94902_c1 3300050493 Bacteria 1754
374 nmdc:mga06z11_169056_c1 3300050494 Bacteria 1254
375 nmdc:mga06z11_277573_c1 3300050494 Bacteria 992
376 nmdc:mga06z11_33924_c1 3300050494 Bacteria 2501
377 nmdc:mga06z11_9565_c1 3300050494 Bacteria 4090
378 nmdc:mga04h51_10992_c1 3300050495 Bacteria 2501
379 nmdc:mga04h51_2137_c1 3300050495 Bacteria 4631
380 nmdc:mga05p37_157467_c1 3300050507 Bacteria 2775
381 nmdc:mga05p37_184958_c1 3300050507 Bacteria 2533
382 nmdc:mga05p37_747815_c1 3300050507 Bacteria 1078
383 nmdc:mga05p37_82757_c1 3300050507 Bacteria 3955
384 nmdc:mga09592_43170_c2 3300050508 Bacteria 3336
385 nmdc:mga09592_77963_c1 3300050508 Bacteria 2819
386 nmdc:mga0qj67_218768_c1 3300050509 Bacteria 1546
387 nmdc:mga0qj67_60977_c1 3300050509 Bacteria 2994
388 nmdc:mga0qj67_9866_c1 3300050509 Bacteria 7118
389 nmdc:mga06r32_15707_c1 3300050510 Bacteria 6880
390 nmdc:mga06r32_18811_c1 3300050510 Bacteria 6330
391 nmdc:mga06r32_272513_c1 3300050510 Bacteria 1680
392 nmdc:mga06r32_43447_c1 3300050510 Bacteria 4276
393 nmdc:mga06r32_4581_c1 3300050510 Bacteria 12395
394 nmdc:mga06r32_671412_c1 3300050510 Bacteria 1003
395 nmdc:mga08y16_220219_c1 3300050511 Bacteria 1965
396 nmdc:mga08y16_38541_c1 3300050511 Bacteria 5018
397 nmdc:mga08y16_40791_c1 3300050511 Bacteria 4864
398 nmdc:mga08y16_413124_c1 3300050511 Bacteria 1380
399 nmdc:mga0n895_206119_c1 3300050512 Bacteria 1997
400 nmdc:mga0n895_339710_c1 3300050512 Bacteria 1521
401 nmdc:mga0rr50_182152_c1 3300050513 Bacteria 1718
402 nmdc:mga0rr50_409025_c1 3300050513 Bacteria 1147
403 nmdc:mga0a205_195112_c2 3300050515 Bacteria 1358
404 nmdc:mga0a205_319806_c1 3300050515 Bacteria 1423
405 nmdc:mga0a205_542300_c1 3300050515 Bacteria 1019
406 nmdc:mga0a205_759358_c1 3300050515 Bacteria 818
407 nmdc:mga0sz30_111103_c1 3300050516 Bacteria 1201
408 Ga0495601_0059008 3300053077 Bacteria 2432
409 Ga0495612_0048957 3300053078 Bacteria 1733
410 Ga0495595_0035894 3300053084 Bacteria 2247
411 Ga0495619_0236607 3300053085 Bacteria 1265
412 Ga0500555_003376 3300053103 Bacteria 4553
413 Ga0500555_101841 3300053103 Bacteria 728
414 Ga0500562_002334 3300053108 Bacteria 4765
415 Ga0500645_091567 3300053730 Bacteria 862
416 Ga0501084_0008233 3300054114 Bacteria 8602
417 Ga0587084_062001 3300059477 Bacteria 688
418 Ga0587083_0051909 3300059505 Bacteria 897
419 Ga0587106_040558 3300059605 Bacteria 788
420 Ga0587115_030598 3300059626 Bacteria 798
421 Ga0587067_078763 3300059640 Bacteria 726
422 Ga0587072_096996 3300059643 Bacteria 657
423 Ga0587071_030624 3300060344 Bacteria 1034
424 Ga0587111_0046309 3300060346 Bacteria 945
425 Ga0501082_0019866 3300060353 Bacteria 5792
426 Ga0501082_0087575 3300060353 Bacteria 2687
427 Ga0501082_0430966 3300060353 Bacteria 1152
428 Ga0530510_0072532 3300061734 Bacteria 2499
429 Ga0530510_0175724 3300061734 Bacteria 1587
430 Ga0530510_0202447 3300061734 Bacteria 1475
431 2535484323 2534681786 Bacteria 3308809
432 2753358886 2751185800 Bacteria 5467370
433 2757572604 2757320392 Bacteria 3737298
434 2854916040 2854911287 Bacteria 5582813
435 2928526140 2928521798 Bacteria 4960112
436 2939670013 2939669807 Bacteria 5028511
437 2954014962 2954011201 Bacteria 4762601
438 2989354380 2989349275 Bacteria 6349068
439 2989775372 2989771324 Bacteria 5605128
440 3002143139 3002141150 Bacteria 5254435
441 8054560092 8054558443 Bacteria 5204801
442 Ga0105239_10657198
443 JGI24737J22298_10025898
444 Ga0065712_10077039
445 Ga0065715_10123431
446 Ga0065707_10281874
447 Ga0070658_10048709
448 Ga0070658_10122343
449 Ga0070676_10077896
450 Ga0070676_10168224
451 Ga0070683_100161210
452 Ga0070670_100216981
453 Ga0070670_100667843
454 Ga0068869_100078895
455 Ga0068868_100119356
456 Ga0070691_10012364
457 Ga0070692_10446289
458 Ga0070668_100060276
459 Ga0070668_100288927
460 Ga0070675_100057137
461 Ga0070675_100756166
462 Ga0070674_100000967
463 Ga0070673_100126522
464 Ga0070688_100576764
465 Ga0070703_10001257
466 Ga0070701_10016207
467 Ga0070711_100937069
468 Ga0070705_100000029
469 Ga0070700_100001253
470 Ga0070694_100000919
471 Ga0070663_100067669
472 Ga0070662_100101578
473 Ga0070662_100520859
474 Ga0070662_100640395
475 Ga0070681_10593495
476 Ga0070706_100045939
477 Ga0070707_100032638
478 Ga0070707_100141544
479 Ga0070698_100036918
480 Ga0070698_100245097
481 Ga0070699_100000435
482 Ga0070679_100154653
483 Ga0070697_100082446
484 Ga0068853_100009480
485 Ga0068853_101123750
486 Ga0070672_100060563
487 Ga0070686_100578795
488 Ga0070695_100008573
489 Ga0070695_100009413
490 Ga0070696_100001054
491 Ga0070665_100291345
492 Ga0070665_101232179
493 Ga0070704_100001516
494 Ga0070704_100420764
495 Ga0068855_100060201
496 Ga0070664_100269233
497 Ga0068857_100000953
498 Ga0070702_100191696
499 Ga0070702_100244935
500 Ga0068852_100027702
501 Ga0068859_100002557
502 Ga0068859_101758329
503 Ga0068864_100362084
504 Ga0068861_101329671
505 Ga0068858_100256114
506 Ga0068860_100021821
507 Ga0068860_100063513
508 Ga0068860_100838600
509 Ga0068862_100000866
510 Ga0068862_101316576
511 Ga0081455_10000334
512 Ga0081455_10038998
513 Ga0081540_1113036
514 Ga0081539_10033841
515 Ga0075365_10008945
516 Ga0075365_10016530
517 Ga0075365_10147881
518 Ga0075365_10328627
519 Ga0075368_10010378
520 Ga0075368_10018115
521 Ga0075368_10031433
522 Ga0075363_100067147
523 Ga0075363_100087997
524 Ga0075364_10006124
525 Ga0070712_100623882
526 Ga0075362_10002172
527 Ga0075362_10101368
528 Ga0075367_10014480
529 Ga0075367_10101706
530 Ga0075369_10121678
531 Ga0075370_10480594
532 Ga0075428_100037447
533 Ga0075428_100066076
534 Ga0075428_100336680
535 Ga0075428_100496133
536 Ga0075428_100538335
537 Ga0075430_100029034
538 Ga0075430_100067007
539 Ga0075430_100067157
540 Ga0075431_100002086
541 Ga0075431_100008815
542 Ga0075431_100026676
543 Ga0075431_100066146
544 Ga0075431_100073374
545 Ga0075431_100178775
546 Ga0075433_10274457
547 Ga0075433_10794742
548 Ga0075434_100003360
549 Ga0075434_100123337
550 Ga0075434_100440140
551 Ga0075434_100505628
552 Ga0075434_100590533
553 Ga0075429_100051963
554 Ga0097620_100002557
555 Ga0097620_101758601
556 Ga0075435_100010582
557 Ga0111539_10029483
558 Ga0111539_10205584
559 Ga0105245_10085116
560 Ga0105247_10056261
561 Ga0114129_10082335
562 Ga0114129_10082355
563 Ga0114129_10085939
564 Ga0114129_10421116
565 Ga0105243_10250959
566 Ga0105242_10260333
567 Ga0105237_10224731
568 Ga0105238_10274143
569 Ga0105239_10219314
570 Ga0105246_10754635
571 Ga0157374_10381111
572 Ga0157378_10133625
573 Ga0163162_10560279
574 Ga0163162_11253980
575 Ga0157375_10305674
576 Ga0163163_10575006
577 Ga0157380_10015316
578 Ga0157380_10025971
579 Ga0157380_10146716
580 Ga0182008_10189662
581 Ga0157379_10159425
582 Ga0157379_10666014
583 Ga0157376_10531905
584 Ga0182005_1004314
585 Ga0163161_10067311
586 Ga0224712_10375820
587 Ga0209025_1000165
588 Ga0209025_1038046
589 Ga0207653_10001895
590 Ga0207647_10076169
591 Ga0207647_10150537
592 Ga0207699_10093702
593 Ga0207645_10044357
594 Ga0207645_10146653
595 Ga0207705_10021634
596 Ga0207705_10093351
597 Ga0207684_10062385
598 Ga0207654_10125291
599 Ga0207707_10133844
600 Ga0207695_10513740
601 Ga0207660_10008659
602 Ga0207662_10217879
603 Ga0207652_10162451
604 Ga0207646_10035437
605 Ga0207646_10494677
606 Ga0207694_10272642
607 Ga0207659_10079738
608 Ga0207659_10601548
609 Ga0207706_10066498
610 Ga0207706_10192753
611 Ga0207669_10029387
612 Ga0207669_10215587
613 Ga0207704_10110935
614 Ga0207661_10127906
615 Ga0207679_10266584
616 Ga0207667_11083998
617 Ga0207651_10009947
618 Ga0207668_10374841
619 Ga0207640_10016699
620 Ga0207640_10506276
621 Ga0207703_10204924
622 Ga0207678_10011542
623 Ga0207678_10090861
624 Ga0207678_10387275
625 Ga0207708_10001278
626 Ga0207708_10074299
627 Ga0207641_10121936
628 Ga0207674_10001858
629 Ga0207674_10005474
630 Ga0207674_10982776
631 Ga0207675_100028598
632 Ga0207675_100084069
633 Ga0207675_100131734
634 Ga0207698_10125562
635 Ga0209969_1027353
636 Ga0209999_1042030
637 Ga0209813_10001093
638 Ga0209813_10016979
639 Ga0207428_10031105
640 Ga0207428_10164627
641 Ga0207428_10230459
642 Ga0268266_10316171
643 Ga0268266_10323433
644 Ga0268265_10038400
645 Ga0268264_10014186
646 Ga0268264_10279408
647 Ga0268264_10793264
648 Ga0265338_10045039
649 Ga0265330_10027748
650 Ga0265325_10004404
651 Ga0265339_10000328
652 Ga0265331_10021153
653 Ga0307408_100026573
654 Ga0265313_10001539
655 Ga0265342_10016182
656 Ga0307516_10088888
657 Ga0307405_10201106
658 Ga0307413_10187809
659 Ga0307413_10305337
660 Ga0307407_10286235
661 Ga0307409_101532777
662 Ga0307416_100383961
663 Ga0307416_100681417
664 Ga0307414_10013224
665 Ga0307411_10643340
666 Ga0307411_10872113
667 Ga0307415_100065456
668 Ga0373940_0009432
669 Ga0373923_0137835
670 Ga0373953_0220807
671 Ga0373956_0127132
672 Ga0373955_0008162
673 Ga0373961_0081042
674 Ga0316574_0146921
675 Ga0373931_0002249
676 Ga0373933_0111554
677 Ga0373937_0279139
678 Ga0373925_0276793
679 Ga0395899_0014569
680 Ga0395900_0004160
681 Ga0395898_0114407
682 Ga0395905_0336907
683 Ga0395901_0872941
684 Ga0436365_1630323
685 Ga0439466_0074072
686 Ga0451835_0380250
687 Ga0451843_0143008
688 Ga0451843_0754311
689 Ga0439435_0129459
690 Ga0439464_0048828
691 Ga0439440_0100812
692 Ga0466961_0628264
693 Ga0495651_0572347
694 Ga0495639_0439006
695 Ga0495643_0338778
696 Ga0495652_0162045
697 Ga0495667_0440822
698 Ga0495611_0253356
699 Ga0495659_0030442
700 Ga0495604_0256896
701 Ga0495636_0247137
702 Ga0495675_0240151
703 Ga0495686_0041004
704 Ga0495686_0091014
705 Ga0496100_0089431
706 Ga0496101_0358746
707 Ga0496102_0092484
708 Ga0496102_0376179
709 Ga0496102_0712457
710 Ga0496102_0722038
711 Ga0496103_0327631
712 Ga0496104_0002884
713 Ga0496104_1006882
714 Ga0496105_0120793
715 Ga0496105_0385308
716 Ga0496106_0016061
717 Ga0496107_0065836
718 Ga0496107_0258678
719 Ga0496107_0388726
720 Ga0496108_0027937
721 Ga0496108_0396706
722 Ga0496109_0094991
723 Ga0496110_0038828
724 Ga0496110_0062587
725 Ga0496112_0400878
726 Ga0496112_0671181
727 Ga0496113_0106585
728 Ga0496114_0950050
729 Ga0496115_0008059
730 Ga0496115_0410672
731 Ga0496117_0002204
732 Ga0496119_0002314
733 Ga0496121_0152795
734 Ga0496121_0445407
735 Ga0496122_0000205
736 Ga0496122_0076809
737 Ga0496123_0000103
738 Ga0496123_0026920
739 Ga0496124_0005072
740 Ga0496125_0000879
741 Ga0496125_0039027
742 Ga0496126_0003996
743 Ga0496126_0212314
744 Ga0501303_015198
745 Ga0501320_018885
746 Ga0501031_0091962
747 Ga0501031_0144489
748 Ga0501032_0029999
749 Ga0501032_0185102
750 Ga0501033_0069412
751 Ga0501034_0017478
752 Ga0501034_0101388
753 Ga0501034_0102961
754 Ga0501034_0383928
755 Ga0501034_0449881
756 Ga0501034_1168524
757 Ga0501036_0019863
758 Ga0501037_0087142
759 Ga0501037_0234616
760 Ga0501038_0069701
761 Ga0501039_0155020
762 Ga0501040_0059002
763 Ga0501040_0501563
764 Ga0501041_0048099
765 Ga0501041_0156666
766 Ga0501041_0187019
767 Ga0501041_0628845
768 Ga0501042_0167934
769 Ga0501043_0064400
770 Ga0501043_0079662
771 Ga0501046_0000011
772 Ga0501046_0428190
773 Ga0501046_0468539
774 Ga0501047_0041580
775 Ga0501048_0022293
776 Ga0501048_0023706
777 Ga0501067_0012495
778 Ga0501069_0627443
779 Ga0501070_0247518
780 Ga0501070_0993947
781 Ga0501072_0002293
782 Ga0501072_0993620
783 Ga0501073_0120426
784 Ga0501073_0137309
785 Ga0501073_0324550
786 Ga0501074_0257190
787 Ga0501074_0331512
788 Ga0501075_0208810
789 Ga0501076_0078877
790 Ga0501076_0079112
791 Ga0501077_0268327
792 Ga0501077_0375277
793 Ga0501079_0001202
794 Ga0501080_0067800
795 Ga0501080_0550421
796 Ga0501081_0049087
797 Ga0501081_0210987
798 Ga0501035_0144508
799 Ga0501035_0206142
800 Ga0501035_0288107
801 Ga0501035_0522476
802 Ga0501044_0377143
803 Ga0501044_0417845
804 Ga0501044_0481225
805 Ga0501044_0575434
806 Ga0501045_0041355
807 nmdc:mga03683_31848_c1
808 nmdc:mga03n38_56224_c1
809 nmdc:mga03n38_57538_c1
810 nmdc:mga00v17_135889_c1
811 nmdc:mga0yw44_349125_c1
812 nmdc:mga0yw44_59470_c1
813 nmdc:mga0k408_27138_c1
814 nmdc:mga0k408_94902_c1
815 nmdc:mga06z11_169056_c1
816 nmdc:mga06z11_277573_c1
817 nmdc:mga06z11_33924_c1
818 nmdc:mga06z11_9565_c1
819 nmdc:mga04h51_10992_c1
820 nmdc:mga04h51_2137_c1
821 nmdc:mga05p37_157467_c1
822 nmdc:mga05p37_184958_c1
823 nmdc:mga05p37_747815_c1
824 nmdc:mga05p37_82757_c1
825 nmdc:mga09592_43170_c2
826 nmdc:mga09592_77963_c1
827 nmdc:mga0qj67_218768_c1
828 nmdc:mga0qj67_60977_c1
829 nmdc:mga0qj67_9866_c1
830 nmdc:mga06r32_15707_c1
831 nmdc:mga06r32_18811_c1
832 nmdc:mga06r32_272513_c1
833 nmdc:mga06r32_43447_c1
834 nmdc:mga06r32_4581_c1
835 nmdc:mga06r32_671412_c1
836 nmdc:mga08y16_220219_c1
837 nmdc:mga08y16_38541_c1
838 nmdc:mga08y16_40791_c1
839 nmdc:mga08y16_413124_c1
840 nmdc:mga0n895_206119_c1
841 nmdc:mga0n895_339710_c1
842 nmdc:mga0rr50_182152_c1
843 nmdc:mga0rr50_409025_c1
844 nmdc:mga0a205_195112_c2
845 nmdc:mga0a205_319806_c1
846 nmdc:mga0a205_542300_c1
847 nmdc:mga0a205_759358_c1
848 nmdc:mga0sz30_111103_c1
849 Ga0495601_0059008
850 Ga0495612_0048957
851 Ga0495595_0035894
852 Ga0495619_0236607
853 Ga0500555_003376
854 Ga0500555_101841
855 Ga0500562_002334
856 Ga0500645_091567
857 Ga0501084_0008233
858 Ga0587084_062001
859 Ga0587083_0051909
860 Ga0587106_040558
861 Ga0587115_030598
862 Ga0587067_078763
863 Ga0587072_096996
864 Ga0587071_030624
865 Ga0587111_0046309
866 Ga0501082_0019866
867 Ga0501082_0087575
868 Ga0501082_0430966
869 Ga0530510_0072532
870 Ga0530510_0175724
871 Ga0530510_0202447
872 2535484323
873 2753358886
874 2757572604
875 2854916040
876 2928526140
877 2939670013
878 2954014962
879 2989354380
880 2989775372
881 3002143139
882 8054560092

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02777

Sod_Fe_C

Iron/manganese superoxide dismutases, C-terminal domain

140

240

0.96

PF00081

Sod_Fe_N

Iron/manganese superoxide dismutases, alpha-hairpin domain

48

132

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tqj-assembly1.cif.gz_B structure of the superoxide dismutase (fe) (sodb) from coxiella burnetii 0.9679 2 197
1isc-assembly1.cif.gz_B structure-function in e. coli iron superoxide dismutase: comparisons with the manganese enzyme from t. thermophilus 0.9659 3 199
1za5-assembly1.cif.gz_B q69h-fesod 0.9651 3 199
2bkb-assembly2.cif.gz_C q69e-fesod 0.9643 3 199
1dt0-assembly2.cif.gz_C-2 cloning, sequence, and crystallographic structure of recombinant iron superoxide dismutase from pseudomonas ovalis 0.9631 2 195
ID Description Score Start End Superfamily
af_A0A0R0EIY1_182_299_3.55.40.20 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.9654 95 201 3.55.40.20
1xuqA02 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.9646 86 200 3.55.40.20
af_Q5VRL3_214_359_3.55.40.20 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.9574 94 201 3.55.40.20
af_I1LCI3_113_243_3.55.40.20 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.9544 86 202 3.55.40.20
3ceiB02 Alpha Beta;3-Layer(bab) Sandwich;minor pseudopilin epsh fold;Iron/manganese superoxide dismutase, C-terminal domain 0.9529 95 202 3.55.40.20
ID Description Score Start End GO Terms
AF-A0A1G8IRB0-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9837 1 200 GO:0004784
GO:0046872
AF-A0A504F4Q9-F1-model_v4 deleted 0.983 1 201
AF-A0A2P7SFX5-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9828 1 200 GO:0004784
GO:0046872
AF-Q8YFZ5-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9827 1 202 GO:0004784
GO:0046872
AF-A0A7W8AFJ8-F1-model_v4 Superoxide dismutase (EC 1.15.1.1) 0.9826 1 200 GO:0004784
GO:0046872

Map