metagRoot

F444622

General Info

Members	Datasets	Scaffolds	Average Seq Length
441	301	424	278

Family's Representative Sequence

Representative Sequence	3300006058\|Ga0075432_10052852\|Ga0075432_100528522
Length	298
Sequence	MIQPMPENSPKTALITGASSGIGEATALHLAELGYTVYAGARRLERMSDLVDRGIRTRTVDVTDDASMTALVEAIIAETGRIDVLVNNAGYGSYGALEDVPIEEARRQFDVNLFGLARLTQLVLPHMRQQHDGYIVNVSSMGGKIWEPLGSWYHASKFAVEGLSDSLRVEVAEFGIKVVIIQPGTIRSEWSGIAADQLEASSASTPYAPQAKIMGAVLRGADQMRLASGPALVAEAIGKAVQSAKPRTRYVVGGGARGILLAERILPDRGFDRFIRVGYRLAAGQGESGRKSQEIDED

Samples

	Sample ID	Description	Type	Environment
1	2509276021	Rhizobium leguminosarum bv. trifolii WSM597	Isolate	Nodule
2	2524023129	Paenibacillus pinihumi DSM 23905	Isolate	Rhizosphere
3	2588253510	Rhizobacter sp. OV335	Isolate	Rhizosphere
4	2643221735	Bacillus sp. Root920	Isolate	Unclassified
5	2728369359	Paenibacillus polymyxa YC0136	Isolate	Rhizosphere
6	2821268502	Microbacterium sp. YT0620BN	Isolate	Unclassified
7	2838042994	Rhizobium esperanzae SEMIA 4089	Isolate	Nodule
8	2838122688	Bradyrhizobium sp. CIR3A	Isolate	Nodule
9	2841864319	Rhizobium leguminosarum SEMIA 4052	Isolate	Nodule
10	2841983080	Bradyrhizobium sp. IAR9	Isolate	Nodule
11	2842198810	Rhizobium aethiopicum SEMIA 470	Isolate	Nodule
12	2881633906	Lactiplantibacillus garii FI11369	Isolate	Unclassified
13	2919051321	Sinomonas atrocyanea 1003	Isolate	Rhizosphere
14	2919443155	Agromyces sp. 3263	Isolate	Rhizosphere
15	2939660829	Mycetocola sp. 2940	Isolate	Rhizosphere
16	2996893221	Rhizobium sp. R635	Isolate	Nodule
17	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
18	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
19	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
20	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
21	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
22	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
23	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
24	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
25	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
26	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
27	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
28	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
29	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
30	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
31	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
32	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
33	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
34	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
35	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
36	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
37	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
38	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
39	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
40	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
41	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
42	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
43	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
44	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
45	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
46	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
47	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
48	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
49	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
50	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
51	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
52	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
53	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
54	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
55	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
56	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
57	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
58	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
59	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
60	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
61	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
62	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
63	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
64	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
65	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
66	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
67	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
68	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
69	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
70	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
71	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
72	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
73	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
74	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
75	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
76	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
77	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
78	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
79	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
80	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
81	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
82	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
83	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
84	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
85	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
86	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
87	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
88	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
89	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
90	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
91	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
92	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
93	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
94	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
95	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
96	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
97	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
98	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
99	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
100	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
101	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
102	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
103	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
104	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
105	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
106	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
147	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300028577	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG	Metagenome	Rhizosphere
151	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
152	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
153	3300031238	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG	Metagenome	Rhizosphere
154	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
155	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
156	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
157	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
158	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
159	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
160	3300031595	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG	Metagenome	Rhizosphere
161	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
162	3300031712	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG	Metagenome	Rhizosphere
163	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
164	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
165	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
166	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
167	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
168	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
169	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
170	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
171	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
172	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
173	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
174	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
175	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
176	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
177	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
178	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
179	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
180	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
181	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
182	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
183	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
184	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
185	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
186	3300038741	Seagrass microbial communities from Seahorse Key, FL, USA - SV0818	Metagenome	Unclassified
187	3300039062	Seagrass microbial communities from Seahorse Key, FL, USA - HH0818	Metagenome	Unclassified
188	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
189	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
190	3300041406	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284	Metagenome	Rhizosphere
191	3300041410	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596	Metagenome	Rhizosphere
192	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
193	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
194	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
195	3300042010	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431	Metagenome	Rhizosphere
196	3300042016	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357	Metagenome	Rhizosphere
197	3300042121	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398	Metagenome	Rhizosphere
198	3300042126	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87	Metagenome	Rhizosphere
199	3300042146	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979	Metagenome	Rhizosphere
200	3300042156	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593	Metagenome	Rhizosphere
201	3300042185	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592	Metagenome	Rhizosphere
202	3300042437	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554	Metagenome	Rhizosphere
203	3300042438	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533	Metagenome	Rhizosphere
204	3300042439	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363	Metagenome	Rhizosphere
205	3300042461	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366	Metagenome	Rhizosphere
206	3300042531	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253	Metagenome	Rhizosphere
207	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
208	3300042993	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372	Metagenome	Rhizosphere
209	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
210	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
211	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
212	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
213	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
214	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
215	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
216	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
217	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
218	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
219	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
220	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
221	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
222	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
223	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
224	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
225	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
226	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
227	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
228	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
229	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
230	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
231	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
232	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
233	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
234	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
235	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
236	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
237	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
238	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
239	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
240	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
241	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
242	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
243	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
244	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
245	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
246	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
247	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
248	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
249	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
250	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
251	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
252	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
253	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
254	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
255	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
256	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
257	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
258	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
259	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
260	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
261	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
262	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
263	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
264	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
265	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
266	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
267	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
268	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
269	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
270	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
271	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
272	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
273	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
274	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
275	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
276	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
277	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
278	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
279	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
280	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
281	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
282	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
283	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
284	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
285	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
286	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
287	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
288	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
289	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
290	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
291	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
292	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
293	3300053087	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere	Metagenome	Endosphere
294	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
295	3300053117	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere	Metagenome	Endosphere
296	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
297	3300053149	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere	Metagenome	Endosphere
298	3300053151	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere	Metagenome	Endosphere
299	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere
300	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
301	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	96.15
Metatranscriptomes	0
Isolates	3.85

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	4.54
Nodule	1.81
Rhizoplane	4.76
Rhizosphere	82.77
Stem	0
Stem Tuber	0
Unclassified	6.12

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25151J46595_10000009	3300003187	Bacteria	296412
2	JGI25406J46586_10009762	3300003203	Bacteria	4290
3	JGI25406J46586_10054041	3300003203	Bacteria	1330
4	rootH1_10093377	3300003316	Bacteria	2540
5	rootH2_10007318	3300003320	Bacteria	12077
6	rootH2_10023157	3300003320	Bacteria	11971
7	rootH1_10001325	3300003323	Bacteria	38210
8	Ga0055539_1008502	3300003752	Bacteria	1284
9	Ga0055540_1004021	3300003792	Bacteria	6845
10	Ga0070658_10005411	3300005327	Bacteria	10358
11	Ga0070682_100004536	3300005337	Bacteria	7715
12	Ga0070682_100008563	3300005337	Bacteria	5774
13	Ga0070682_100122312	3300005337	Bacteria	1749
14	Ga0068868_100040239	3300005338	Bacteria	3637
15	Ga0068868_100240757	3300005338	Bacteria	1520
16	Ga0070660_100218161	3300005339	Bacteria	1550
17	Ga0070687_100014547	3300005343	Bacteria	3535
18	Ga0070668_100001764	3300005347	Bacteria	15741
19	Ga0070668_100020285	3300005347	Bacteria	5014
20	Ga0070668_100437051	3300005347	Bacteria	1123
21	Ga0070669_100001222	3300005353	Bacteria	18647
22	Ga0070669_100164738	3300005353	Bacteria	1725
23	Ga0070674_100164768	3300005356	Bacteria	1685
24	Ga0070673_100072641	3300005364	Bacteria	2767
25	Ga0070688_100021113	3300005365	Bacteria	3799
26	Ga0070659_100115078	3300005366	Bacteria	2173
27	Ga0070659_100380049	3300005366	Bacteria	1189
28	Ga0070667_100000312	3300005367	Bacteria	54191
29	Ga0070709_10090051	3300005434	Bacteria	2021
30	Ga0070711_100109099	3300005439	Bacteria	2028
31	Ga0070700_100057995	3300005441	Bacteria	2431
32	Ga0070694_100006947	3300005444	Bacteria	6877
33	Ga0070663_100165052	3300005455	Bacteria	1707
34	Ga0070663_100374536	3300005455	Bacteria	1158
35	Ga0070662_100003013	3300005457	Bacteria	10481
36	Ga0070662_100042881	3300005457	Bacteria	3234
37	Ga0070706_100013711	3300005467	Bacteria	7495
38	Ga0070684_100103624	3300005535	Bacteria	2545
39	Ga0070697_100110469	3300005536	Bacteria	2290
40	Ga0070672_100087468	3300005543	Bacteria	2507
41	Ga0070672_100250652	3300005543	Bacteria	1491
42	Ga0070695_100042481	3300005545	Bacteria	2886
43	Ga0070693_100007007	3300005547	Bacteria	5490
44	Ga0070665_100149604	3300005548	Unclassified	2338
45	Ga0070665_100167234	3300005548	Bacteria	2201
46	Ga0068855_100008760	3300005563	Bacteria	12232
47	Ga0068857_100149344	3300005577	Bacteria	2116
48	Ga0068854_100040827	3300005578	Bacteria	3275
49	Ga0068856_100008472	3300005614	Bacteria	10007
50	Ga0068856_100443627	3300005614	Bacteria	1318
51	Ga0068852_100212324	3300005616	Bacteria	1836
52	Ga0068852_100213214	3300005616	Bacteria	1833
53	Ga0068852_100230291	3300005616	Unclassified	1766
54	Ga0068859_100000574	3300005617	Bacteria	36714
55	Ga0068866_10003002	3300005718	Bacteria	6969
56	Ga0068861_100240490	3300005719	Bacteria	1539
57	Ga0068861_100287601	3300005719	Bacteria	1418
58	Ga0068863_100000496	3300005841	Bacteria	39941
59	Ga0068858_100068693	3300005842	Bacteria	3284
60	Ga0068858_100523715	3300005842	Bacteria	1146
61	Ga0068860_100000190	3300005843	Bacteria	97582
62	Ga0068860_100049786	3300005843	Bacteria	3989
63	Ga0068862_100000024	3300005844	Bacteria	197686
64	Ga0068862_100041822	3300005844	Bacteria	3901
65	Ga0068862_100077144	3300005844	Bacteria	2885
66	Ga0081455_10004538	3300005937	Bacteria	15507
67	Ga0081455_10011994	3300005937	Bacteria	8672
68	Ga0081455_10075876	3300005937	Bacteria	2771
69	Ga0081538_10000579	3300005981	Bacteria	40771
70	Ga0081538_10014595	3300005981	Bacteria	6143
71	Ga0081538_10081294	3300005981	Bacteria	1724
72	Ga0081540_1003672	3300005983	Bacteria	12039
73	Ga0081539_10000262	3300005985	Bacteria	121044
74	Ga0081539_10007992	3300005985	Bacteria	9397
75	Ga0081539_10021320	3300005985	Bacteria	4336
76	Ga0081539_10033182	3300005985	Bacteria	3149
77	Ga0070717_10257138	3300006028	Bacteria	1544
78	Ga0070717_10303999	3300006028	Bacteria	1418
79	Ga0075432_10000018	3300006058	Bacteria	30031
80	Ga0075432_10000040	3300006058	Bacteria	24283
81	Ga0075432_10052852	3300006058	Bacteria	1436
82	Ga0070716_100117920	3300006173	Bacteria	1656
83	Ga0070712_100177928	3300006175	Bacteria	1655
84	Ga0075428_100002090	3300006844	Bacteria	21535
85	Ga0075428_100062889	3300006844	Bacteria	4063
86	Ga0075428_100173725	3300006844	Bacteria	2334
87	Ga0075430_100072793	3300006846	Bacteria	2882
88	Ga0075431_100064629	3300006847	Bacteria	3778
89	Ga0075431_100241635	3300006847	Bacteria	1837
90	Ga0075433_10025154	3300006852	Bacteria	5032
91	Ga0075433_10126367	3300006852	Bacteria	2271
92	Ga0075434_100000292	3300006871	Bacteria	35457
93	Ga0075434_100047945	3300006871	Bacteria	4239
94	Ga0075434_100143227	3300006871	Bacteria	2410
95	Ga0068865_100013106	3300006881	Bacteria	5231
96	Ga0068865_100201834	3300006881	Bacteria	1544
97	Ga0075436_100007323	3300006914	Bacteria	7546
98	Ga0075436_100152607	3300006914	Bacteria	1626
99	Ga0097620_100000574	3300006931	Bacteria	36714
100	Ga0075435_100000680	3300007076	Bacteria	21088
101	Ga0075435_100048856	3300007076	Bacteria	3400
102	Ga0075435_100065512	3300007076	Bacteria	2953
103	Ga0105240_10484575	3300009093	Bacteria	1378
104	Ga0105240_10602199	3300009093	Bacteria	1210
105	Ga0111539_10000347	3300009094	Bacteria	57043
106	Ga0111539_10135955	3300009094	Bacteria	2878
107	Ga0105245_10012352	3300009098	Bacteria	7431
108	Ga0105245_10318133	3300009098	Bacteria	1532
109	Ga0105247_10000046	3300009101	Bacteria	151843
110	Ga0105247_10050283	3300009101	Bacteria	2564
111	Ga0114129_10001208	3300009147	Bacteria	34287
112	Ga0114129_10142787	3300009147	Bacteria	3280
113	Ga0105243_10001475	3300009148	Bacteria	20626
114	Ga0105243_10029830	3300009148	Bacteria	4196
115	Ga0105243_10266434	3300009148	Bacteria	1536
116	Ga0105243_10325987	3300009148	Bacteria	1401
117	Ga0105241_10418175	3300009174	Bacteria	1179
118	Ga0105242_10159314	3300009176	Bacteria	1974
119	Ga0105242_10289909	3300009176	Bacteria	1490
120	Ga0105248_10000302	3300009177	Bacteria	58644
121	Ga0105248_10027998	3300009177	Bacteria	6276
122	Ga0105238_10149958	3300009551	Bacteria	2307
123	Ga0105238_10184929	3300009551	Bacteria	2060
124	Ga0105249_10000333	3300009553	Bacteria	47704
125	Ga0105249_10035985	3300009553	Bacteria	4492
126	Ga0105249_10079992	3300009553	Bacteria	3035
127	Ga0105239_10064661	3300010375	Bacteria	4016
128	Ga0105239_10092867	3300010375	Bacteria	3331
129	Ga0105239_10419560	3300010375	Bacteria	1516
130	Ga0157370_10042431	3300013104	Unclassified	4384
131	Ga0157369_10225649	3300013105	Bacteria	1960
132	Ga0157374_10070683	3300013296	Bacteria	3290
133	Ga0163162_10012483	3300013306	Bacteria	8300
134	Ga0163162_10113665	3300013306	Bacteria	2806
135	Ga0157372_10040162	3300013307	Bacteria	5166
136	Ga0157375_10057697	3300013308	Bacteria	3838
137	Ga0163163_10325488	3300014325	Bacteria	1591
138	Ga0157380_10284775	3300014326	Bacteria	1514
139	Ga0157377_10072996	3300014745	Bacteria	1987
140	Ga0157379_10033853	3300014968	Bacteria	4556
141	Ga0163161_10097243	3300017792	Bacteria	2187
142	Ga0207425_1013604	3300025245	Bacteria	1874
143	Ga0209677_100147	3300025253	Bacteria	65365
144	Ga0209129_1000096	3300025258	Bacteria	166298
145	Ga0209025_1000001	3300025294	Bacteria	1888151
146	Ga0209025_1000045	3300025294	Bacteria	349118
147	Ga0209051_1005248	3300025303	Bacteria	7645
148	Ga0207692_10007425	3300025898	Bacteria	4494
149	Ga0207642_10010649	3300025899	Bacteria	3251
150	Ga0207642_10080065	3300025899	Bacteria	1583
151	Ga0207710_10000071	3300025900	Bacteria	151859
152	Ga0207688_10021574	3300025901	Bacteria	3520
153	Ga0207647_10147201	3300025904	Bacteria	1378
154	Ga0207685_10001473	3300025905	Bacteria	4960
155	Ga0207699_10012039	3300025906	Bacteria	4390
156	Ga0207705_10022955	3300025909	Bacteria	4449
157	Ga0207684_10004017	3300025910	Bacteria	14063
158	Ga0207693_10000761	3300025915	Bacteria	28954
159	Ga0207693_10055617	3300025915	Bacteria	3104
160	Ga0207663_10063700	3300025916	Bacteria	2349
161	Ga0207662_10033065	3300025918	Bacteria	3012
162	Ga0207657_10067899	3300025919	Bacteria	3030
163	Ga0207649_10444607	3300025920	Bacteria	977
164	Ga0207681_10001544	3300025923	Bacteria	14844
165	Ga0207681_10139310	3300025923	Bacteria	1805
166	Ga0207687_10011705	3300025927	Bacteria	5738
167	Ga0207664_10103485	3300025929	Bacteria	2356
168	Ga0207706_10034652	3300025933	Bacteria	4491
169	Ga0207706_10046584	3300025933	Bacteria	3839
170	Ga0207686_10078061	3300025934	Bacteria	2152
171	Ga0207669_10341105	3300025937	Bacteria	1154
172	Ga0207704_10006247	3300025938	Bacteria	5540
173	Ga0207704_10041156	3300025938	Bacteria	2707
174	Ga0207665_10000422	3300025939	Bacteria	29175
175	Ga0207691_10063119	3300025940	Bacteria	3360
176	Ga0207711_10000106	3300025941	Bacteria	89143
177	Ga0207689_10004251	3300025942	Bacteria	13022
178	Ga0207651_10114027	3300025960	Bacteria	2035
179	Ga0207712_10000289	3300025961	Bacteria	47458
180	Ga0207712_10224532	3300025961	Bacteria	1504
181	Ga0207668_10001678	3300025972	Bacteria	12951
182	Ga0207668_10019323	3300025972	Bacteria	4305
183	Ga0207658_10000272	3300025986	Bacteria	54201
184	Ga0207703_10135949	3300026035	Bacteria	2128
185	Ga0207639_10127470	3300026041	Bacteria	2101
186	Ga0207678_10045572	3300026067	Bacteria	3792
187	Ga0207708_10076422	3300026075	Bacteria	2569
188	Ga0207702_10077252	3300026078	Bacteria	2879
189	Ga0207641_10000643	3300026088	Bacteria	38084
190	Ga0207641_10072874	3300026088	Bacteria	2959
191	Ga0207676_10211645	3300026095	Bacteria	1720
192	Ga0207674_10097879	3300026116	Bacteria	2917
193	Ga0207675_100007898	3300026118	Bacteria	10032
194	Ga0207675_100024939	3300026118	Bacteria	5564
195	Ga0207675_100098685	3300026118	Bacteria	2751
196	Ga0207683_10012785	3300026121	Bacteria	7164
197	Ga0207698_10558685	3300026142	Bacteria	1123
198	Ga0207428_10000778	3300027907	Bacteria	36215
199	Ga0207428_10000883	3300027907	Bacteria	33637
200	Ga0207428_10283776	3300027907	Bacteria	1228
201	Ga0268266_10199739	3300028379	Unclassified	1829
202	Ga0268265_10000012	3300028380	Bacteria	343132
203	Ga0268265_10028240	3300028380	Bacteria	4015
204	Ga0268265_10465471	3300028380	Bacteria	1184
205	Ga0268264_10000223	3300028381	Bacteria	110442
206	Ga0265318_10007778	3300028577	Bacteria	4817
207	Ga0307515_10000004	3300028794	Bacteria	846506
208	Ga0307515_10023622	3300028794	Bacteria	10764
209	Ga0307515_10185647	3300028794	Bacteria	2010
210	Ga0265330_10025505	3300031235	Bacteria	2679
211	Ga0265332_10007395	3300031238	Bacteria	4970
212	Ga0265328_10106344	3300031239	Bacteria	1041
213	Ga0265325_10042905	3300031241	Bacteria	2362
214	Ga0265340_10039367	3300031247	Bacteria	2333
215	Ga0265339_10135004	3300031249	Bacteria	1259
216	Ga0265316_10044794	3300031344	Bacteria	3516
217	Ga0307408_100000323	3300031548	Bacteria	45826
218	Ga0307408_100001728	3300031548	Bacteria	15979
219	Ga0307408_100009456	3300031548	Bacteria	6430
220	Ga0307408_100016315	3300031548	Bacteria	4955
221	Ga0307408_100216966	3300031548	Bacteria	1559
222	Ga0265313_10013322	3300031595	Bacteria	4943
223	Ga0265314_10027844	3300031711	Bacteria	4223
224	Ga0265342_10007973	3300031712	Bacteria	7666
225	Ga0307516_10107330	3300031730	Bacteria	2601
226	Ga0307516_10130627	3300031730	Bacteria	2291
227	Ga0307405_10001893	3300031731	Bacteria	8993
228	Ga0307413_10000480	3300031824	Bacteria	13042
229	Ga0307413_10060868	3300031824	Bacteria	2326
230	Ga0307410_10000343	3300031852	Bacteria	18011
231	Ga0307410_10003408	3300031852	Bacteria	7973
232	Ga0307406_10000449	3300031901	Bacteria	24046
233	Ga0307406_10006624	3300031901	Bacteria	6403
234	Ga0307406_10065456	3300031901	Bacteria	2362
235	Ga0307407_10014138	3300031903	Bacteria	3898
236	Ga0307407_10014201	3300031903	Bacteria	3892
237	Ga0307412_10005959	3300031911	Bacteria	6870
238	Ga0307409_100000068	3300031995	Bacteria	38097
239	Ga0307409_100000652	3300031995	Bacteria	15371
240	Ga0307409_100204611	3300031995	Bacteria	1769
241	Ga0307416_100000041	3300032002	Bacteria	131920
242	Ga0307416_100111153	3300032002	Bacteria	2415
243	Ga0307416_100306629	3300032002	Bacteria	1581
244	Ga0307416_100341421	3300032002	Bacteria	1510
245	Ga0307416_100491564	3300032002	Bacteria	1289
246	Ga0307414_10014917	3300032004	Bacteria	4677
247	Ga0307414_10374906	3300032004	Bacteria	1228
248	Ga0307411_10001694	3300032005	Bacteria	9245
249	Ga0307411_10021356	3300032005	Bacteria	3786
250	Ga0307415_100004088	3300032126	Bacteria	7526
251	Ga0307415_100008831	3300032126	Bacteria	5611
252	Ga0307510_10048003	3300033180	Bacteria	4562
253	Ga0373950_0012342	3300034818	Bacteria	1409
254	Ga0373940_0008692	3300035088	Bacteria	2341
255	Ga0373942_0001000	3300035207	Bacteria	7694
256	Ga0373962_0000618	3300035242	Bacteria	8039
257	Ga0316582_0050624	3300036647	Bacteria	2632
258	Ga0316584_0004118	3300036712	Bacteria	9590
259	Ga0395899_0007225	3300037312	Bacteria	8597
260	Ga0395900_0024031	3300037418	Bacteria	6236
261	Ga0395898_0519069	3300037466	Bacteria	1132
262	Ga0395901_0120930	3300038443	Bacteria	2752
263	Ga0400488_55673	3300038741	Bacteria	1432
264	Ga0400483_061938	3300039062	Bacteria	1260
265	Ga0400489_47753	3300039093	Bacteria	5645
266	Ga0400489_75070	3300039093	Bacteria	1159
267	Ga0400489_82139	3300039093	Bacteria	1308
268	Ga0436360_0119180	3300039438	Bacteria	3501
269	Ga0439439_0000584	3300041406	Bacteria	6387
270	Ga0439461_0000847	3300041410	Bacteria	4522
271	Ga0439433_0000844	3300041999	Bacteria	6075
272	Ga0439448_0004413	3300042005	Bacteria	3968
273	Ga0439448_0023746	3300042005	Bacteria	1915
274	Ga0439432_016275	3300042006	Bacteria	2504
275	Ga0439452_003443	3300042010	Bacteria	5536
276	Ga0439463_000888	3300042016	Bacteria	8233
277	Ga0439463_012197	3300042016	Bacteria	2111
278	Ga0439463_056344	3300042016	Bacteria	1004
279	Ga0450919_001271	3300042121	Bacteria	3297
280	Ga0450888_001206	3300042126	Bacteria	2468
281	Ga0450907_007917	3300042146	Bacteria	1769
282	Ga0439446_0007668	3300042156	Bacteria	2844
283	Ga0450909_000344	3300042185	Bacteria	5889
284	Ga0439444_0013776	3300042437	Bacteria	1343
285	Ga0439459_0033515	3300042438	Unclassified	1058
286	Ga0439464_0058636	3300042439	Bacteria	1124
287	Ga0439460_0067139	3300042461	Bacteria	1104
288	Ga0450918_000279	3300042531	Bacteria	11567
289	Ga0451577_0859674	3300042876	Bacteria	818
290	Ga0439440_0002218	3300042993	Bacteria	3637
291	Ga0439440_0002346	3300042993	Bacteria	3565
292	Ga0466966_0000017	3300044684	Bacteria	123642
293	Ga0466961_0005349	3300044693	Bacteria	8076
294	Ga0466963_0076423	3300044694	Unclassified	2261
295	Ga0453684_0000648	3300044712	Bacteria	125276
296	Ga0453684_0001426	3300044712	Bacteria	68576
297	Ga0453684_0259117	3300044712	Bacteria	1993
298	Ga0453684_0891756	3300044712	Bacteria	953
299	Ga0466971_0012148	3300044719	Unclassified	3774
300	Ga0466957_0010394	3300044842	Bacteria	5341
301	Ga0466959_0202471	3300045049	Unclassified	1381
302	Ga0451576_0000357	3300045051	Bacteria	109975
303	Ga0451576_0000887	3300045051	Bacteria	56861
304	Ga0466958_0007940	3300045836	Bacteria	5864
305	Ga0466958_0467193	3300045836	Bacteria	817
306	Ga0495638_0098388	3300046460	Bacteria	1753
307	Ga0495641_0022478	3300046461	Bacteria	3154
308	Ga0495650_0000027	3300046471	Bacteria	475071
309	Ga0495650_0000591	3300046471	Bacteria	50174
310	Ga0495616_0066486	3300046513	Bacteria	1754
311	Ga0495631_0083457	3300046518	Bacteria	1377
312	Ga0495637_0022627	3300046520	Bacteria	2865
313	Ga0495666_0169799	3300046526	Bacteria	1009
314	Ga0495654_0103604	3300046530	Bacteria	1306
315	Ga0495656_0052453	3300046615	Bacteria	1749
316	Ga0495656_0167333	3300046615	Bacteria	1072
317	Ga0495625_0016961	3300046660	Bacteria	5713
318	Ga0495658_0122876	3300046683	Bacteria	1572
319	Ga0495669_0025305	3300046684	Bacteria	2587
320	Ga0495624_0238523	3300046690	Bacteria	1101
321	Ga0495670_0226054	3300046691	Bacteria	995
322	Ga0495671_0179921	3300046692	Bacteria	1027
323	Ga0495660_0169656	3300046810	Bacteria	1064
324	Ga0495676_0039375	3300047321	Bacteria	3915
325	Ga0495614_0126370	3300048089	Bacteria	1130
326	Ga0496100_0098916	3300048903	Bacteria	2006
327	Ga0496101_0062223	3300048904	Bacteria	2713
328	Ga0496102_0002013	3300048905	Bacteria	17555
329	Ga0496102_0064569	3300048905	Bacteria	3353
330	Ga0496103_0000620	3300048906	Bacteria	27358
331	Ga0496104_0000544	3300048907	Bacteria	32282
332	Ga0496104_0086883	3300048907	Bacteria	2986
333	Ga0496105_0018402	3300048908	Bacteria	5613
334	Ga0496105_0046009	3300048908	Bacteria	3602
335	Ga0496108_0011165	3300048911	Bacteria	7297
336	Ga0496108_0062358	3300048911	Bacteria	3139
337	Ga0496109_0020359	3300048912	Bacteria	5860
338	Ga0496109_0035363	3300048912	Bacteria	4506
339	Ga0496110_0020886	3300048913	Bacteria	5532
340	Ga0496110_0627913	3300048913	Bacteria	973
341	Ga0496111_0036531	3300048914	Bacteria	3513
342	Ga0496112_0044972	3300048915	Bacteria	4327
343	Ga0496112_0761171	3300048915	Bacteria	894
344	Ga0496113_0007399	3300048916	Bacteria	7062
345	Ga0496114_0208234	3300048917	Bacteria	1715
346	Ga0496115_0012953	3300048918	Bacteria	6290
347	Ga0496116_0011222	3300048919	Bacteria	7439
348	Ga0496117_0000550	3300048920	Bacteria	61610
349	Ga0496118_0000473	3300048921	Bacteria	66681
350	Ga0496119_0022345	3300048922	Bacteria	4532
351	Ga0496120_0003530	3300048923	Bacteria	14153
352	Ga0496121_0001856	3300048924	Bacteria	33927
353	Ga0496125_0002458	3300048928	Bacteria	24073
354	Ga0496125_0013158	3300048928	Bacteria	8153
355	Ga0496126_0001953	3300048929	Bacteria	29245
356	Ga0501031_0017516	3300049568	Bacteria	4657
357	Ga0501032_0014099	3300049569	Bacteria	5668
358	Ga0501032_0155829	3300049569	Bacteria	1500
359	Ga0501032_0219253	3300049569	Bacteria	1238
360	Ga0501033_0064805	3300049570	Bacteria	2688
361	Ga0501034_0006402	3300049571	Bacteria	12683
362	Ga0501034_0047185	3300049571	Bacteria	4351
363	Ga0501034_0102077	3300049571	Bacteria	2861
364	Ga0501036_0078138	3300049572	Bacteria	2799
365	Ga0501036_0085546	3300049572	Bacteria	2665
366	Ga0501037_0130210	3300049573	Bacteria	1804
367	Ga0501038_0089337	3300049574	Bacteria	2584
368	Ga0501038_0138292	3300049574	Bacteria	1994
369	Ga0501039_0025639	3300049575	Bacteria	4531
370	Ga0501043_0002890	3300049579	Bacteria	14349
371	Ga0501043_0068963	3300049579	Bacteria	2777
372	Ga0501046_0184294	3300049580	Bacteria	1559
373	Ga0501047_0003214	3300049581	Bacteria	15490
374	Ga0501047_0021380	3300049581	Bacteria	6210
375	Ga0501047_0200557	3300049581	Bacteria	1856
376	Ga0501067_0011644	3300049583	Bacteria	4871
377	Ga0501067_0018718	3300049583	Bacteria	3834
378	Ga0501067_0111330	3300049583	Bacteria	1522
379	Ga0501069_0003461	3300049585	Bacteria	8123
380	Ga0501070_0342010	3300049586	Bacteria	1215
381	Ga0501072_0139215	3300049588	Bacteria	1935
382	Ga0501072_0194312	3300049588	Bacteria	1618
383	Ga0501073_0056084	3300049589	Bacteria	2756
384	Ga0501074_0042564	3300049590	Bacteria	3286
385	Ga0501076_0317906	3300049592	Bacteria	1277
386	Ga0501077_0071727	3300049593	Bacteria	2195
387	Ga0501077_0306908	3300049593	Bacteria	1011
388	Ga0501217_046450	3300049661	Bacteria	1122
389	Ga0501079_0195953	3300049741	Bacteria	1577
390	Ga0501080_0005429	3300049742	Bacteria	11375
391	Ga0501080_0352388	3300049742	Bacteria	1329
392	Ga0501083_0009457	3300049744	Bacteria	6885
393	Ga0501044_0046763	3300049823	Bacteria	4479
394	Ga0501044_0215353	3300049823	Bacteria	1873
395	Ga0501044_0217487	3300049823	Bacteria	1862
396	nmdc:mga00v17_25551_c1	3300050491	Bacteria	3433
397	nmdc:mga05p37_66534_c1	3300050507	Bacteria	4433
398	nmdc:mga0qj67_215670_c1	3300050509	Bacteria	1558
399	nmdc:mga06r32_163075_c1	3300050510	Bacteria	2211
400	nmdc:mga06r32_35352_c1	3300050510	Bacteria	4715
401	nmdc:mga06r32_60316_c1	3300050510	Bacteria	3650
402	nmdc:mga08y16_2768_c1	3300050511	Bacteria	17969
403	nmdc:mga0n895_153821_c1	3300050512	Bacteria	2331
404	nmdc:mga0n895_957_c1	3300050512	Bacteria	20920
405	nmdc:mga0rr50_60318_c1	3300050513	Bacteria	2853
406	nmdc:mga08x19_4229_c1	3300050514	Bacteria	8505
407	nmdc:mga08x19_74457_c1	3300050514	Bacteria	2218
408	nmdc:mga0a205_162_c1	3300050515	Bacteria	44184
409	nmdc:mga0a205_1797_c1	3300050515	Bacteria	18543
410	nmdc:mga0sz30_8751_c1	3300050516	Bacteria	3432
411	Ga0500578_0078037	3300053086	Bacteria	2108
412	Ga0500643_014902	3300053087	Bacteria	2683
413	Ga0500555_015102	3300053103	Unclassified	2227
414	Ga0500593_000001	3300053117	Bacteria	784404
415	Ga0500658_0016294	3300053134	Bacteria	2768
416	Ga0500600_0047546	3300053149	Bacteria	2446
417	Ga0500604_0010902	3300053151	Bacteria	2436
418	Ga0500622_0001611	3300053156	Bacteria	17723
419	Ga0500622_0007684	3300053156	Bacteria	6096
420	Ga0501084_0000656	3300054114	Bacteria	26406
421	Ga0501084_0236948	3300054114	Bacteria	1540
422	Ga0501082_0007142	3300060353	Bacteria	9625
423	Ga0501082_0057763	3300060353	Bacteria	3342
424	Ga0501082_0170091	3300060353	Bacteria	1894

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300044712	Ga0453684_0259117	Ga0453684_0259117_23_655	209
2	3300046683	Ga0495658_0122876	Ga0495658_0122876_791_1546	229
3	3300048089	Ga0495614_0126370	Ga0495614_0126370_88_843	229
4	3300049741	Ga0501079_0195953	Ga0501079_0195953_36_737	231
5	3300009093	Ga0105240_10602199	Ga0105240_106021992	232
6	3300009098	Ga0105245_10318133	Ga0105245_103181332	232
7	3300009101	Ga0105247_10050283	Ga0105247_100502834	232
8	3300009148	Ga0105243_10266434	Ga0105243_102664342	232
9	3300009174	Ga0105241_10418175	Ga0105241_104181752	232
10	3300009176	Ga0105242_10159314	Ga0105242_101593143	232
11	3300009177	Ga0105248_10027998	Ga0105248_100279984	232
12	3300009553	Ga0105249_10035985	Ga0105249_100359851	232
13	3300010375	Ga0105239_10064661	Ga0105239_100646611	232
14	3300013105	Ga0157369_10225649	Ga0157369_102256493	232
15	3300013296	Ga0157374_10070683	Ga0157374_100706834	232
16	3300013306	Ga0163162_10012483	Ga0163162_100124836	232
17	3300013308	Ga0157375_10057697	Ga0157375_100576973	232
18	3300014326	Ga0157380_10284775	Ga0157380_102847752	232
19	3300014745	Ga0157377_10072996	Ga0157377_100729963	232
20	3300014968	Ga0157379_10033853	Ga0157379_100338531	232
21	3300037312	Ga0395899_0007225	Ga0395899_0007225_179_904	232
22	3300045836	Ga0466958_0467193	Ga0466958_0467193_58_795	232
23	3300039062	Ga0400483_061938	Ga0400483_061938_17_721	233
24	3300039093	Ga0400489_82139	Ga0400489_82139_32_733	233
25	3300044712	Ga0453684_0891756	Ga0453684_0891756_191_892	233
26	3300050509	nmdc:mga0qj67_215670_c1	nmdc:mga0qj67_215670_c1_736_1497	233
27	3300053156	Ga0500622_0001611	Ga0500622_0001611_19_723	233
28	3300048913	Ga0496110_0627913	Ga0496110_0627913_34_780	244
29	iso_pu_bacteria	2588253510	2588295481	247
30	3300042876	Ga0451577_0859674	Ga0451577_0859674_45_797	249
31	3300046530	Ga0495654_0103604	Ga0495654_0103604_97_891	251
32	3300036712	Ga0316584_0004118	Ga0316584_0004118_5576_6340	254
33	3300031995	Ga0307409_100204611	Ga0307409_1002046112	262
34	3300032002	Ga0307416_100111153	Ga0307416_1001111532	262
35	iso_pu_bacteria	2841983080	2841987375	262
36	3300005467	Ga0070706_100013711	Ga0070706_1000137119	263
37	3300025910	Ga0207684_10004017	Ga0207684_1000401715	263
38	3300033180	Ga0307510_10048003	Ga0307510_100480034	263
39	3300046471	Ga0495650_0000027	Ga0495650_0000027_254930_255781	263
40	iso_pu_bacteria	2524023129	2524190399	264
41	3300003203	JGI25406J46586_10009762	JGI25406J46586_100097625	265
42	3300005327	Ga0070658_10005411	Ga0070658_100054114	265
43	3300005981	Ga0081538_10014595	Ga0081538_100145957	265
44	3300005985	Ga0081539_10021320	Ga0081539_100213203	265
45	3300025909	Ga0207705_10022955	Ga0207705_100229553	265
46	3300053086	Ga0500578_0078037	Ga0500578_0078037_514_1365	265
47	3300053117	Ga0500593_000001	Ga0500593_000001_667767_668567	265
48	3300053156	Ga0500622_0007684	Ga0500622_0007684_1455_2306	265
49	iso_pu_bacteria	2919051321	2919053826	265
50	iso_pu_bacteria	2881633906	2881636567	266
51	3300003203	JGI25406J46586_10054041	JGI25406J46586_100540412	268
52	3300005985	Ga0081539_10007992	Ga0081539_1000799210	268
53	3300025920	Ga0207649_10444607	Ga0207649_104446071	268
54	3300042005	Ga0439448_0004413	Ga0439448_0004413_1145_1972	268
55	3300042461	Ga0439460_0067139	Ga0439460_0067139_144_971	268
56	3300046461	Ga0495641_0022478	Ga0495641_0022478_2229_3101	268
57	3300046526	Ga0495666_0169799	Ga0495666_0169799_72_944	268
58	3300046690	Ga0495624_0238523	Ga0495624_0238523_93_965	268
59	3300047321	Ga0495676_0039375	Ga0495676_0039375_2232_3104	268
60	3300048907	Ga0496104_0086883	Ga0496104_0086883_1509_2330	268
61	3300048908	Ga0496105_0046009	Ga0496105_0046009_2141_2962	268
62	3300048911	Ga0496108_0062358	Ga0496108_0062358_92_913	268
63	3300048912	Ga0496109_0035363	Ga0496109_0035363_2070_2891	268
64	3300048913	Ga0496110_0020886	Ga0496110_0020886_3672_4493	268
65	3300048914	Ga0496111_0036531	Ga0496111_0036531_795_1616	268
66	3300048917	Ga0496114_0208234	Ga0496114_0208234_405_1226	268
67	3300048922	Ga0496119_0022345	Ga0496119_0022345_38_862	268
68	iso_pu_bacteria	2509276021	2509386593	268
69	iso_pu_bacteria	2509276021	2509392833	268
70	iso_pu_bacteria	2643221735	2644739511	268
71	iso_pu_bacteria	2728369359	2730139853	268
72	iso_pu_bacteria	2821268502	2821271807	268
73	iso_pu_bacteria	2838042994	2838045295	268
74	iso_pu_bacteria	2841864319	2841866374	268
75	iso_pu_bacteria	2996893221	2996894421	268
76	3300005543	Ga0070672_100250652	Ga0070672_1002506522	269
77	3300005981	Ga0081538_10000579	Ga0081538_1000057925	269
78	3300005981	Ga0081538_10081294	Ga0081538_100812942	269
79	3300009148	Ga0105243_10325987	Ga0105243_103259872	269
80	3300014325	Ga0163163_10325488	Ga0163163_103254881	269
81	3300025937	Ga0207669_10341105	Ga0207669_103411052	269
82	3300028577	Ga0265318_10007778	Ga0265318_100077781	269
83	3300028794	Ga0307515_10185647	Ga0307515_101856472	269
84	3300031235	Ga0265330_10025505	Ga0265330_100255053	269
85	3300031241	Ga0265325_10042905	Ga0265325_100429051	269
86	3300031247	Ga0265340_10039367	Ga0265340_100393672	269
87	3300031249	Ga0265339_10135004	Ga0265339_101350042	269
88	3300031344	Ga0265316_10044794	Ga0265316_100447943	269
89	3300031548	Ga0307408_100000323	Ga0307408_10000032313	269
90	3300031595	Ga0265313_10013322	Ga0265313_100133225	269
91	3300031711	Ga0265314_10027844	Ga0265314_100278442	269
92	3300031730	Ga0307516_10107330	Ga0307516_101073303	269
93	3300031730	Ga0307516_10130627	Ga0307516_101306271	269
94	3300037466	Ga0395898_0519069	Ga0395898_0519069_36_854	269
95	3300044684	Ga0466966_0000017	Ga0466966_0000017_50738_51571	269
96	3300044693	Ga0466961_0005349	Ga0466961_0005349_1979_2812	269
97	3300044694	Ga0466963_0076423	Ga0466963_0076423_1237_2070	269
98	3300044712	Ga0453684_0000648	Ga0453684_0000648_43393_44208	269
99	3300044719	Ga0466971_0012148	Ga0466971_0012148_2586_3419	269
100	3300045049	Ga0466959_0202471	Ga0466959_0202471_266_1099	269
101	3300046615	Ga0495656_0052453	Ga0495656_0052453_214_1035	269
102	3300046660	Ga0495625_0016961	Ga0495625_0016961_565_1377	269
103	3300049568	Ga0501031_0017516	Ga0501031_0017516_86_946	269
104	3300049569	Ga0501032_0014099	Ga0501032_0014099_3616_4476	269
105	3300049569	Ga0501032_0155829	Ga0501032_0155829_205_1083	269
106	3300049569	Ga0501032_0219253	Ga0501032_0219253_121_981	269
107	3300049570	Ga0501033_0064805	Ga0501033_0064805_1549_2409	269
108	3300049571	Ga0501034_0006402	Ga0501034_0006402_6675_7535	269
109	3300049571	Ga0501034_0047185	Ga0501034_0047185_3229_4089	269
110	3300049571	Ga0501034_0102077	Ga0501034_0102077_1578_2438	269
111	3300049572	Ga0501036_0078138	Ga0501036_0078138_135_995	269
112	3300049572	Ga0501036_0085546	Ga0501036_0085546_1382_2242	269
113	3300049573	Ga0501037_0130210	Ga0501037_0130210_792_1658	269
114	3300049574	Ga0501038_0089337	Ga0501038_0089337_892_1752	269
115	3300049574	Ga0501038_0138292	Ga0501038_0138292_1039_1896	269
116	3300049575	Ga0501039_0025639	Ga0501039_0025639_3617_4477	269
117	3300049579	Ga0501043_0002890	Ga0501043_0002890_2528_3379	269
118	3300049579	Ga0501043_0068963	Ga0501043_0068963_133_993	269
119	3300049580	Ga0501046_0184294	Ga0501046_0184294_431_1291	269
120	3300049581	Ga0501047_0003214	Ga0501047_0003214_1744_2595	269
121	3300049581	Ga0501047_0021380	Ga0501047_0021380_1574_2434	269
122	3300049581	Ga0501047_0200557	Ga0501047_0200557_484_1344	269
123	3300049583	Ga0501067_0011644	Ga0501067_0011644_3097_3948	269
124	3300049583	Ga0501067_0018718	Ga0501067_0018718_1897_2757	269
125	3300049585	Ga0501069_0003461	Ga0501069_0003461_4230_5090	269
126	3300049586	Ga0501070_0342010	Ga0501070_0342010_234_1094	269
127	3300049588	Ga0501072_0139215	Ga0501072_0139215_744_1604	269
128	3300049588	Ga0501072_0194312	Ga0501072_0194312_219_1070	269
129	3300049589	Ga0501073_0056084	Ga0501073_0056084_1419_2279	269
130	3300049590	Ga0501074_0042564	Ga0501074_0042564_24_875	269
131	3300049592	Ga0501076_0317906	Ga0501076_0317906_271_1128	269
132	3300049593	Ga0501077_0071727	Ga0501077_0071727_1137_1994	269
133	3300049593	Ga0501077_0306908	Ga0501077_0306908_89_913	269
134	3300049742	Ga0501080_0005429	Ga0501080_0005429_7540_8400	269
135	3300049742	Ga0501080_0352388	Ga0501080_0352388_350_1210	269
136	3300049744	Ga0501083_0009457	Ga0501083_0009457_3950_4801	269
137	3300049823	Ga0501044_0046763	Ga0501044_0046763_1710_2570	269
138	3300049823	Ga0501044_0215353	Ga0501044_0215353_512_1378	269
139	3300049823	Ga0501044_0217487	Ga0501044_0217487_870_1730	269
140	3300053149	Ga0500600_0047546	Ga0500600_0047546_1382_2272	269
141	3300054114	Ga0501084_0000656	Ga0501084_0000656_13077_13928	269
142	3300054114	Ga0501084_0236948	Ga0501084_0236948_36_860	269
143	3300060353	Ga0501082_0007142	Ga0501082_0007142_4158_5018	269
144	3300060353	Ga0501082_0057763	Ga0501082_0057763_778_1629	269
145	3300060353	Ga0501082_0170091	Ga0501082_0170091_255_1079	269
146	iso_pu_bacteria	2838122688	2838127275	269
147	3300006846	Ga0075430_100072793	Ga0075430_1000727932	270
148	3300006847	Ga0075431_100241635	Ga0075431_1002416352	270
149	3300013104	Ga0157370_10042431	Ga0157370_100424312	270
150	3300028794	Ga0307515_10000004	Ga0307515_10000004128	270
151	3300031238	Ga0265332_10007395	Ga0265332_100073953	270
152	3300031239	Ga0265328_10106344	Ga0265328_101063441	270
153	3300031712	Ga0265342_10007973	Ga0265342_100079734	270
154	3300039438	Ga0436360_0119180	Ga0436360_0119180_860_1687	270
155	3300044712	Ga0453684_0001426	Ga0453684_0001426_5913_6731	270
156	3300045051	Ga0451576_0000357	Ga0451576_0000357_85465_86283	270
157	3300045051	Ga0451576_0000887	Ga0451576_0000887_41415_42233	270
158	3300050510	nmdc:mga06r32_163075_c1	nmdc:mga06r32_163075_c1_593_1465	270
159	iso_pu_bacteria	2939660829	2939662169	270
160	3300003316	rootH1_10093377	rootH1_100933772	271
161	3300003320	rootH2_10007318	rootH2_100073187	271
162	3300003323	rootH1_10001325	rootH1_1000132510	271
163	3300005337	Ga0070682_100004536	Ga0070682_1000045367	271
164	3300005337	Ga0070682_100008563	Ga0070682_1000085635	271
165	3300005337	Ga0070682_100122312	Ga0070682_1001223121	271
166	3300005338	Ga0068868_100040239	Ga0068868_1000402392	271
167	3300005338	Ga0068868_100240757	Ga0068868_1002407572	271
168	3300005339	Ga0070660_100218161	Ga0070660_1002181612	271
169	3300005343	Ga0070687_100014547	Ga0070687_1000145475	271
170	3300005347	Ga0070668_100020285	Ga0070668_1000202855	271
171	3300005347	Ga0070668_100437051	Ga0070668_1004370512	271
172	3300005353	Ga0070669_100164738	Ga0070669_1001647382	271
173	3300005356	Ga0070674_100164768	Ga0070674_1001647682	271
174	3300005364	Ga0070673_100072641	Ga0070673_1000726411	271
175	3300005365	Ga0070688_100021113	Ga0070688_1000211133	271
176	3300005366	Ga0070659_100115078	Ga0070659_1001150782	271
177	3300005366	Ga0070659_100380049	Ga0070659_1003800492	271
178	3300005434	Ga0070709_10090051	Ga0070709_100900512	271
179	3300005439	Ga0070711_100109099	Ga0070711_1001090992	271
180	3300005441	Ga0070700_100057995	Ga0070700_1000579952	271
181	3300005444	Ga0070694_100006947	Ga0070694_1000069475	271
182	3300005455	Ga0070663_100165052	Ga0070663_1001650522	271
183	3300005455	Ga0070663_100374536	Ga0070663_1003745361	271
184	3300005457	Ga0070662_100003013	Ga0070662_1000030137	271
185	3300005457	Ga0070662_100042881	Ga0070662_1000428811	271
186	3300005535	Ga0070684_100103624	Ga0070684_1001036241	271
187	3300005536	Ga0070697_100110469	Ga0070697_1001104692	271
188	3300005543	Ga0070672_100087468	Ga0070672_1000874681	271
189	3300005545	Ga0070695_100042481	Ga0070695_1000424813	271
190	3300005547	Ga0070693_100007007	Ga0070693_1000070073	271
191	3300005548	Ga0070665_100167234	Ga0070665_1001672342	271
192	3300005563	Ga0068855_100008760	Ga0068855_1000087605	271
193	3300005577	Ga0068857_100149344	Ga0068857_1001493442	271
194	3300005578	Ga0068854_100040827	Ga0068854_1000408273	271
195	3300005614	Ga0068856_100008472	Ga0068856_1000084727	271
196	3300005614	Ga0068856_100443627	Ga0068856_1004436272	271
197	3300005616	Ga0068852_100212324	Ga0068852_1002123241	271
198	3300005616	Ga0068852_100213214	Ga0068852_1002132142	271
199	3300005616	Ga0068852_100230291	Ga0068852_1002302911	271
200	3300005718	Ga0068866_10003002	Ga0068866_100030026	271
201	3300005719	Ga0068861_100240490	Ga0068861_1002404902	271
202	3300005719	Ga0068861_100287601	Ga0068861_1002876012	271
203	3300005842	Ga0068858_100523715	Ga0068858_1005237152	271
204	3300005843	Ga0068860_100049786	Ga0068860_1000497862	271
205	3300005844	Ga0068862_100077144	Ga0068862_1000771443	271
206	3300005937	Ga0081455_10004538	Ga0081455_1000453815	271
207	3300005937	Ga0081455_10011994	Ga0081455_100119943	271
208	3300005937	Ga0081455_10075876	Ga0081455_100758762	271
209	3300005983	Ga0081540_1003672	Ga0081540_10036726	271
210	3300005985	Ga0081539_10000262	Ga0081539_10000262120	271
211	3300005985	Ga0081539_10033182	Ga0081539_100331822	271
212	3300006028	Ga0070717_10257138	Ga0070717_102571381	271
213	3300006028	Ga0070717_10303999	Ga0070717_103039992	271
214	3300006058	Ga0075432_10000018	Ga0075432_100000183	271
215	3300006058	Ga0075432_10000040	Ga0075432_1000004015	271
216	3300006058	Ga0075432_10052852	Ga0075432_100528522	271
217	3300006173	Ga0070716_100117920	Ga0070716_1001179202	271
218	3300006175	Ga0070712_100177928	Ga0070712_1001779282	271
219	3300006844	Ga0075428_100002090	Ga0075428_1000020904	271
220	3300006844	Ga0075428_100062889	Ga0075428_1000628892	271
221	3300006844	Ga0075428_100173725	Ga0075428_1001737251	271
222	3300006847	Ga0075431_100064629	Ga0075431_1000646293	271
223	3300006852	Ga0075433_10025154	Ga0075433_100251543	271
224	3300006852	Ga0075433_10126367	Ga0075433_101263673	271
225	3300006871	Ga0075434_100000292	Ga0075434_10000029224	271
226	3300006871	Ga0075434_100047945	Ga0075434_1000479456	271
227	3300006871	Ga0075434_100143227	Ga0075434_1001432273	271
228	3300006881	Ga0068865_100013106	Ga0068865_1000131063	271
229	3300006881	Ga0068865_100201834	Ga0068865_1002018342	271
230	3300006914	Ga0075436_100007323	Ga0075436_1000073236	271
231	3300006914	Ga0075436_100152607	Ga0075436_1001526072	271
232	3300007076	Ga0075435_100000680	Ga0075435_10000068015	271
233	3300007076	Ga0075435_100048856	Ga0075435_1000488564	271
234	3300007076	Ga0075435_100065512	Ga0075435_1000655122	271
235	3300009093	Ga0105240_10484575	Ga0105240_104845752	271
236	3300009094	Ga0111539_10000347	Ga0111539_1000034712	271
237	3300009094	Ga0111539_10135955	Ga0111539_101359553	271
238	3300009098	Ga0105245_10012352	Ga0105245_100123526	271
239	3300009147	Ga0114129_10001208	Ga0114129_1000120817	271
240	3300009147	Ga0114129_10142787	Ga0114129_101427874	271
241	3300009148	Ga0105243_10001475	Ga0105243_1000147514	271
242	3300009148	Ga0105243_10029830	Ga0105243_100298304	271
243	3300009176	Ga0105242_10289909	Ga0105242_102899092	271
244	3300009551	Ga0105238_10149958	Ga0105238_101499582	271
245	3300009551	Ga0105238_10184929	Ga0105238_101849292	271
246	3300009553	Ga0105249_10079992	Ga0105249_100799922	271
247	3300010375	Ga0105239_10092867	Ga0105239_100928672	271
248	3300010375	Ga0105239_10419560	Ga0105239_104195602	271
249	3300013306	Ga0163162_10113665	Ga0163162_101136652	271
250	3300013307	Ga0157372_10040162	Ga0157372_100401624	271
251	3300017792	Ga0163161_10097243	Ga0163161_100972431	271
252	3300025898	Ga0207692_10007425	Ga0207692_100074254	271
253	3300025899	Ga0207642_10010649	Ga0207642_100106493	271
254	3300025899	Ga0207642_10080065	Ga0207642_100800651	271
255	3300025901	Ga0207688_10021574	Ga0207688_100215742	271
256	3300025904	Ga0207647_10147201	Ga0207647_101472012	271
257	3300025905	Ga0207685_10001473	Ga0207685_100014733	271
258	3300025906	Ga0207699_10012039	Ga0207699_100120392	271
259	3300025915	Ga0207693_10000761	Ga0207693_100007616	271
260	3300025915	Ga0207693_10055617	Ga0207693_100556172	271
261	3300025916	Ga0207663_10063700	Ga0207663_100637002	271
262	3300025918	Ga0207662_10033065	Ga0207662_100330653	271
263	3300025919	Ga0207657_10067899	Ga0207657_100678993	271
264	3300025923	Ga0207681_10139310	Ga0207681_101393103	271
265	3300025927	Ga0207687_10011705	Ga0207687_100117054	271
266	3300025929	Ga0207664_10103485	Ga0207664_101034852	271
267	3300025933	Ga0207706_10034652	Ga0207706_100346522	271
268	3300025933	Ga0207706_10046584	Ga0207706_100465842	271
269	3300025934	Ga0207686_10078061	Ga0207686_100780612	271
270	3300025938	Ga0207704_10006247	Ga0207704_100062472	271
271	3300025938	Ga0207704_10041156	Ga0207704_100411563	271
272	3300025939	Ga0207665_10000422	Ga0207665_100004225	271
273	3300025940	Ga0207691_10063119	Ga0207691_100631193	271
274	3300025942	Ga0207689_10004251	Ga0207689_100042518	271
275	3300025960	Ga0207651_10114027	Ga0207651_101140271	271
276	3300025961	Ga0207712_10224532	Ga0207712_102245321	271
277	3300025972	Ga0207668_10019323	Ga0207668_100193232	271
278	3300026041	Ga0207639_10127470	Ga0207639_101274702	271
279	3300026067	Ga0207678_10045572	Ga0207678_100455724	271
280	3300026075	Ga0207708_10076422	Ga0207708_100764223	271
281	3300026078	Ga0207702_10077252	Ga0207702_100772525	271
282	3300026088	Ga0207641_10072874	Ga0207641_100728743	271
283	3300026095	Ga0207676_10211645	Ga0207676_102116452	271
284	3300026116	Ga0207674_10097879	Ga0207674_100978792	271
285	3300026118	Ga0207675_100007898	Ga0207675_1000078985	271
286	3300026118	Ga0207675_100024939	Ga0207675_1000249394	271
287	3300026118	Ga0207675_100098685	Ga0207675_1000986852	271
288	3300026121	Ga0207683_10012785	Ga0207683_100127852	271
289	3300026142	Ga0207698_10558685	Ga0207698_105586851	271
290	3300027907	Ga0207428_10000778	Ga0207428_1000077821	271
291	3300027907	Ga0207428_10000883	Ga0207428_1000088317	271
292	3300027907	Ga0207428_10283776	Ga0207428_102837761	271
293	3300028380	Ga0268265_10465471	Ga0268265_104654711	271
294	3300028794	Ga0307515_10023622	Ga0307515_1002362212	271
295	3300031548	Ga0307408_100001728	Ga0307408_10000172812	271
296	3300031548	Ga0307408_100009456	Ga0307408_1000094564	271
297	3300031548	Ga0307408_100016315	Ga0307408_1000163152	271
298	3300031548	Ga0307408_100216966	Ga0307408_1002169662	271
299	3300031731	Ga0307405_10001893	Ga0307405_100018934	271
300	3300031824	Ga0307413_10000480	Ga0307413_100004803	271
301	3300031824	Ga0307413_10060868	Ga0307413_100608681	271
302	3300031852	Ga0307410_10000343	Ga0307410_1000034314	271
303	3300031852	Ga0307410_10003408	Ga0307410_100034084	271
304	3300031901	Ga0307406_10000449	Ga0307406_1000044919	271
305	3300031901	Ga0307406_10006624	Ga0307406_100066244	271
306	3300031901	Ga0307406_10065456	Ga0307406_100654562	271
307	3300031903	Ga0307407_10014138	Ga0307407_100141384	271
308	3300031903	Ga0307407_10014201	Ga0307407_100142013	271
309	3300031911	Ga0307412_10005959	Ga0307412_100059592	271
310	3300031995	Ga0307409_100000068	Ga0307409_1000000684	271
311	3300031995	Ga0307409_100000652	Ga0307409_1000006524	271
312	3300032002	Ga0307416_100000041	Ga0307416_10000004163	271
313	3300032002	Ga0307416_100306629	Ga0307416_1003066292	271
314	3300032002	Ga0307416_100341421	Ga0307416_1003414212	271
315	3300032002	Ga0307416_100491564	Ga0307416_1004915642	271
316	3300032004	Ga0307414_10014917	Ga0307414_100149171	271
317	3300032004	Ga0307414_10374906	Ga0307414_103749061	271
318	3300032005	Ga0307411_10001694	Ga0307411_100016943	271
319	3300032005	Ga0307411_10021356	Ga0307411_100213561	271
320	3300032126	Ga0307415_100004088	Ga0307415_1000040884	271
321	3300032126	Ga0307415_100008831	Ga0307415_1000088313	271
322	3300036647	Ga0316582_0050624	Ga0316582_0050624_966_1787	271
323	3300041406	Ga0439439_0000584	Ga0439439_0000584_1415_2248	271
324	3300041410	Ga0439461_0000847	Ga0439461_0000847_1760_2593	271
325	3300041999	Ga0439433_0000844	Ga0439433_0000844_98_931	271
326	3300042005	Ga0439448_0023746	Ga0439448_0023746_245_1141	271
327	3300042006	Ga0439432_016275	Ga0439432_016275_1646_2479	271
328	3300042010	Ga0439452_003443	Ga0439452_003443_563_1396	271
329	3300042016	Ga0439463_000888	Ga0439463_000888_4718_5596	271
330	3300042016	Ga0439463_012197	Ga0439463_012197_1067_1924	271
331	3300042016	Ga0439463_056344	Ga0439463_056344_63_905	271
332	3300042121	Ga0450919_001271	Ga0450919_001271_945_1778	271
333	3300042126	Ga0450888_001206	Ga0450888_001206_567_1421	271
334	3300042146	Ga0450907_007917	Ga0450907_007917_158_991	271
335	3300042156	Ga0439446_0007668	Ga0439446_0007668_104_937	271
336	3300042185	Ga0450909_000344	Ga0450909_000344_400_1233	271
337	3300042437	Ga0439444_0013776	Ga0439444_0013776_371_1225	271
338	3300042438	Ga0439459_0033515	Ga0439459_0033515_28_885	271
339	3300042439	Ga0439464_0058636	Ga0439464_0058636_69_947	271
340	3300042531	Ga0450918_000279	Ga0450918_000279_2575_3408	271
341	3300042993	Ga0439440_0002218	Ga0439440_0002218_516_1394	271
342	3300042993	Ga0439440_0002346	Ga0439440_0002346_797_1651	271
343	3300044842	Ga0466957_0010394	Ga0466957_0010394_2465_3319	271
344	3300045836	Ga0466958_0007940	Ga0466958_0007940_3335_4189	271
345	3300046460	Ga0495638_0098388	Ga0495638_0098388_23_856	271
346	3300046471	Ga0495650_0000591	Ga0495650_0000591_42165_42992	271
347	3300046513	Ga0495616_0066486	Ga0495616_0066486_877_1734	271
348	3300046518	Ga0495631_0083457	Ga0495631_0083457_59_931	271
349	3300046520	Ga0495637_0022627	Ga0495637_0022627_329_1186	271
350	3300046615	Ga0495656_0167333	Ga0495656_0167333_99_959	271
351	3300046684	Ga0495669_0025305	Ga0495669_0025305_1270_2118	271
352	3300046691	Ga0495670_0226054	Ga0495670_0226054_55_912	271
353	3300046692	Ga0495671_0179921	Ga0495671_0179921_128_985	271
354	3300046810	Ga0495660_0169656	Ga0495660_0169656_135_992	271
355	3300048905	Ga0496102_0064569	Ga0496102_0064569_569_1480	271
356	3300048907	Ga0496104_0000544	Ga0496104_0000544_9637_10548	271
357	3300048908	Ga0496105_0018402	Ga0496105_0018402_3918_4829	271
358	3300048911	Ga0496108_0011165	Ga0496108_0011165_2263_3174	271
359	3300048912	Ga0496109_0020359	Ga0496109_0020359_3872_4783	271
360	3300048915	Ga0496112_0044972	Ga0496112_0044972_2021_2932	271
361	3300048915	Ga0496112_0761171	Ga0496112_0761171_42_875	271
362	3300048916	Ga0496113_0007399	Ga0496113_0007399_4629_5540	271
363	3300048918	Ga0496115_0012953	Ga0496115_0012953_3838_4749	271
364	3300049583	Ga0501067_0111330	Ga0501067_0111330_517_1368	271
365	3300049661	Ga0501217_046450	Ga0501217_046450_10_852	271
366	3300050507	nmdc:mga05p37_66534_c1	nmdc:mga05p37_66534_c1_1160_2017	271
367	3300050510	nmdc:mga06r32_60316_c1	nmdc:mga06r32_60316_c1_1307_2164	271
368	3300050511	nmdc:mga08y16_2768_c1	nmdc:mga08y16_2768_c1_7685_8539	271
369	3300050512	nmdc:mga0n895_153821_c1	nmdc:mga0n895_153821_c1_1291_2148	271
370	3300050512	nmdc:mga0n895_957_c1	nmdc:mga0n895_957_c1_11326_12180	271
371	3300050513	nmdc:mga0rr50_60318_c1	nmdc:mga0rr50_60318_c1_1198_2055	271
372	3300050514	nmdc:mga08x19_4229_c1	nmdc:mga08x19_4229_c1_5508_6362	271
373	3300050514	nmdc:mga08x19_74457_c1	nmdc:mga08x19_74457_c1_1291_2148	271
374	3300050515	nmdc:mga0a205_162_c1	nmdc:mga0a205_162_c1_20456_21310	271
375	3300050515	nmdc:mga0a205_1797_c1	nmdc:mga0a205_1797_c1_2571_3428	271
376	3300050516	nmdc:mga0sz30_8751_c1	nmdc:mga0sz30_8751_c1_1434_2261	271
377	3300053103	Ga0500555_015102	Ga0500555_015102_613_1431	271
378	iso_pu_bacteria	2919443155	2919444463	271
379	3300003187	JGI25151J46595_10000009	JGI25151J46595_10000009319	272
380	3300003320	rootH2_10023157	rootH2_1002315715	272
381	3300003752	Ga0055539_1008502	Ga0055539_10085022	272
382	3300003792	Ga0055540_1004021	Ga0055540_10040218	272
383	3300005347	Ga0070668_100001764	Ga0070668_1000017645	272
384	3300005353	Ga0070669_100001222	Ga0070669_10000122210	272
385	3300005367	Ga0070667_100000312	Ga0070667_10000031220	272
386	3300005548	Ga0070665_100149604	Ga0070665_1001496042	272
387	3300005617	Ga0068859_100000574	Ga0068859_10000057411	272
388	3300005841	Ga0068863_100000496	Ga0068863_10000049610	272
389	3300005842	Ga0068858_100068693	Ga0068858_1000686934	272
390	3300005843	Ga0068860_100000190	Ga0068860_10000019080	272
391	3300005844	Ga0068862_100000024	Ga0068862_100000024197	272
392	3300005844	Ga0068862_100041822	Ga0068862_1000418225	272
393	3300006931	Ga0097620_100000574	Ga0097620_10000057427	272
394	3300009101	Ga0105247_10000046	Ga0105247_1000004656	272
395	3300009177	Ga0105248_10000302	Ga0105248_1000030210	272
396	3300009553	Ga0105249_10000333	Ga0105249_1000033328	272
397	3300025245	Ga0207425_1013604	Ga0207425_10136041	272
398	3300025253	Ga0209677_100147	Ga0209677_10014753	272
399	3300025258	Ga0209129_1000096	Ga0209129_100009613	272
400	3300025294	Ga0209025_1000001	Ga0209025_10000011720	272
401	3300025294	Ga0209025_1000045	Ga0209025_1000045119	272
402	3300025303	Ga0209051_1005248	Ga0209051_10052489	272
403	3300025900	Ga0207710_10000071	Ga0207710_1000007156	272
404	3300025923	Ga0207681_10001544	Ga0207681_1000154412	272
405	3300025941	Ga0207711_10000106	Ga0207711_1000010613	272
406	3300025961	Ga0207712_10000289	Ga0207712_1000028920	272
407	3300025972	Ga0207668_10001678	Ga0207668_100016782	272
408	3300025986	Ga0207658_10000272	Ga0207658_1000027236	272
409	3300026035	Ga0207703_10135949	Ga0207703_101359493	272
410	3300026088	Ga0207641_10000643	Ga0207641_1000064332	272
411	3300028379	Ga0268266_10199739	Ga0268266_101997392	272
412	3300028380	Ga0268265_10000012	Ga0268265_10000012308	272
413	3300028380	Ga0268265_10028240	Ga0268265_100282404	272
414	3300028381	Ga0268264_10000223	Ga0268264_1000022336	272
415	3300034818	Ga0373950_0012342	Ga0373950_0012342_457_1329	272
416	3300035088	Ga0373940_0008692	Ga0373940_0008692_488_1360	272
417	3300035207	Ga0373942_0001000	Ga0373942_0001000_110_982	272
418	3300035242	Ga0373962_0000618	Ga0373962_0000618_3150_4034	272
419	3300037418	Ga0395900_0024031	Ga0395900_0024031_3891_4727	272
420	3300038443	Ga0395901_0120930	Ga0395901_0120930_1711_2547	272
421	3300038741	Ga0400488_55673	Ga0400488_55673_503_1324	272
422	3300039093	Ga0400489_47753	Ga0400489_47753_2603_3442	272
423	3300039093	Ga0400489_75070	Ga0400489_75070_102_959	272
424	3300048903	Ga0496100_0098916	Ga0496100_0098916_49_885	272
425	3300048904	Ga0496101_0062223	Ga0496101_0062223_1232_2068	272
426	3300048905	Ga0496102_0002013	Ga0496102_0002013_9874_10710	272
427	3300048906	Ga0496103_0000620	Ga0496103_0000620_26062_26898	272
428	3300048919	Ga0496116_0011222	Ga0496116_0011222_1009_1845	272
429	3300048920	Ga0496117_0000550	Ga0496117_0000550_2345_3181	272
430	3300048921	Ga0496118_0000473	Ga0496118_0000473_3464_4300	272
431	3300048923	Ga0496120_0003530	Ga0496120_0003530_11009_11845	272
432	3300048924	Ga0496121_0001856	Ga0496121_0001856_3543_4379	272
433	3300048928	Ga0496125_0002458	Ga0496125_0002458_21037_21873	272
434	3300048928	Ga0496125_0013158	Ga0496125_0013158_5113_5955	272
435	3300048929	Ga0496126_0001953	Ga0496126_0001953_26377_27213	272
436	3300050491	nmdc:mga00v17_25551_c1	nmdc:mga00v17_25551_c1_884_1726	272
437	3300050510	nmdc:mga06r32_35352_c1	nmdc:mga06r32_35352_c1_2405_3289	272
438	3300053087	Ga0500643_014902	Ga0500643_014902_1385_2206	272
439	3300053134	Ga0500658_0016294	Ga0500658_0016294_1516_2337	272
440	3300053151	Ga0500604_0010902	Ga0500604_0010902_1130_1951	272
441	iso_pu_bacteria	2842198810	2842205014	272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

11

198

0.95 PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

17

216

0.89 PF08659

KR

KR domain

11

187

0.82 PF01370

Epimerase

NAD dependent epimerase/dehydratase family

13

205

0.77 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
1nff-assembly1.cif.gz_A	crystal structure of rv2002 gene product from mycobacterium tuberculosis	0.9654	4	183
7e6o-assembly1.cif.gz_A	crystal structure of polyol dehydrogenase from paracoccus denitrificans	0.9617	4	179
4trr-assembly2.cif.gz_G	crystal structure of a putative putative d-beta-hydroxybutyrate dehydrogenase from burkholderia cenocepacia j2315	0.9593	4	181
3cxr-assembly1.cif.gz_A	crystal structure of gluconate 5-dehydrogase from streptococcus suis type 2	0.9579	4	181
5g4l-assembly1.cif.gz_A	phloroglucinol reductase from clostridium sp. with bound nadph	0.9574	3	182

ID	Description	Score	Start	End	Superfamily
af_F4J128_251_373_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9705	83	181	3.40.50.720
af_A0A1D6ED38_49_231_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9645	1	173	3.40.50.720
af_Q2QLP7_18_222_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9638	5	176	3.40.50.720
af_A0A0P0Y501_3_211_3.40.50.720	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9618	4	182	3.40.50.720
4trrG00	Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain	0.9593	4	181	3.40.50.720

ID	Description	Score	Start	End	GO Terms
AF-I9X0Y1-F1-model_v4	Short-chain alcohol dehydrogenase	0.9967	1	272	GO:0016491
AF-A0A7Y9UM79-F1-model_v4	NAD(P)-dependent dehydrogenase (Short-subunit alcohol dehydrogenase family)	0.9963	8	271	GO:0016491
AF-A0A3N4R8S2-F1-model_v4	Short subunit dehydrogenase	0.9954	55	270	GO:0016491
AF-A0A833NB69-F1-model_v4	deleted	0.9952	1	272
AF-A0A436VZ95-F1-model_v4	Oxidoreductase	0.9943	8	272	GO:0016491

Feature Viewer

pLDDT	pTM	Quality
95.36	0.93	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F444622

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00106

adh_short

short chain dehydrogenase

11

198

0.95

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

17

216

0.89

PF08659

KR

KR domain

11

187

0.82

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

13

205

0.77

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map