F444610

General Info

Members Datasets Scaffolds Average Seq Length
441 230 882 224

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_100641985|Ga0068857_1006419852
Length 256
Sequence VAAARGDRESLIGGACYPIVLALMDQPRKSVSWESMTDHPDLSDLAADEAAEVDVATETDAERAARFERDALPFLDQLYGAAMRMTRNPSDAEDLVQETFAKAYASFHQFRPGTNLKAWLYRILTNTFINNYRKKQRQPQQSMSEDVEDWQLARAESHTSSGLKSAENEALEHLPDSEVKEALQRLPEEFRLAVYLADVEGFAYKEIAEIMGTPIGTVMSRLHRGRRQLRDMLSDYVRAHDLLPVGRDGHEGGTES

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003162 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_21 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003568 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_24 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
13 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
16 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003611 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_27 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
19 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
20 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
62 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
81 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
82 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
121 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
122 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
130 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
131 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
132 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
133 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
134 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
141 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
145 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
146 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
150 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
153 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
156 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
159 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
160 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
161 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
162 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
163 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
164 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
167 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
168 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
169 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
170 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
193 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
194 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
195 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
196 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
197 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
212 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
216 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
217 3300059608 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 166R_SD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
224 2643221615 Nocardioides sp. Root224 Isolate Unclassified
225 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
226 2739367898 Nocardioides sp. CF479 Isolate Unclassified
227 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
228 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
229 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
230 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.3
Metatranscriptomes 11.11
Isolates 1.59

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.54
Nodule 0.23
Rhizoplane 10.88
Rhizosphere 82.77
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_100641985 3300005577 Bacteria 1006
2 JGI24743J22301_10064156 3300001991 Unclassified 760
3 JGI24738J21930_10012495 3300002075 Unclassified 1855
4 JGI24744J21845_10005078 3300002077 Unclassified 2722
5 Ga0006778J45830_1004864 3300003162 Bacteria 1142
6 Ga0006778J45830_1013595 3300003162 Bacteria 1117
7 Ga0006759J45824_1007497 3300003163 Bacteria 1119
8 Ga0006759J45824_1011562 3300003163 Bacteria 1035
9 Ga0006759J45824_1034305 3300003163 Bacteria 949
10 Ga0006759J45824_1036528 3300003163 Bacteria 786
11 Ga0006758J48902_1010279 3300003300 Bacteria 953
12 Ga0006770J48903_1015954 3300003305 Bacteria 1082
13 Ga0006770J48903_1028064 3300003305 Bacteria 779
14 Ga0006777J48905_1018719 3300003308 Bacteria 801
15 Ga0007417J51691_1009974 3300003544 Bacteria 1032
16 Ga0007427J51700_104123 3300003559 Bacteria 1059
17 Ga0006781J51513_1005834 3300003568 Bacteria 884
18 Ga0006781J51513_1008865 3300003568 Bacteria 865
19 Ga0007410J51695_1005060 3300003574 Bacteria 1162
20 Ga0007410J51695_1023207 3300003574 Bacteria 926
21 Ga0007409J51694_1008660 3300003575 Bacteria 1085
22 Ga0007409J51694_1011734 3300003575 Bacteria 1001
23 Ga0007416J51690_1016708 3300003577 Bacteria 1026
24 Ga0007429J51699_1004909 3300003579 Bacteria 1124
25 Ga0007411J51799_103736 3300003611 Bacteria 1095
26 Ga0032354_1003798 3300003693 Bacteria 1092
27 Ga0006780_1012077 3300003735 Bacteria 1116
28 Ga0058862_12725049 3300004803 Bacteria 994
29 Ga0070658_10027602 3300005327 Bacteria 4554
30 Ga0070658_10271372 3300005327 Bacteria 1443
31 Ga0070683_100020592 3300005329 Bacteria 5870
32 Ga0070683_100051373 3300005329 Bacteria 3817
33 Ga0070683_100103008 3300005329 Bacteria 2689
34 Ga0070670_101033476 3300005331 Bacteria 748
35 Ga0070682_100009289 3300005337 Bacteria 5565
36 Ga0070682_100069785 3300005337 Bacteria 2245
37 Ga0068868_100036639 3300005338 Bacteria 3799
38 Ga0068868_100071488 3300005338 Bacteria 2767
39 Ga0070660_100011959 3300005339 Bacteria 6192
40 Ga0070689_100082101 3300005340 Bacteria 2531
41 Ga0070691_10025789 3300005341 Bacteria 2739
42 Ga0070687_100019596 3300005343 Bacteria 3150
43 Ga0070687_100032940 3300005343 Bacteria 2554
44 Ga0070692_10084437 3300005345 Bacteria 1716
45 Ga0070692_10195281 3300005345 Bacteria 1182
46 Ga0070675_100135728 3300005354 Bacteria 2100
47 Ga0070675_100269497 3300005354 Bacteria 1494
48 Ga0070674_100023164 3300005356 Bacteria 4015
49 Ga0070659_100439277 3300005366 Bacteria 1105
50 Ga0070714_100012225 3300005435 Bacteria 6847
51 Ga0070700_100155457 3300005441 Bacteria 1569
52 Ga0070708_100436167 3300005445 Bacteria 1236
53 Ga0070663_100956099 3300005455 Bacteria 743
54 Ga0070678_100232099 3300005456 Bacteria 1539
55 Ga0068867_100097003 3300005459 Bacteria 2245
56 Ga0070698_100001942 3300005471 Bacteria 22953
57 Ga0070679_100014974 3300005530 Bacteria 7451
58 Ga0070684_100002700 3300005535 Bacteria 13104
59 Ga0070684_100037259 3300005535 Bacteria 4171
60 Ga0070684_100613701 3300005535 Bacteria 1012
61 Ga0068853_100751778 3300005539 Bacteria 932
62 Ga0070672_100254487 3300005543 Bacteria 1480
63 Ga0070693_100299905 3300005547 Bacteria 1083
64 Ga0070665_100001745 3300005548 Bacteria 24881
65 Ga0070665_100295439 3300005548 Bacteria 1622
66 Ga0070665_100781686 3300005548 Bacteria 968
67 Ga0070704_100231071 3300005549 Bacteria 1509
68 Ga0068855_100402494 3300005563 Bacteria 1500
69 Ga0068857_100126589 3300005577 Bacteria 2302
70 Ga0068856_100029166 3300005614 Bacteria 5390
71 Ga0068852_100038756 3300005616 Bacteria 4007
72 Ga0068852_100040989 3300005616 Bacteria 3911
73 Ga0068852_100301570 3300005616 Bacteria 1551
74 Ga0068861_100007118 3300005719 Bacteria 7657
75 Ga0068861_100568670 3300005719 Bacteria 1036
76 Ga0068858_100031637 3300005842 Bacteria 4916
77 Ga0068862_100399889 3300005844 Bacteria 1285
78 Ga0075365_10000189 3300006038 Bacteria 20092
79 Ga0075365_10047657 3300006038 Bacteria 2817
80 Ga0075365_10104048 3300006038 Bacteria 1946
81 Ga0075365_10150933 3300006038 Bacteria 1616
82 Ga0075363_100113592 3300006048 Bacteria 1507
83 Ga0075363_100246815 3300006048 Bacteria 1027
84 Ga0075363_100262851 3300006048 Bacteria 996
85 Ga0075432_10243007 3300006058 Bacteria 728
86 Ga0075367_10023652 3300006178 Bacteria 3459
87 Ga0075367_10073246 3300006178 Bacteria 2063
88 Ga0075370_10015428 3300006353 Bacteria 4091
89 Ga0075370_10238129 3300006353 Bacteria 1077
90 Ga0075428_100454986 3300006844 Bacteria 1371
91 Ga0111539_10096032 3300009094 Bacteria 3481
92 Ga0111539_10327546 3300009094 Bacteria 1783
93 Ga0111539_10972795 3300009094 Bacteria 987
94 Ga0105245_10001875 3300009098 Bacteria 19079
95 Ga0105245_10067757 3300009098 Bacteria 3233
96 Ga0105245_10091361 3300009098 Bacteria 2802
97 Ga0105245_10270883 3300009098 Bacteria 1656
98 Ga0105243_10111765 3300009148 Bacteria 2287
99 Ga0105243_10394135 3300009148 Bacteria 1284
100 Ga0105242_10101701 3300009176 Bacteria 2436
101 Ga0105242_10383169 3300009176 Bacteria 1308
102 Ga0105248_10192407 3300009177 Bacteria 2299
103 Ga0105248_10451637 3300009177 Bacteria 1448
104 Ga0105237_10131624 3300009545 Bacteria 2496
105 Ga0105237_11570043 3300009545 Bacteria 665
106 Ga0105238_10143083 3300009551 Bacteria 2368
107 Ga0105238_10555652 3300009551 Bacteria 1153
108 Ga0105249_10086207 3300009553 Bacteria 2928
109 Ga0105249_10434148 3300009553 Bacteria 1349
110 Ga0105239_10006772 3300010375 Bacteria 13230
111 Ga0105239_10572981 3300010375 Bacteria 1286
112 Ga0105246_10000332 3300011119 Bacteria 25139
113 Ga0157371_10305752 3300013102 Bacteria 1152
114 Ga0157369_10046231 3300013105 Bacteria 4731
115 Ga0157372_10004720 3300013307 Bacteria 14476
116 Ga0157372_10728589 3300013307 Bacteria 1153
117 Ga0157372_11462685 3300013307 Bacteria 787
118 Ga0157375_10003685 3300013308 Bacteria 13302
119 Ga0157375_10425420 3300013308 Bacteria 1494
120 Ga0163163_10028616 3300014325 Bacteria 5354
121 Ga0157380_10001167 3300014326 Bacteria 17023
122 Ga0157380_10038095 3300014326 Bacteria 3731
123 Ga0157377_10002462 3300014745 Bacteria 8193
124 Ga0157379_10002556 3300014968 Bacteria 15266
125 Ga0197907_10739329 3300020069 Bacteria 1537
126 Ga0206356_11473438 3300020070 Bacteria 1036
127 Ga0206349_1169211 3300020075 Bacteria 1611
128 Ga0206355_1375146 3300020076 Bacteria 1451
129 Ga0206351_10067729 3300020077 Bacteria 1886
130 Ga0206350_10096806 3300020080 Bacteria 1875
131 Ga0206350_11136655 3300020080 Bacteria 988
132 Ga0206354_11014917 3300020081 Bacteria 984
133 Ga0206354_11326971 3300020081 Bacteria 1341
134 Ga0206354_11718552 3300020081 Bacteria 2900
135 Ga0206353_10282476 3300020082 Bacteria 4615
136 Ga0206353_10514181 3300020082 Bacteria 1245
137 Ga0224712_10113526 3300022467 Bacteria 1165
138 Ga0207688_10014718 3300025901 Bacteria 4247
139 Ga0207688_10175020 3300025901 Bacteria 1277
140 Ga0207647_10011261 3300025904 Bacteria 6278
141 Ga0207647_10034403 3300025904 Bacteria 3235
142 Ga0207643_10000778 3300025908 Bacteria 19442
143 Ga0207705_10081096 3300025909 Bacteria 2365
144 Ga0207705_10150114 3300025909 Bacteria 1746
145 Ga0207671_10288979 3300025914 Bacteria 1294
146 Ga0207662_10038177 3300025918 Bacteria 2813
147 Ga0207662_10685063 3300025918 Bacteria 718
148 Ga0207657_10055386 3300025919 Bacteria 3425
149 Ga0207657_10177239 3300025919 Bacteria 1725
150 Ga0207681_10120999 3300025923 Bacteria 1920
151 Ga0207694_10060527 3300025924 Bacteria 2947
152 Ga0207687_10008754 3300025927 Bacteria 6614
153 Ga0207687_10009025 3300025927 Bacteria 6517
154 Ga0207687_10392760 3300025927 Bacteria 1139
155 Ga0207664_10365135 3300025929 Bacteria 1279
156 Ga0207690_10291795 3300025932 Bacteria 1273
157 Ga0207709_10035405 3300025935 Bacteria 2951
158 Ga0207709_10319940 3300025935 Bacteria 1161
159 Ga0207670_10048577 3300025936 Bacteria 2833
160 Ga0207670_10687326 3300025936 Bacteria 846
161 Ga0207704_10150404 3300025938 Bacteria 1642
162 Ga0207691_10367866 3300025940 Bacteria 1228
163 Ga0207711_10087851 3300025941 Bacteria 2728
164 Ga0207711_10168825 3300025941 Bacteria 1984
165 Ga0207661_10039930 3300025944 Bacteria 3686
166 Ga0207667_10225949 3300025949 Bacteria 1918
167 Ga0207712_10060317 3300025961 Bacteria 2689
168 Ga0207712_10479162 3300025961 Bacteria 1060
169 Ga0207668_10636960 3300025972 Bacteria 932
170 Ga0207677_10138137 3300026023 Bacteria 1861
171 Ga0207703_10021543 3300026035 Bacteria 5046
172 Ga0207639_10712469 3300026041 Bacteria 932
173 Ga0207678_10234354 3300026067 Bacteria 1572
174 Ga0207708_10002155 3300026075 Bacteria 14535
175 Ga0207708_10106106 3300026075 Bacteria 2178
176 Ga0207648_10014468 3300026089 Bacteria 7289
177 Ga0207676_10101110 3300026095 Bacteria 2390
178 Ga0207674_10002647 3300026116 Bacteria 22374
179 Ga0207675_100019660 3300026118 Bacteria 6303
180 Ga0207675_100217389 3300026118 Bacteria 1840
181 Ga0207683_10650963 3300026121 Bacteria 976
182 Ga0207698_10300455 3300026142 Bacteria 1494
183 Ga0268266_10007843 3300028379 Bacteria 9563
184 Ga0316181_1157914 3300030744 Bacteria 992
185 Ga0307413_10301107 3300031824 Bacteria 1216
186 Ga0307410_10347446 3300031852 Bacteria 1184
187 Ga0307410_10428028 3300031852 Bacteria 1075
188 Ga0307410_10456086 3300031852 Bacteria 1044
189 Ga0307409_100733506 3300031995 Bacteria 990
190 Ga0307416_100711660 3300032002 Bacteria 1094
191 Ga0373931_0173314 3300035691 Bacteria 1273
192 Ga0395899_0032375 3300037312 Bacteria 3927
193 Ga0395900_0013115 3300037418 Bacteria 8469
194 Ga0395900_0290364 3300037418 Bacteria 1624
195 Ga0395898_0362274 3300037466 Bacteria 1382
196 Ga0395901_0276261 3300038443 Bacteria 1746
197 Ga0439465_0008647 3300041413 Bacteria 3211
198 Ga0451797_0057187 3300041453 Bacteria 829
199 Ga0451797_1271441 3300041453 Bacteria 930
200 Ga0451843_0642124 3300041509 Bacteria 1109
201 Ga0439431_0004371 3300041997 Bacteria 3104
202 Ga0439431_0023594 3300041997 Bacteria 1491
203 Ga0466972_0036854 3300044658 Bacteria 2391
204 Ga0466972_0111400 3300044658 Bacteria 1293
205 Ga0466965_0023845 3300044683 Bacteria 2956
206 Ga0466965_0029653 3300044683 Bacteria 2663
207 Ga0466966_0010156 3300044684 Bacteria 6244
208 Ga0466966_0075997 3300044684 Bacteria 2098
209 Ga0466966_0124257 3300044684 Bacteria 1583
210 Ga0466966_0292898 3300044684 Bacteria 978
211 Ga0466961_0027398 3300044693 Bacteria 3665
212 Ga0466961_0056007 3300044693 Bacteria 2512
213 Ga0466963_0031500 3300044694 Bacteria 3429
214 Ga0466963_0107477 3300044694 Bacteria 1913
215 Ga0466964_0015867 3300044706 Bacteria 2869
216 Ga0466971_0004200 3300044719 Bacteria 6208
217 Ga0466971_0021364 3300044719 Bacteria 2881
218 Ga0466968_0030708 3300044735 Bacteria 2227
219 Ga0466968_0258592 3300044735 Bacteria 828
220 Ga0466970_0007494 3300044765 Bacteria 5474
221 Ga0466970_0011273 3300044765 Bacteria 4555
222 Ga0466970_0043820 3300044765 Bacteria 2382
223 Ga0466970_0089361 3300044765 Bacteria 1671
224 Ga0466970_0292090 3300044765 Bacteria 918
225 Ga0466957_0014674 3300044842 Bacteria 4564
226 Ga0466957_0169063 3300044842 Bacteria 1423
227 Ga0466957_0185987 3300044842 Bacteria 1358
228 Ga0466957_0384257 3300044842 Bacteria 958
229 Ga0466960_0000096 3300044901 Bacteria 28669
230 Ga0466960_0009098 3300044901 Bacteria 4086
231 Ga0466960_0060904 3300044901 Bacteria 1851
232 Ga0466960_0128057 3300044901 Bacteria 1337
233 Ga0466959_0060997 3300045049 Bacteria 2743
234 Ga0466959_0264595 3300045049 Bacteria 1183
235 Ga0451576_0404592 3300045051 Bacteria 1431
236 Ga0466958_0029810 3300045836 Bacteria 3238
237 Ga0466958_0226373 3300045836 Bacteria 1194
238 Ga0466967_0009147 3300045976 Bacteria 7329
239 Ga0466967_0031503 3300045976 Bacteria 4464
240 Ga0466967_0101926 3300045976 Bacteria 2625
241 Ga0466967_0206169 3300045976 Bacteria 1863
242 Ga0466967_0783311 3300045976 Bacteria 946
243 Ga0466967_1014082 3300045976 Bacteria 826
244 Ga0495629_0075560 3300046459 Bacteria 2353
245 Ga0495629_0349480 3300046459 Bacteria 1009
246 Ga0495641_0150811 3300046461 Bacteria 1039
247 Ga0495653_0296108 3300046463 Bacteria 1057
248 Ga0495608_0547402 3300046511 Bacteria 698
249 Ga0495588_0208245 3300046674 Bacteria 1033
250 Ga0495602_0594222 3300048088 Bacteria 762
251 Ga0495614_0150083 3300048089 Bacteria 1039
252 Ga0496100_0163477 3300048903 Bacteria 1597
253 Ga0496100_0348105 3300048903 Bacteria 1118
254 Ga0496101_0077725 3300048904 Bacteria 2446
255 Ga0496101_0140194 3300048904 Bacteria 1842
256 Ga0496102_0009370 3300048905 Bacteria 8411
257 Ga0496102_0109288 3300048905 Bacteria 2576
258 Ga0496102_0151073 3300048905 Bacteria 2182
259 Ga0496102_0557336 3300048905 Bacteria 1069
260 Ga0496103_0021395 3300048906 Bacteria 3891
261 Ga0496103_0044387 3300048906 Bacteria 2739
262 Ga0496103_0268145 3300048906 Bacteria 1098
263 Ga0496105_0036915 3300048908 Bacteria 4026
264 Ga0496105_0210651 3300048908 Bacteria 1584
265 Ga0496106_0019169 3300048909 Bacteria 5072
266 Ga0496106_0345323 3300048909 Bacteria 1195
267 Ga0496106_0812867 3300048909 Bacteria 741
268 Ga0496107_0048289 3300048910 Bacteria 3066
269 Ga0496107_0107380 3300048910 Bacteria 2050
270 Ga0496107_0141155 3300048910 Bacteria 1780
271 Ga0496107_0446696 3300048910 Bacteria 961
272 Ga0496108_0139999 3300048911 Bacteria 2084
273 Ga0496108_0143222 3300048911 Bacteria 2060
274 Ga0496108_0263423 3300048911 Bacteria 1500
275 Ga0496109_0012302 3300048912 Bacteria 7388
276 Ga0496109_0031080 3300048912 Bacteria 4789
277 Ga0496109_0190393 3300048912 Bacteria 1928
278 Ga0496109_0207039 3300048912 Bacteria 1844
279 Ga0496109_0256385 3300048912 Bacteria 1647
280 Ga0496109_0362539 3300048912 Bacteria 1369
281 Ga0496110_0001726 3300048913 Bacteria 16096
282 Ga0496110_0037104 3300048913 Bacteria 4235
283 Ga0496110_0081685 3300048913 Bacteria 2881
284 Ga0496110_0439919 3300048913 Bacteria 1188
285 Ga0496111_0011123 3300048914 Bacteria 6057
286 Ga0496111_0012422 3300048914 Bacteria 5765
287 Ga0496111_0088577 3300048914 Bacteria 2267
288 Ga0496113_0020090 3300048916 Bacteria 4689
289 Ga0496113_0128364 3300048916 Bacteria 1987
290 Ga0496113_0165107 3300048916 Bacteria 1752
291 Ga0496113_0608135 3300048916 Bacteria 875
292 Ga0496114_0014328 3300048917 Bacteria 6361
293 Ga0496114_0015899 3300048917 Bacteria 6056
294 Ga0496114_0031998 3300048917 Bacteria 4328
295 Ga0496114_0079613 3300048917 Bacteria 2766
296 Ga0496114_0133313 3300048917 Bacteria 2147
297 Ga0496115_0220960 3300048918 Bacteria 1563
298 Ga0501311_011346 3300049527 Bacteria 1096
299 Ga0501311_026083 3300049527 Bacteria 822
300 Ga0501316_012837 3300049532 Bacteria 983
301 Ga0501316_015111 3300049532 Bacteria 926
302 Ga0501317_013405 3300049533 Bacteria 1025
303 Ga0501317_018685 3300049533 Bacteria 919
304 Ga0501318_018560 3300049534 Bacteria 860
305 Ga0501325_006201 3300049541 Bacteria 976
306 Ga0501031_0014194 3300049568 Bacteria 5183
307 Ga0501031_0041986 3300049568 Bacteria 2986
308 Ga0501031_0042478 3300049568 Bacteria 2967
309 Ga0501031_0045209 3300049568 Bacteria 2873
310 Ga0501032_0005042 3300049569 Bacteria 9871
311 Ga0501032_0184825 3300049569 Bacteria 1364
312 Ga0501034_0022692 3300049571 Bacteria 6393
313 Ga0501034_0084105 3300049571 Bacteria 3184
314 Ga0501034_0215227 3300049571 Bacteria 1875
315 Ga0501036_0006057 3300049572 Bacteria 9809
316 Ga0501036_0069323 3300049572 Bacteria 2983
317 Ga0501036_0076456 3300049572 Bacteria 2832
318 Ga0501036_0113869 3300049572 Bacteria 2286
319 Ga0501036_0116086 3300049572 Bacteria 2261
320 Ga0501036_0374641 3300049572 Bacteria 1188
321 Ga0501037_0005347 3300049573 Bacteria 9338
322 Ga0501037_0025031 3300049573 Bacteria 4412
323 Ga0501037_0191451 3300049573 Bacteria 1448
324 Ga0501037_0330782 3300049573 Bacteria 1054
325 Ga0501038_0001745 3300049574 Bacteria 20203
326 Ga0501039_0010286 3300049575 Bacteria 7135
327 Ga0501039_0011693 3300049575 Bacteria 6687
328 Ga0501039_0113969 3300049575 Bacteria 2115
329 Ga0501040_0052653 3300049576 Bacteria 2787
330 Ga0501040_0053884 3300049576 Bacteria 2756
331 Ga0501040_0070393 3300049576 Bacteria 2414
332 Ga0501041_0028132 3300049577 Bacteria 3390
333 Ga0501041_0243869 3300049577 Bacteria 1129
334 Ga0501041_0397494 3300049577 Bacteria 873
335 Ga0501042_0024052 3300049578 Bacteria 4269
336 Ga0501043_0007456 3300049579 Bacteria 8687
337 Ga0501046_0003431 3300049580 Bacteria 14548
338 Ga0501047_0032021 3300049581 Bacteria 5073
339 Ga0501047_0666089 3300049581 Bacteria 859
340 Ga0501048_0010890 3300049582 Bacteria 6781
341 Ga0501048_0035838 3300049582 Bacteria 3568
342 Ga0501048_0283763 3300049582 Bacteria 1177
343 Ga0501048_0306337 3300049582 Bacteria 1130
344 Ga0501048_0375430 3300049582 Bacteria 1015
345 Ga0501067_0000186 3300049583 Bacteria 35281
346 Ga0501067_0013651 3300049583 Bacteria 4497
347 Ga0501067_0076503 3300049583 Bacteria 1854
348 Ga0501067_0079247 3300049583 Bacteria 1820
349 Ga0501068_0018469 3300049584 Bacteria 4038
350 Ga0501068_0034835 3300049584 Bacteria 3004
351 Ga0501068_0035548 3300049584 Bacteria 2974
352 Ga0501068_0341195 3300049584 Bacteria 962
353 Ga0501069_0028702 3300049585 Bacteria 3051
354 Ga0501069_0088191 3300049585 Bacteria 1753
355 Ga0501069_0134311 3300049585 Bacteria 1418
356 Ga0501070_0001359 3300049586 Bacteria 21923
357 Ga0501070_0008709 3300049586 Bacteria 8580
358 Ga0501070_0030340 3300049586 Bacteria 4530
359 Ga0501070_0075226 3300049586 Bacteria 2795
360 Ga0501070_0084960 3300049586 Bacteria 2620
361 Ga0501070_0096513 3300049586 Bacteria 2445
362 Ga0501070_0700576 3300049586 Bacteria 801
363 Ga0501071_0012505 3300049587 Bacteria 5758
364 Ga0501071_0043833 3300049587 Bacteria 3209
365 Ga0501071_0093008 3300049587 Bacteria 2217
366 Ga0501071_0205207 3300049587 Bacteria 1481
367 Ga0501071_0257888 3300049587 Bacteria 1316
368 Ga0501072_0069052 3300049588 Bacteria 2790
369 Ga0501072_0101601 3300049588 Bacteria 2285
370 Ga0501072_0127556 3300049588 Bacteria 2027
371 Ga0501073_0000338 3300049589 Bacteria 31568
372 Ga0501073_0011729 3300049589 Bacteria 6398
373 Ga0501073_0033468 3300049589 Bacteria 3660
374 Ga0501074_0017280 3300049590 Bacteria 5232
375 Ga0501074_0027665 3300049590 Bacteria 4111
376 Ga0501074_0053497 3300049590 Bacteria 2912
377 Ga0501074_0104168 3300049590 Bacteria 2031
378 Ga0501074_0143846 3300049590 Bacteria 1705
379 Ga0501075_0193813 3300049591 Bacteria 1550
380 Ga0501075_0301320 3300049591 Bacteria 1221
381 Ga0501075_0308987 3300049591 Bacteria 1205
382 Ga0501075_0327635 3300049591 Bacteria 1167
383 Ga0501075_0349905 3300049591 Bacteria 1126
384 Ga0501076_0063501 3300049592 Bacteria 2942
385 Ga0501076_0118151 3300049592 Bacteria 2146
386 Ga0501076_0128441 3300049592 Bacteria 2055
387 Ga0501077_0017295 3300049593 Bacteria 4548
388 Ga0501077_0017928 3300049593 Bacteria 4474
389 Ga0501079_0011363 3300049741 Bacteria 6795
390 Ga0501079_0109989 3300049741 Bacteria 2141
391 Ga0501079_0767333 3300049741 Bacteria 759
392 Ga0501080_0000231 3300049742 Bacteria 42074
393 Ga0501080_0045425 3300049742 Bacteria 4089
394 Ga0501080_0099868 3300049742 Bacteria 2693
395 Ga0501080_0187695 3300049742 Bacteria 1900
396 Ga0501081_0100638 3300049743 Bacteria 2043
397 Ga0501081_0415314 3300049743 Bacteria 997
398 Ga0501081_0449067 3300049743 Bacteria 958
399 Ga0501083_0040768 3300049744 Bacteria 3151
400 Ga0501035_0098238 3300049822 Bacteria 2570
401 Ga0501035_0182112 3300049822 Bacteria 1810
402 Ga0501035_0527897 3300049822 Bacteria 969
403 Ga0501044_0055154 3300049823 Bacteria 4082
404 Ga0501044_0088917 3300049823 Bacteria 3118
405 Ga0501044_0153040 3300049823 Bacteria 2288
406 Ga0501045_0028401 3300049824 Bacteria 4036
407 Ga0501045_0085668 3300049824 Bacteria 2326
408 Ga0501045_0133849 3300049824 Bacteria 1843
409 Ga0501045_0316511 3300049824 Bacteria 1161
410 nmdc:mga03n38_127084_c1 3300050490 Bacteria 1259
411 nmdc:mga03n38_91654_c1 3300050490 Bacteria 1448
412 nmdc:mga00v17_18692_c1 3300050491 Bacteria 3942
413 nmdc:mga00v17_320557_c1 3300050491 Bacteria 1007
414 nmdc:mga0yw44_147170_c1 3300050492 Bacteria 1534
415 nmdc:mga06z11_127914_c1 3300050494 Bacteria 1423
416 nmdc:mga06z11_26300_c1 3300050494 Bacteria 2768
417 nmdc:mga08y16_71619_c1 3300050511 Bacteria 3612
418 nmdc:mga0sz30_35974_c1 3300050516 Bacteria 2068
419 Ga0495601_0067271 3300053077 Bacteria 2282
420 Ga0495619_0013919 3300053085 Bacteria 5077
421 Ga0495619_0297218 3300053085 Bacteria 1119
422 Ga0500556_0000643 3300053104 Bacteria 21878
423 Ga0501084_0045046 3300054114 Bacteria 3694
424 Ga0501084_0770741 3300054114 Bacteria 810
425 Ga0587129_006814 3300059608 Bacteria 815
426 Ga0587128_010866 3300059630 Bacteria 1233
427 Ga0587130_017651 3300059631 Bacteria 751
428 Ga0587114_017428 3300059655 Bacteria 974
429 Ga0501082_0036402 3300060353 Bacteria 4240
430 Ga0501082_0082864 3300060353 Bacteria 2767
431 Ga0501082_0130359 3300060353 Bacteria 2182
432 Ga0466962_0006648 3300061719 Bacteria 5548
433 Ga0466962_0064055 3300061719 Bacteria 1755
434 Ga0530510_0083868 3300061734 Bacteria 2321
435 2644090701 2643221615 Bacteria 5487866
436 2644320505 2643221657 Bacteria 5490246
437 2740167601 2739367898 Bacteria 4367674
438 2812349630 2811994878 Bacteria 5992952
439 2855390704 2855386786 Bacteria 4752232
440 2857482286 2857481737 Bacteria 4761446
441 8054613176 8054609563 Bacteria 5170090
442 Ga0068857_100641985
443 JGI24743J22301_10064156
444 JGI24738J21930_10012495
445 JGI24744J21845_10005078
446 Ga0006778J45830_1004864
447 Ga0006778J45830_1013595
448 Ga0006759J45824_1007497
449 Ga0006759J45824_1011562
450 Ga0006759J45824_1034305
451 Ga0006759J45824_1036528
452 Ga0006758J48902_1010279
453 Ga0006770J48903_1015954
454 Ga0006770J48903_1028064
455 Ga0006777J48905_1018719
456 Ga0007417J51691_1009974
457 Ga0007427J51700_104123
458 Ga0006781J51513_1005834
459 Ga0006781J51513_1008865
460 Ga0007410J51695_1005060
461 Ga0007410J51695_1023207
462 Ga0007409J51694_1008660
463 Ga0007409J51694_1011734
464 Ga0007416J51690_1016708
465 Ga0007429J51699_1004909
466 Ga0007411J51799_103736
467 Ga0032354_1003798
468 Ga0006780_1012077
469 Ga0058862_12725049
470 Ga0070658_10027602
471 Ga0070658_10271372
472 Ga0070683_100020592
473 Ga0070683_100051373
474 Ga0070683_100103008
475 Ga0070670_101033476
476 Ga0070682_100009289
477 Ga0070682_100069785
478 Ga0068868_100036639
479 Ga0068868_100071488
480 Ga0070660_100011959
481 Ga0070689_100082101
482 Ga0070691_10025789
483 Ga0070687_100019596
484 Ga0070687_100032940
485 Ga0070692_10084437
486 Ga0070692_10195281
487 Ga0070675_100135728
488 Ga0070675_100269497
489 Ga0070674_100023164
490 Ga0070659_100439277
491 Ga0070714_100012225
492 Ga0070700_100155457
493 Ga0070708_100436167
494 Ga0070663_100956099
495 Ga0070678_100232099
496 Ga0068867_100097003
497 Ga0070698_100001942
498 Ga0070679_100014974
499 Ga0070684_100002700
500 Ga0070684_100037259
501 Ga0070684_100613701
502 Ga0068853_100751778
503 Ga0070672_100254487
504 Ga0070693_100299905
505 Ga0070665_100001745
506 Ga0070665_100295439
507 Ga0070665_100781686
508 Ga0070704_100231071
509 Ga0068855_100402494
510 Ga0068857_100126589
511 Ga0068856_100029166
512 Ga0068852_100038756
513 Ga0068852_100040989
514 Ga0068852_100301570
515 Ga0068861_100007118
516 Ga0068861_100568670
517 Ga0068858_100031637
518 Ga0068862_100399889
519 Ga0075365_10000189
520 Ga0075365_10047657
521 Ga0075365_10104048
522 Ga0075365_10150933
523 Ga0075363_100113592
524 Ga0075363_100246815
525 Ga0075363_100262851
526 Ga0075432_10243007
527 Ga0075367_10023652
528 Ga0075367_10073246
529 Ga0075370_10015428
530 Ga0075370_10238129
531 Ga0075428_100454986
532 Ga0111539_10096032
533 Ga0111539_10327546
534 Ga0111539_10972795
535 Ga0105245_10001875
536 Ga0105245_10067757
537 Ga0105245_10091361
538 Ga0105245_10270883
539 Ga0105243_10111765
540 Ga0105243_10394135
541 Ga0105242_10101701
542 Ga0105242_10383169
543 Ga0105248_10192407
544 Ga0105248_10451637
545 Ga0105237_10131624
546 Ga0105237_11570043
547 Ga0105238_10143083
548 Ga0105238_10555652
549 Ga0105249_10086207
550 Ga0105249_10434148
551 Ga0105239_10006772
552 Ga0105239_10572981
553 Ga0105246_10000332
554 Ga0157371_10305752
555 Ga0157369_10046231
556 Ga0157372_10004720
557 Ga0157372_10728589
558 Ga0157372_11462685
559 Ga0157375_10003685
560 Ga0157375_10425420
561 Ga0163163_10028616
562 Ga0157380_10001167
563 Ga0157380_10038095
564 Ga0157377_10002462
565 Ga0157379_10002556
566 Ga0197907_10739329
567 Ga0206356_11473438
568 Ga0206349_1169211
569 Ga0206355_1375146
570 Ga0206351_10067729
571 Ga0206350_10096806
572 Ga0206350_11136655
573 Ga0206354_11014917
574 Ga0206354_11326971
575 Ga0206354_11718552
576 Ga0206353_10282476
577 Ga0206353_10514181
578 Ga0224712_10113526
579 Ga0207688_10014718
580 Ga0207688_10175020
581 Ga0207647_10011261
582 Ga0207647_10034403
583 Ga0207643_10000778
584 Ga0207705_10081096
585 Ga0207705_10150114
586 Ga0207671_10288979
587 Ga0207662_10038177
588 Ga0207662_10685063
589 Ga0207657_10055386
590 Ga0207657_10177239
591 Ga0207681_10120999
592 Ga0207694_10060527
593 Ga0207687_10008754
594 Ga0207687_10009025
595 Ga0207687_10392760
596 Ga0207664_10365135
597 Ga0207690_10291795
598 Ga0207709_10035405
599 Ga0207709_10319940
600 Ga0207670_10048577
601 Ga0207670_10687326
602 Ga0207704_10150404
603 Ga0207691_10367866
604 Ga0207711_10087851
605 Ga0207711_10168825
606 Ga0207661_10039930
607 Ga0207667_10225949
608 Ga0207712_10060317
609 Ga0207712_10479162
610 Ga0207668_10636960
611 Ga0207677_10138137
612 Ga0207703_10021543
613 Ga0207639_10712469
614 Ga0207678_10234354
615 Ga0207708_10002155
616 Ga0207708_10106106
617 Ga0207648_10014468
618 Ga0207676_10101110
619 Ga0207674_10002647
620 Ga0207675_100019660
621 Ga0207675_100217389
622 Ga0207683_10650963
623 Ga0207698_10300455
624 Ga0268266_10007843
625 Ga0316181_1157914
626 Ga0307413_10301107
627 Ga0307410_10347446
628 Ga0307410_10428028
629 Ga0307410_10456086
630 Ga0307409_100733506
631 Ga0307416_100711660
632 Ga0373931_0173314
633 Ga0395899_0032375
634 Ga0395900_0013115
635 Ga0395900_0290364
636 Ga0395898_0362274
637 Ga0395901_0276261
638 Ga0439465_0008647
639 Ga0451797_0057187
640 Ga0451797_1271441
641 Ga0451843_0642124
642 Ga0439431_0004371
643 Ga0439431_0023594
644 Ga0466972_0036854
645 Ga0466972_0111400
646 Ga0466965_0023845
647 Ga0466965_0029653
648 Ga0466966_0010156
649 Ga0466966_0075997
650 Ga0466966_0124257
651 Ga0466966_0292898
652 Ga0466961_0027398
653 Ga0466961_0056007
654 Ga0466963_0031500
655 Ga0466963_0107477
656 Ga0466964_0015867
657 Ga0466971_0004200
658 Ga0466971_0021364
659 Ga0466968_0030708
660 Ga0466968_0258592
661 Ga0466970_0007494
662 Ga0466970_0011273
663 Ga0466970_0043820
664 Ga0466970_0089361
665 Ga0466970_0292090
666 Ga0466957_0014674
667 Ga0466957_0169063
668 Ga0466957_0185987
669 Ga0466957_0384257
670 Ga0466960_0000096
671 Ga0466960_0009098
672 Ga0466960_0060904
673 Ga0466960_0128057
674 Ga0466959_0060997
675 Ga0466959_0264595
676 Ga0451576_0404592
677 Ga0466958_0029810
678 Ga0466958_0226373
679 Ga0466967_0009147
680 Ga0466967_0031503
681 Ga0466967_0101926
682 Ga0466967_0206169
683 Ga0466967_0783311
684 Ga0466967_1014082
685 Ga0495629_0075560
686 Ga0495629_0349480
687 Ga0495641_0150811
688 Ga0495653_0296108
689 Ga0495608_0547402
690 Ga0495588_0208245
691 Ga0495602_0594222
692 Ga0495614_0150083
693 Ga0496100_0163477
694 Ga0496100_0348105
695 Ga0496101_0077725
696 Ga0496101_0140194
697 Ga0496102_0009370
698 Ga0496102_0109288
699 Ga0496102_0151073
700 Ga0496102_0557336
701 Ga0496103_0021395
702 Ga0496103_0044387
703 Ga0496103_0268145
704 Ga0496105_0036915
705 Ga0496105_0210651
706 Ga0496106_0019169
707 Ga0496106_0345323
708 Ga0496106_0812867
709 Ga0496107_0048289
710 Ga0496107_0107380
711 Ga0496107_0141155
712 Ga0496107_0446696
713 Ga0496108_0139999
714 Ga0496108_0143222
715 Ga0496108_0263423
716 Ga0496109_0012302
717 Ga0496109_0031080
718 Ga0496109_0190393
719 Ga0496109_0207039
720 Ga0496109_0256385
721 Ga0496109_0362539
722 Ga0496110_0001726
723 Ga0496110_0037104
724 Ga0496110_0081685
725 Ga0496110_0439919
726 Ga0496111_0011123
727 Ga0496111_0012422
728 Ga0496111_0088577
729 Ga0496113_0020090
730 Ga0496113_0128364
731 Ga0496113_0165107
732 Ga0496113_0608135
733 Ga0496114_0014328
734 Ga0496114_0015899
735 Ga0496114_0031998
736 Ga0496114_0079613
737 Ga0496114_0133313
738 Ga0496115_0220960
739 Ga0501311_011346
740 Ga0501311_026083
741 Ga0501316_012837
742 Ga0501316_015111
743 Ga0501317_013405
744 Ga0501317_018685
745 Ga0501318_018560
746 Ga0501325_006201
747 Ga0501031_0014194
748 Ga0501031_0041986
749 Ga0501031_0042478
750 Ga0501031_0045209
751 Ga0501032_0005042
752 Ga0501032_0184825
753 Ga0501034_0022692
754 Ga0501034_0084105
755 Ga0501034_0215227
756 Ga0501036_0006057
757 Ga0501036_0069323
758 Ga0501036_0076456
759 Ga0501036_0113869
760 Ga0501036_0116086
761 Ga0501036_0374641
762 Ga0501037_0005347
763 Ga0501037_0025031
764 Ga0501037_0191451
765 Ga0501037_0330782
766 Ga0501038_0001745
767 Ga0501039_0010286
768 Ga0501039_0011693
769 Ga0501039_0113969
770 Ga0501040_0052653
771 Ga0501040_0053884
772 Ga0501040_0070393
773 Ga0501041_0028132
774 Ga0501041_0243869
775 Ga0501041_0397494
776 Ga0501042_0024052
777 Ga0501043_0007456
778 Ga0501046_0003431
779 Ga0501047_0032021
780 Ga0501047_0666089
781 Ga0501048_0010890
782 Ga0501048_0035838
783 Ga0501048_0283763
784 Ga0501048_0306337
785 Ga0501048_0375430
786 Ga0501067_0000186
787 Ga0501067_0013651
788 Ga0501067_0076503
789 Ga0501067_0079247
790 Ga0501068_0018469
791 Ga0501068_0034835
792 Ga0501068_0035548
793 Ga0501068_0341195
794 Ga0501069_0028702
795 Ga0501069_0088191
796 Ga0501069_0134311
797 Ga0501070_0001359
798 Ga0501070_0008709
799 Ga0501070_0030340
800 Ga0501070_0075226
801 Ga0501070_0084960
802 Ga0501070_0096513
803 Ga0501070_0700576
804 Ga0501071_0012505
805 Ga0501071_0043833
806 Ga0501071_0093008
807 Ga0501071_0205207
808 Ga0501071_0257888
809 Ga0501072_0069052
810 Ga0501072_0101601
811 Ga0501072_0127556
812 Ga0501073_0000338
813 Ga0501073_0011729
814 Ga0501073_0033468
815 Ga0501074_0017280
816 Ga0501074_0027665
817 Ga0501074_0053497
818 Ga0501074_0104168
819 Ga0501074_0143846
820 Ga0501075_0193813
821 Ga0501075_0301320
822 Ga0501075_0308987
823 Ga0501075_0327635
824 Ga0501075_0349905
825 Ga0501076_0063501
826 Ga0501076_0118151
827 Ga0501076_0128441
828 Ga0501077_0017295
829 Ga0501077_0017928
830 Ga0501079_0011363
831 Ga0501079_0109989
832 Ga0501079_0767333
833 Ga0501080_0000231
834 Ga0501080_0045425
835 Ga0501080_0099868
836 Ga0501080_0187695
837 Ga0501081_0100638
838 Ga0501081_0415314
839 Ga0501081_0449067
840 Ga0501083_0040768
841 Ga0501035_0098238
842 Ga0501035_0182112
843 Ga0501035_0527897
844 Ga0501044_0055154
845 Ga0501044_0088917
846 Ga0501044_0153040
847 Ga0501045_0028401
848 Ga0501045_0085668
849 Ga0501045_0133849
850 Ga0501045_0316511
851 nmdc:mga03n38_127084_c1
852 nmdc:mga03n38_91654_c1
853 nmdc:mga00v17_18692_c1
854 nmdc:mga00v17_320557_c1
855 nmdc:mga0yw44_147170_c1
856 nmdc:mga06z11_127914_c1
857 nmdc:mga06z11_26300_c1
858 nmdc:mga08y16_71619_c1
859 nmdc:mga0sz30_35974_c1
860 Ga0495601_0067271
861 Ga0495619_0013919
862 Ga0495619_0297218
863 Ga0500556_0000643
864 Ga0501084_0045046
865 Ga0501084_0770741
866 Ga0587129_006814
867 Ga0587128_010866
868 Ga0587130_017651
869 Ga0587114_017428
870 Ga0501082_0036402
871 Ga0501082_0082864
872 Ga0501082_0130359
873 Ga0466962_0006648
874 Ga0466962_0064055
875 Ga0530510_0083868
876 2644090701
877 2644320505
878 2740167601
879 2812349630
880 2855390704
881 2857482286
882 8054613176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04545

Sigma70_r4

Sigma-70, region 4

182

231

0.98

PF08281

Sigma70_r4_2

Sigma-70, region 4

176

229

0.97

PF04542

Sigma70_r2

Sigma-70 region 2

72

138

0.95

Map