F444536

General Info

Members Datasets Scaffolds Average Seq Length
440 267 428 135

Family's Representative Sequence

Representative Sequence 3300059421|Ga0590071_043097|Ga0590071_043097_401_877
Length 158
Sequence MPTTLSQFFLHDKPSLKESPAMAQQIYVNLPVKDLERSKAFFARLGYSFNPQYTNEQAACMVVSENHIYVMLLVESFFQTFTKKPVADATKSTEVLVCLSCESKEQVDDLVAKALAAGGSTPNPKQDLGFMYSHSFEDLDGHGWELVYMDPNAVMPQE

Samples

Sample ID Description Type Environment
1 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
2 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
3 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
6 2857465823 Brevibacillus sp. R-74266 Isolate Unclassified
7 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
8 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
9 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
10 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
11 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
12 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
13 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
14 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
15 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
16 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
17 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
18 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
19 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
20 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
21 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
22 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
23 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
24 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
25 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
58 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
98 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
99 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
100 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
101 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
136 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
137 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
141 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
150 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
151 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
152 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
153 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
154 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
155 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
156 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
157 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
158 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
159 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
160 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
161 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
162 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
163 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
164 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
167 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
168 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
169 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
170 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
171 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
172 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
175 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
176 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
177 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
178 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
179 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
180 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
181 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
182 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
183 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
184 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
185 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
186 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
187 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
188 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
189 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
190 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
191 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
192 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
193 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
194 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
195 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
196 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
197 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
200 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
210 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
211 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
212 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
213 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
214 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
215 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
216 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
220 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
221 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
224 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
225 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
226 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
230 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
231 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
232 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
233 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
234 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
235 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
251 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
252 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
256 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
257 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
258 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
259 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
260 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
261 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
262 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
263 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
266 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
267 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.05
Metatranscriptomes 0.23
Isolates 2.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.68
Nodule 0
Rhizoplane 3.41
Rhizosphere 77.73
Stem 0
Stem Tuber 0
Unclassified 8.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10032238 3300001979 Bacteria 1678
2 JGI24739J22299_10029087 3300001989 Bacteria 1924
3 JGI24737J22298_10000262 3300001990 Bacteria 17291
4 JGI24735J21928_10000002 3300002067 Bacteria 624895
5 JGI25162J39368_1000039 3300002737 Bacteria 175976
6 rootH2_10247364 3300003320 Bacteria 1878
7 rootL2_10060678 3300003322 Bacteria 8610
8 rootL2_10256226 3300003322 Unclassified 1975
9 rootH1_10046470 3300003323 Unclassified 1960
10 rootH1_10246981 3300003323 Bacteria 1209
11 Ga0055528_1076370 3300003790 Bacteria 596
12 Ga0055540_1003201 3300003792 Bacteria 8046
13 Ga0055531_10001478 3300003794 Bacteria 17287
14 Ga0065707_10685334 3300005295 Bacteria 646
15 Ga0070676_10000901 3300005328 Bacteria 14713
16 Ga0070676_10421110 3300005328 Bacteria 933
17 Ga0070683_102188106 3300005329 Bacteria 531
18 Ga0068869_100051143 3300005334 Bacteria 2997
19 Ga0068869_100234104 3300005334 Bacteria 1461
20 Ga0068869_101400804 3300005334 Bacteria 619
21 Ga0070680_100457962 3300005336 Bacteria 1090
22 Ga0068868_100184586 3300005338 Bacteria 1732
23 Ga0070669_100103539 3300005353 Bacteria 2151
24 Ga0070669_100238139 3300005353 Bacteria 1445
25 Ga0070675_100785245 3300005354 Unclassified 870
26 Ga0070674_100051279 3300005356 Unclassified 2843
27 Ga0070674_100127708 3300005356 Bacteria 1891
28 Ga0070673_100167870 3300005364 Bacteria 1871
29 Ga0070673_100724290 3300005364 Bacteria 915
30 Ga0070673_100821680 3300005364 Bacteria 859
31 Ga0070714_100154555 3300005435 Bacteria 2070
32 Ga0070705_100893141 3300005440 Bacteria 714
33 Ga0070678_100009322 3300005456 Bacteria 5939
34 Ga0070678_100035189 3300005456 Bacteria 3494
35 Ga0070678_100757065 3300005456 Bacteria 879
36 Ga0070678_101393531 3300005456 Unclassified 654
37 Ga0070681_11182007 3300005458 Bacteria 687
38 Ga0068867_100004947 3300005459 Bacteria 9390
39 Ga0068867_100390648 3300005459 Bacteria 1171
40 Ga0070706_101170018 3300005467 Bacteria 707
41 Ga0070707_100501785 3300005468 Bacteria 1175
42 Ga0070699_100192929 3300005518 Bacteria 1810
43 Ga0070679_100171985 3300005530 Bacteria 2139
44 Ga0068853_100404543 3300005539 Bacteria 1278
45 Ga0068853_101016984 3300005539 Bacteria 798
46 Ga0068853_101204973 3300005539 Bacteria 731
47 Ga0070672_100186961 3300005543 Bacteria 1728
48 Ga0070665_100090374 3300005548 Bacteria 3068
49 Ga0070665_100148690 3300005548 Bacteria 2345
50 Ga0068855_100000093 3300005563 Bacteria 106968
51 Ga0068855_100012151 3300005563 Bacteria 10404
52 Ga0068855_100084571 3300005563 Bacteria 3673
53 Ga0068855_100111487 3300005563 Bacteria 3140
54 Ga0068855_101264020 3300005563 Unclassified 765
55 Ga0068855_101566558 3300005563 Bacteria 675
56 Ga0068857_100984519 3300005577 Bacteria 811
57 Ga0068854_100016048 3300005578 Bacteria 4982
58 Ga0068854_101802390 3300005578 Bacteria 561
59 Ga0068856_100013920 3300005614 Bacteria 7781
60 Ga0068856_100292415 3300005614 Bacteria 1646
61 Ga0070702_101103028 3300005615 Unclassified 634
62 Ga0068852_100840434 3300005616 Bacteria 933
63 Ga0068852_101711196 3300005616 Bacteria 651
64 Ga0068859_101854632 3300005617 Bacteria 666
65 Ga0068866_10030999 3300005718 Unclassified 2571
66 Ga0068861_100329635 3300005719 Bacteria 1332
67 Ga0068863_100723677 3300005841 Bacteria 990
68 Ga0068860_100221984 3300005843 Bacteria 1835
69 Ga0068860_102080711 3300005843 Bacteria 589
70 Ga0068862_100051115 3300005844 Bacteria 3534
71 Ga0068862_102112439 3300005844 Unclassified 574
72 Ga0075365_10046994 3300006038 Bacteria 2836
73 Ga0075365_10068037 3300006038 Bacteria 2392
74 Ga0075365_10135142 3300006038 Bacteria 1708
75 Ga0075368_10014008 3300006042 Bacteria 2954
76 Ga0075362_10005026 3300006177 Bacteria 4802
77 Ga0075367_10003071 3300006178 Bacteria 7833
78 Ga0075427_10043037 3300006194 Bacteria 765
79 Ga0075366_10009535 3300006195 Bacteria 5423
80 Ga0075366_10159530 3300006195 Bacteria 1366
81 Ga0075366_10209122 3300006195 Bacteria 1187
82 Ga0075366_10344763 3300006195 Unclassified 914
83 Ga0075366_10535211 3300006195 Unclassified 725
84 Ga0075366_10868014 3300006195 Bacteria 562
85 Ga0097621_100000212 3300006237 Bacteria 38270
86 Ga0075370_10047529 3300006353 Bacteria 2430
87 Ga0068871_100007236 3300006358 Bacteria 7918
88 Ga0075428_100054805 3300006844 Bacteria 4369
89 Ga0075428_100925840 3300006844 Bacteria 924
90 Ga0075430_100669513 3300006846 Bacteria 856
91 Ga0075430_100765624 3300006846 Bacteria 796
92 Ga0075429_100088482 3300006880 Bacteria 2700
93 Ga0075429_101068495 3300006880 Unclassified 705
94 Ga0068865_100000112 3300006881 Bacteria 41532
95 Ga0068865_101980421 3300006881 Unclassified 528
96 Ga0097620_101854222 3300006931 Bacteria 666
97 Ga0105240_10000143 3300009093 Bacteria 146858
98 Ga0105240_10035919 3300009093 Bacteria 6381
99 Ga0105240_10547437 3300009093 Bacteria 1281
100 Ga0105240_10876689 3300009093 Bacteria 967
101 Ga0111539_10466100 3300009094 Bacteria 1471
102 Ga0111539_10585383 3300009094 Bacteria 1300
103 Ga0105245_10046747 3300009098 Bacteria 3867
104 Ga0114129_10223093 3300009147 Bacteria 2542
105 Ga0114129_11586981 3300009147 Bacteria 802
106 Ga0105243_12550387 3300009148 Unclassified 551
107 Ga0105241_10026571 3300009174 Bacteria 4308
108 Ga0105241_10145470 3300009174 Bacteria 1934
109 Ga0105242_10037600 3300009176 Unclassified 3889
110 Ga0105242_10670889 3300009176 Bacteria 1011
111 Ga0105237_10000834 3300009545 Bacteria 42106
112 Ga0105237_10000980 3300009545 Bacteria 38324
113 Ga0105237_10002186 3300009545 Bacteria 24493
114 Ga0105237_10004936 3300009545 Bacteria 15246
115 Ga0105237_10039581 3300009545 Bacteria 4759
116 Ga0105237_10063233 3300009545 Bacteria 3699
117 Ga0105237_10173948 3300009545 Bacteria 2153
118 Ga0105237_11111400 3300009545 Bacteria 797
119 Ga0105238_10014279 3300009551 Bacteria 8027
120 Ga0105238_10736873 3300009551 Bacteria 999
121 Ga0105238_11171987 3300009551 Bacteria 792
122 Ga0105249_10495351 3300009553 Unclassified 1266
123 Ga0105239_10004839 3300010375 Bacteria 15937
124 Ga0105239_10015639 3300010375 Bacteria 8401
125 Ga0105239_10032983 3300010375 Bacteria 5688
126 Ga0105239_10126096 3300010375 Bacteria 2845
127 Ga0105239_10449039 3300010375 Bacteria 1462
128 Ga0105239_10644844 3300010375 Bacteria 1209
129 Ga0105239_11389283 3300010375 Bacteria 810
130 Ga0105246_10283980 3300011119 Bacteria 1329
131 Ga0157371_10098411 3300013102 Bacteria 2074
132 Ga0157371_10308525 3300013102 Bacteria 1146
133 Ga0157371_10402735 3300013102 Bacteria 1001
134 Ga0157370_10000421 3300013104 Bacteria 53510
135 Ga0157370_10543087 3300013104 Bacteria 1066
136 Ga0157369_10232033 3300013105 Bacteria 1929
137 Ga0157369_11193380 3300013105 Bacteria 777
138 Ga0157374_10000029 3300013296 Bacteria 211547
139 Ga0157374_10003360 3300013296 Bacteria 13437
140 Ga0157378_10006681 3300013297 Bacteria 10078
141 Ga0157378_10081082 3300013297 Bacteria 2932
142 Ga0157378_12487393 3300013297 Unclassified 570
143 Ga0157372_10189898 3300013307 Bacteria 2379
144 Ga0157372_10323103 3300013307 Bacteria 1797
145 Ga0157372_11517595 3300013307 Bacteria 772
146 Ga0157375_11622596 3300013308 Bacteria 765
147 Ga0157375_12135450 3300013308 Bacteria 667
148 Ga0163163_10013409 3300014325 Bacteria 7504
149 Ga0157380_13046171 3300014326 Bacteria 534
150 Ga0182008_10001720 3300014497 Bacteria 14370
151 Ga0182008_10310792 3300014497 Bacteria 827
152 Ga0157377_10318919 3300014745 Bacteria 1032
153 Ga0157376_10000288 3300014969 Bacteria 34012
154 Ga0157376_10260912 3300014969 Bacteria 1623
155 Ga0182007_10269536 3300015262 Bacteria 616
156 Ga0182007_10423714 3300015262 Bacteria 510
157 Ga0163161_10002846 3300017792 Bacteria 12269
158 Ga0163161_10040350 3300017792 Bacteria 3352
159 Ga0209437_100135 3300025233 Bacteria 176455
160 Ga0209646_1004237 3300025246 Bacteria 2643
161 Ga0209129_1008765 3300025258 Bacteria 2762
162 Ga0209673_1029930 3300025273 Bacteria 1725
163 Ga0209130_1030840 3300025284 Bacteria 1105
164 Ga0207426_1080210 3300025302 Bacteria 887
165 Ga0209051_1000025 3300025303 Bacteria 415397
166 Ga0209257_1000039 3300025304 Bacteria 591694
167 Ga0207647_10096112 3300025904 Bacteria 1764
168 Ga0207645_10000167 3300025907 Bacteria 52468
169 Ga0207645_10689214 3300025907 Unclassified 694
170 Ga0207705_10623729 3300025909 Bacteria 838
171 Ga0207695_10000016 3300025913 Bacteria 771991
172 Ga0207695_10000284 3300025913 Bacteria 126041
173 Ga0207695_10785019 3300025913 Bacteria 832
174 Ga0207695_10832269 3300025913 Bacteria 803
175 Ga0207671_10002157 3300025914 Bacteria 21431
176 Ga0207671_10003170 3300025914 Bacteria 16617
177 Ga0207671_10003646 3300025914 Bacteria 15208
178 Ga0207671_10023891 3300025914 Bacteria 4604
179 Ga0207671_10036301 3300025914 Bacteria 3655
180 Ga0207660_10110658 3300025917 Bacteria 2067
181 Ga0207657_10040853 3300025919 Bacteria 4106
182 Ga0207652_10342460 3300025921 Bacteria 1350
183 Ga0207694_10224164 3300025924 Bacteria 1534
184 Ga0207694_10305772 3300025924 Bacteria 1310
185 Ga0207694_10518513 3300025924 Bacteria 999
186 Ga0207659_11414462 3300025926 Unclassified 596
187 Ga0207687_10026703 3300025927 Bacteria 3868
188 Ga0207686_10065876 3300025934 Bacteria 2312
189 Ga0207686_11084392 3300025934 Bacteria 652
190 Ga0207669_10675037 3300025937 Bacteria 847
191 Ga0207704_10000062 3300025938 Bacteria 76334
192 Ga0207704_10265254 3300025938 Unclassified 1297
193 Ga0207689_10060447 3300025942 Bacteria 3116
194 Ga0207689_10159406 3300025942 Bacteria 1859
195 Ga0207689_11198737 3300025942 Bacteria 639
196 Ga0207667_10000939 3300025949 Bacteria 37174
197 Ga0207667_10036805 3300025949 Bacteria 5240
198 Ga0207667_10050636 3300025949 Bacteria 4381
199 Ga0207667_10500135 3300025949 Bacteria 1233
200 Ga0207667_10626343 3300025949 Bacteria 1083
201 Ga0207667_11024676 3300025949 Unclassified 812
202 Ga0207651_10231041 3300025960 Bacteria 1502
203 Ga0207651_10235859 3300025960 Bacteria 1488
204 Ga0207651_10659399 3300025960 Bacteria 919
205 Ga0207651_10684884 3300025960 Bacteria 902
206 Ga0207668_10038701 3300025972 Unclassified 3204
207 Ga0207640_10044036 3300025981 Bacteria 2857
208 Ga0207658_11074224 3300025986 Bacteria 735
209 Ga0207677_10119467 3300026023 Bacteria 1979
210 Ga0207639_10133479 3300026041 Bacteria 2059
211 Ga0207639_10761593 3300026041 Bacteria 901
212 Ga0207641_11566149 3300026088 Bacteria 661
213 Ga0207648_10003859 3300026089 Bacteria 15655
214 Ga0207648_10491970 3300026089 Bacteria 1121
215 Ga0207648_10699438 3300026089 Bacteria 939
216 Ga0207674_10064228 3300026116 Bacteria 3703
217 Ga0207674_10317454 3300026116 Bacteria 1507
218 Ga0207675_100290592 3300026118 Bacteria 1590
219 Ga0207683_10015959 3300026121 Bacteria 6391
220 Ga0207683_10053398 3300026121 Bacteria 3543
221 Ga0207683_10500084 3300026121 Bacteria 1123
222 Ga0207683_10616837 3300026121 Bacteria 1004
223 Ga0207698_10384094 3300026142 Bacteria 1337
224 Ga0207698_10840136 3300026142 Bacteria 923
225 Ga0207698_11463864 3300026142 Bacteria 698
226 Ga0268266_10061927 3300028379 Bacteria 3228
227 Ga0268266_10212818 3300028379 Bacteria 1773
228 Ga0268265_11686522 3300028380 Unclassified 639
229 Ga0268265_12614433 3300028380 Unclassified 510
230 Ga0307515_10000138 3300028794 Bacteria 173220
231 Ga0307515_10002326 3300028794 Bacteria 41504
232 Ga0307515_10249508 3300028794 Bacteria 1530
233 Ga0307512_10031091 3300030522 Bacteria 4632
234 Ga0265327_10005690 3300031251 Bacteria 10300
235 Ga0307513_10000008 3300031456 Bacteria 442128
236 Ga0307513_10011501 3300031456 Bacteria 10994
237 Ga0307513_10110167 3300031456 Bacteria 2749
238 Ga0307408_100081721 3300031548 Bacteria 2416
239 Ga0307408_100232430 3300031548 Bacteria 1511
240 Ga0307408_100773248 3300031548 Bacteria 869
241 Ga0307408_101690818 3300031548 Bacteria 603
242 Ga0307516_10175199 3300031730 Bacteria 1882
243 Ga0307405_10582553 3300031731 Bacteria 910
244 Ga0307409_100419366 3300031995 Bacteria 1284
245 Ga0307416_100205166 3300032002 Bacteria 1874
246 Ga0307414_10288232 3300032004 Bacteria 1383
247 Ga0307411_10276191 3300032005 Bacteria 1335
248 Ga0307411_10558590 3300032005 Bacteria 978
249 Ga0373957_0444567 3300035120 Bacteria 561
250 Ga0373927_0483043 3300035695 Bacteria 819
251 Ga0373937_0202890 3300036401 Bacteria 1864
252 Ga0373937_0613255 3300036401 Bacteria 1033
253 Ga0395899_0026008 3300037312 Bacteria 4416
254 Ga0395899_0050036 3300037312 Bacteria 3104
255 Ga0395899_0473165 3300037312 Bacteria 817
256 Ga0395899_0767741 3300037312 Bacteria 598
257 Ga0395900_0013770 3300037418 Bacteria 8256
258 Ga0395900_0146359 3300037418 Bacteria 2415
259 Ga0395900_0227056 3300037418 Bacteria 1879
260 Ga0395898_0041268 3300037466 Bacteria 4558
261 Ga0395898_0114808 3300037466 Bacteria 2580
262 Ga0395905_0000492 3300037471 Bacteria 54399
263 Ga0395905_0020892 3300037471 Bacteria 6199
264 Ga0395905_0026082 3300037471 Bacteria 5511
265 Ga0395905_0052899 3300037471 Bacteria 3801
266 Ga0395905_0125790 3300037471 Bacteria 2410
267 Ga0395905_0134603 3300037471 Bacteria 2324
268 Ga0395905_0172601 3300037471 Bacteria 2031
269 Ga0395901_0034384 3300038443 Bacteria 5234
270 Ga0395901_0071268 3300038443 Bacteria 3621
271 Ga0395901_0142322 3300038443 Bacteria 2520
272 Ga0395901_1163385 3300038443 Bacteria 739
273 Ga0439436_0015745 3300041404 Bacteria 2272
274 Ga0439436_0061426 3300041404 Bacteria 1052
275 Ga0439436_0085833 3300041404 Bacteria 876
276 Ga0439439_0011311 3300041406 Bacteria 2146
277 Ga0439439_0027084 3300041406 Bacteria 1447
278 Ga0439453_0022653 3300041408 Bacteria 1140
279 Ga0439461_0074929 3300041410 Bacteria 790
280 Ga0439465_0115037 3300041413 Bacteria 939
281 Ga0451789_0965244 3300041443 Bacteria 965
282 Ga0451791_0341307 3300041451 Bacteria 554
283 Ga0451793_1933520 3300041452 Bacteria 2403
284 Ga0451795_0172344 3300041456 Bacteria 895
285 Ga0451795_0483915 3300041456 Bacteria 1189
286 Ga0451795_1457987 3300041456 Bacteria 1574
287 Ga0451798_0070591 3300041458 Unclassified 687
288 Ga0451804_0556604 3300041463 Bacteria 1067
289 Ga0451804_0935367 3300041463 Bacteria 546
290 Ga0451807_2055702 3300041486 Bacteria 903
291 Ga0451833_0388163 3300041491 Bacteria 523
292 Ga0451835_0308700 3300041492 Bacteria 837
293 Ga0451837_0305209 3300041494 Bacteria 692
294 Ga0451837_0710025 3300041494 Bacteria 1022
295 Ga0451839_0492226 3300041496 Bacteria 1346
296 Ga0451841_1231795 3300041498 Bacteria 556
297 Ga0451841_1364275 3300041498 Bacteria 545
298 Ga0451843_0998630 3300041509 Unclassified 668
299 Ga0451843_1593968 3300041509 Bacteria 690
300 Ga0451855_1584976 3300041511 Bacteria 1542
301 Ga0451853_1188011 3300041512 Bacteria 713
302 Ga0451853_1874792 3300041512 Bacteria 609
303 Ga0439431_0000046 3300041997 Bacteria 18062
304 Ga0439433_0004142 3300041999 Bacteria 3116
305 Ga0439437_007113 3300042000 Bacteria 1247
306 Ga0439445_0047892 3300042004 Bacteria 1148
307 Ga0439432_142490 3300042006 Bacteria 705
308 Ga0439449_0000612 3300042007 Bacteria 13391
309 Ga0439449_0043636 3300042007 Bacteria 1664
310 Ga0439449_0368654 3300042007 Bacteria 544
311 Ga0439455_0065845 3300042012 Bacteria 967
312 Ga0439457_034210 3300042014 Bacteria 1129
313 Ga0439462_0001383 3300042015 Bacteria 5368
314 Ga0439462_0014214 3300042015 Bacteria 2044
315 Ga0450914_008551 3300042118 Bacteria 950
316 Ga0450921_003836 3300042123 Bacteria 1075
317 Ga0450888_031391 3300042126 Bacteria 712
318 Ga0450890_004182 3300042127 Bacteria 1892
319 Ga0450898_017798 3300042134 Bacteria 1225
320 Ga0450903_014634 3300042138 Bacteria 1240
321 Ga0450904_016244 3300042139 Bacteria 745
322 Ga0439446_0312903 3300042156 Bacteria 553
323 Ga0439458_0028651 3300042157 Bacteria 1319
324 Ga0450909_010056 3300042185 Bacteria 1381
325 Ga0439434_0022553 3300042435 Bacteria 1893
326 Ga0439435_0015951 3300042436 Bacteria 1876
327 Ga0439444_0021697 3300042437 Bacteria 1139
328 Ga0439464_0086814 3300042439 Bacteria 939
329 Ga0450893_0001369 3300042532 Bacteria 3710
330 Ga0451577_0009013 3300042876 Bacteria 9635
331 Ga0451577_0339077 3300042876 Bacteria 1363
332 Ga0466969_0021648 3300044656 Bacteria 3323
333 Ga0466972_0070923 3300044658 Unclassified 1662
334 Ga0466966_0006478 3300044684 Bacteria 7749
335 Ga0466966_0327928 3300044684 Bacteria 920
336 Ga0466961_0043621 3300044693 Bacteria 2871
337 Ga0466964_0032780 3300044706 Bacteria 2066
338 Ga0466964_0226230 3300044706 Bacteria 911
339 Ga0453684_0728884 3300044712 Bacteria 1075
340 Ga0466968_0053748 3300044735 Bacteria 1726
341 Ga0466968_0242701 3300044735 Bacteria 853
342 Ga0466970_0038575 3300044765 Bacteria 2534
343 Ga0466970_0905852 3300044765 Bacteria 519
344 Ga0466959_0098747 3300045049 Bacteria 2091
345 Ga0466959_0139428 3300045049 Bacteria 1715
346 Ga0451576_0709760 3300045051 Bacteria 1057
347 Ga0495650_0008001 3300046471 Bacteria 6253
348 Ga0495607_0153984 3300046501 Bacteria 1174
349 Ga0495610_0068597 3300046512 Bacteria 1661
350 Ga0495616_0012336 3300046513 Bacteria 4854
351 Ga0495632_0021999 3300046519 Bacteria 3426
352 Ga0495632_0426234 3300046519 Bacteria 577
353 Ga0495643_0101131 3300046522 Bacteria 1477
354 Ga0495643_0102925 3300046522 Bacteria 1461
355 Ga0495644_0033736 3300046523 Bacteria 1933
356 Ga0495609_0011213 3300046538 Bacteria 4275
357 Ga0495621_0083055 3300046539 Bacteria 1197
358 Ga0495668_0000028 3300046616 Bacteria 286629
359 Ga0495668_0000112 3300046616 Bacteria 128501
360 Ga0495668_0011557 3300046616 Bacteria 5280
361 Ga0495611_0003463 3300046648 Bacteria 6951
362 Ga0495625_0004022 3300046660 Bacteria 14061
363 Ga0495625_0006096 3300046660 Bacteria 10813
364 Ga0495625_0078429 3300046660 Bacteria 2305
365 Ga0495683_0043135 3300047323 Bacteria 2272
366 Ga0495687_091665 3300047443 Bacteria 1162
367 Ga0495685_082524 3300047447 Bacteria 1070
368 Ga0495681_0201703 3300047470 Bacteria 806
369 Ga0495686_0001502 3300047472 Bacteria 25169
370 Ga0495686_0001973 3300047472 Bacteria 20378
371 Ga0495686_0065671 3300047472 Bacteria 2243
372 Ga0495615_0008406 3300048090 Bacteria 1993
373 Ga0496102_0505540 3300048905 Bacteria 1131
374 Ga0496109_0068236 3300048912 Bacteria 3260
375 Ga0496109_1881053 3300048912 Bacteria 531
376 Ga0496122_0004931 3300048925 Bacteria 16182
377 Ga0496123_0032769 3300048926 Bacteria 3753
378 Ga0496124_0000009 3300048927 Bacteria 734820
379 Ga0496125_0141209 3300048928 Bacteria 1674
380 Ga0495678_012445 3300049459 Bacteria 4032
381 Ga0495682_0018266 3300049460 Bacteria 2643
382 Ga0501036_0579443 3300049572 Bacteria 932
383 Ga0501038_0466236 3300049574 Bacteria 970
384 Ga0501038_1022589 3300049574 Bacteria 606
385 Ga0501040_0591260 3300049576 Bacteria 802
386 Ga0501041_0710429 3300049577 Bacteria 643
387 Ga0501042_0389348 3300049578 Bacteria 1010
388 Ga0501043_0184113 3300049579 Bacteria 1627
389 Ga0501047_0017151 3300049581 Bacteria 6929
390 Ga0501047_0648088 3300049581 Bacteria 876
391 Ga0501048_0696274 3300049582 Bacteria 730
392 Ga0501072_0313121 3300049588 Bacteria 1248
393 Ga0501080_0520203 3300049742 Bacteria 1062
394 Ga0501035_0166949 3300049822 Bacteria 1903
395 Ga0501044_0089475 3300049823 Bacteria 3107
396 nmdc:mga03683_361295_c1 3300050489 Bacteria 689
397 nmdc:mga03683_534207_c1 3300050489 Bacteria 570
398 nmdc:mga03683_646317_c1 3300050489 Bacteria 520
399 nmdc:mga03n38_19742_c1 3300050490 Bacteria 2682
400 nmdc:mga0yw44_337155_c1 3300050492 Bacteria 1014
401 nmdc:mga0yw44_42035_c1 3300050492 Bacteria 2724
402 nmdc:mga0yw44_76358_c1 3300050492 Bacteria 2091
403 nmdc:mga0k408_108920_c1 3300050493 Bacteria 1637
404 nmdc:mga0k408_179522_c1 3300050493 Bacteria 1262
405 nmdc:mga0k408_1866_c1 3300050493 Bacteria 11300
406 nmdc:mga0k408_20379_c1 3300050493 Bacteria 3714
407 nmdc:mga0k408_4657_c1 3300050493 Bacteria 7269
408 nmdc:mga06z11_45366_c1 3300050494 Bacteria 2222
409 nmdc:mga06z11_628535_c1 3300050494 Bacteria 653
410 nmdc:mga07m45_218163_c1 3300050496 Bacteria 1110
411 nmdc:mga07m45_525890_c1 3300050496 Unclassified 684
412 nmdc:mga09592_89734_c1 3300050508 Bacteria 2625
413 nmdc:mga0qj67_235269_c1 3300050509 Bacteria 1486
414 nmdc:mga0qj67_47040_c1 3300050509 Bacteria 3407
415 nmdc:mga0qj67_479039_c1 3300050509 Bacteria 1001
416 nmdc:mga06r32_2021014_c1 3300050510 Bacteria 510
417 nmdc:mga08y16_336880_c1 3300050511 Bacteria 1551
418 nmdc:mga0sz30_111132_c1 3300050516 Bacteria 1201
419 Ga0500651_0010317 3300053093 Bacteria 5597
420 Ga0500555_003917 3300053103 Bacteria 4237
421 Ga0500622_0008277 3300053156 Bacteria 5833
422 Ga0500634_0168274 3300053161 Bacteria 1002
423 Ga0500645_048596 3300053730 Unclassified 1242
424 Ga0500587_000372 3300053739 Bacteria 5102
425 Ga0501084_0752762 3300054114 Bacteria 821
426 Ga0590071_043097 3300059421 Bacteria 1087
427 Ga0590075_081242 3300059424 Bacteria 840
428 Ga0587076_078055 3300059645 Bacteria 701

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005328 Ga0070676_10421110 Ga0070676_104211102 117
2 3300005334 Ga0068869_100051143 Ga0068869_1000511434 117
3 3300005353 Ga0070669_100103539 Ga0070669_1001035393 117
4 3300005354 Ga0070675_100785245 Ga0070675_1007852452 117
5 3300005356 Ga0070674_100051279 Ga0070674_1000512794 117
6 3300005456 Ga0070678_101393531 Ga0070678_1013935311 117
7 3300005459 Ga0068867_100004947 Ga0068867_1000049476 117
8 3300005718 Ga0068866_10030999 Ga0068866_100309993 117
9 3300025913 Ga0207695_10000284 Ga0207695_1000028443 117
10 3300025926 Ga0207659_11414462 Ga0207659_114144621 117
11 3300025934 Ga0207686_10065876 Ga0207686_100658764 117
12 3300025942 Ga0207689_10060447 Ga0207689_100604474 117
13 3300025972 Ga0207668_10038701 Ga0207668_100387012 117
14 3300026089 Ga0207648_10003859 Ga0207648_1000385911 117
15 3300028380 Ga0268265_11686522 Ga0268265_116865222 117
16 3300025302 Ga0207426_1080210 Ga0207426_10802102 121
17 3300037312 Ga0395899_0767741 Ga0395899_0767741_217_588 121
18 3300049742 Ga0501080_0520203 Ga0501080_0520203_17_388 121
19 3300003323 rootH1_10046470 rootH1_100464703 126
20 3300009545 Ga0105237_10004936 Ga0105237_100049366 126
21 3300010375 Ga0105239_10644844 Ga0105239_106448442 126
22 3300013105 Ga0157369_11193380 Ga0157369_111933802 126
23 3300014497 Ga0182008_10001720 Ga0182008_100017207 126
24 3300015262 Ga0182007_10423714 Ga0182007_104237141 126
25 3300025246 Ga0209646_1004237 Ga0209646_10042372 126
26 3300025914 Ga0207671_10003646 Ga0207671_1000364613 126
27 3300041456 Ga0451795_0172344 Ga0451795_0172344_396_800 126
28 3300041463 Ga0451804_0556604 Ga0451804_0556604_414_824 126
29 3300041498 Ga0451841_1364275 Ga0451841_1364275_14_424 126
30 3300041509 Ga0451843_0998630 Ga0451843_0998630_157_567 126
31 3300044706 Ga0466964_0032780 Ga0466964_0032780_511_921 126
32 3300044735 Ga0466968_0053748 Ga0466968_0053748_328_738 126
33 3300048905 Ga0496102_0505540 Ga0496102_0505540_70_489 126
34 iso_pu_bacteria 2842780639 2842780745 127
35 3300009147 Ga0114129_10223093 Ga0114129_102230932 128
36 3300041494 Ga0451837_0305209 Ga0451837_0305209_146_550 128
37 3300031456 Ga0307513_10000008 Ga0307513_10000008131 129
38 3300014497 Ga0182008_10310792 Ga0182008_103107922 130
39 iso_pu_bacteria 2585428062 2587759427 130
40 iso_pu_bacteria 2599185184 2599478778 130
41 iso_pu_bacteria 2599185292 2599902077 130
42 iso_pu_bacteria 2738541283 2738759540 130
43 iso_pu_bacteria 2919437846 2919439239 130
44 iso_pu_bacteria 2919437846 2919442910 130
45 iso_pu_bacteria 2928078545 2928080163 130
46 iso_pu_bacteria 2928147474 2928149664 130
47 iso_pu_bacteria 2932082852 2932083490 130
48 3300014325 Ga0163163_10013409 Ga0163163_100134092 131
49 3300046501 Ga0495607_0153984 Ga0495607_0153984_228_626 131
50 3300046538 Ga0495609_0011213 Ga0495609_0011213_1259_1657 131
51 3300046616 Ga0495668_0011557 Ga0495668_0011557_2950_3348 131
52 3300046648 Ga0495611_0003463 Ga0495611_0003463_101_499 131
53 3300047447 Ga0495685_082524 Ga0495685_082524_252_650 131
54 3300048927 Ga0496124_0000009 Ga0496124_0000009_594692_595090 131
55 iso_pu_bacteria 2857465823 2857466056 131
56 iso_pu_bacteria 2857591370 2857593833 131
57 3300005295 Ga0065707_10685334 Ga0065707_106853341 132
58 3300005440 Ga0070705_100893141 Ga0070705_1008931411 132
59 3300005844 Ga0068862_100051115 Ga0068862_1000511153 132
60 3300005844 Ga0068862_102112439 Ga0068862_1021124391 132
61 3300006195 Ga0075366_10159530 Ga0075366_101595301 132
62 3300006195 Ga0075366_10868014 Ga0075366_108680141 132
63 3300006844 Ga0075428_100925840 Ga0075428_1009258401 132
64 3300006846 Ga0075430_100669513 Ga0075430_1006695132 132
65 3300006881 Ga0068865_101980421 Ga0068865_1019804211 132
66 3300009094 Ga0111539_10585383 Ga0111539_105853832 132
67 3300025938 Ga0207704_10265254 Ga0207704_102652541 132
68 3300028380 Ga0268265_12614433 Ga0268265_126144331 132
69 3300031995 Ga0307409_100419366 Ga0307409_1004193663 132
70 3300041404 Ga0439436_0085833 Ga0439436_0085833_344_742 132
71 3300041406 Ga0439439_0027084 Ga0439439_0027084_675_1073 132
72 3300041494 Ga0451837_0710025 Ga0451837_0710025_286_690 132
73 3300041498 Ga0451841_1231795 Ga0451841_1231795_95_499 132
74 3300042007 Ga0439449_0043636 Ga0439449_0043636_487_885 132
75 3300042156 Ga0439446_0312903 Ga0439446_0312903_28_432 132
76 3300046523 Ga0495644_0033736 Ga0495644_0033736_82_483 132
77 3300046616 Ga0495668_0000028 Ga0495668_0000028_88354_88755 132
78 3300047323 Ga0495683_0043135 Ga0495683_0043135_1313_1714 132
79 3300047470 Ga0495681_0201703 Ga0495681_0201703_277_678 132
80 3300047472 Ga0495686_0001973 Ga0495686_0001973_18939_19340 132
81 3300048090 Ga0495615_0008406 Ga0495615_0008406_177_584 132
82 3300050496 nmdc:mga07m45_525890_c1 nmdc:mga07m45_525890_c1_165_566 132
83 3300050509 nmdc:mga0qj67_479039_c1 nmdc:mga0qj67_479039_c1_30_431 132
84 3300059645 Ga0587076_078055 Ga0587076_078055_121_525 132
85 3300005458 Ga0070681_11182007 Ga0070681_111820072 133
86 3300005539 Ga0068853_100404543 Ga0068853_1004045431 133
87 3300005614 Ga0068856_100292415 Ga0068856_1002924152 133
88 3300005615 Ga0070702_101103028 Ga0070702_1011030281 133
89 3300009551 Ga0105238_10736873 Ga0105238_107368731 133
90 3300013102 Ga0157371_10402735 Ga0157371_104027352 133
91 3300013307 Ga0157372_10189898 Ga0157372_101898982 133
92 3300025924 Ga0207694_10518513 Ga0207694_105185131 133
93 3300026041 Ga0207639_10133479 Ga0207639_101334791 133
94 3300026142 Ga0207698_10384094 Ga0207698_103840943 133
95 3300031251 Ga0265327_10005690 Ga0265327_100056904 133
96 3300036401 Ga0373937_0202890 Ga0373937_0202890_38_445 133
97 3300036401 Ga0373937_0613255 Ga0373937_0613255_446_850 133
98 3300042126 Ga0450888_031391 Ga0450888_031391_76_477 133
99 3300042532 Ga0450893_0001369 Ga0450893_0001369_2002_2403 133
100 3300046471 Ga0495650_0008001 Ga0495650_0008001_5572_5988 133
101 3300053103 Ga0500555_003917 Ga0500555_003917_1114_1536 133
102 3300001979 JGI24740J21852_10032238 JGI24740J21852_100322382 134
103 3300001989 JGI24739J22299_10029087 JGI24739J22299_100290873 134
104 3300001990 JGI24737J22298_10000262 JGI24737J22298_1000026213 134
105 3300002067 JGI24735J21928_10000002 JGI24735J21928_10000002161 134
106 3300002737 JGI25162J39368_1000039 JGI25162J39368_1000039123 134
107 3300003320 rootH2_10247364 rootH2_102473642 134
108 3300003322 rootL2_10060678 rootL2_100606783 134
109 3300003322 rootL2_10256226 rootL2_102562263 134
110 3300003323 rootH1_10246981 rootH1_102469812 134
111 3300003790 Ga0055528_1076370 Ga0055528_10763701 134
112 3300003792 Ga0055540_1003201 Ga0055540_10032019 134
113 3300003794 Ga0055531_10001478 Ga0055531_1000147818 134
114 3300005328 Ga0070676_10000901 Ga0070676_1000090115 134
115 3300005329 Ga0070683_102188106 Ga0070683_1021881061 134
116 3300005334 Ga0068869_100234104 Ga0068869_1002341042 134
117 3300005334 Ga0068869_101400804 Ga0068869_1014008041 134
118 3300005336 Ga0070680_100457962 Ga0070680_1004579621 134
119 3300005338 Ga0068868_100184586 Ga0068868_1001845863 134
120 3300005353 Ga0070669_100238139 Ga0070669_1002381392 134
121 3300005356 Ga0070674_100127708 Ga0070674_1001277081 134
122 3300005364 Ga0070673_100167870 Ga0070673_1001678703 134
123 3300005364 Ga0070673_100724290 Ga0070673_1007242902 134
124 3300005364 Ga0070673_100821680 Ga0070673_1008216802 134
125 3300005435 Ga0070714_100154555 Ga0070714_1001545552 134
126 3300005456 Ga0070678_100009322 Ga0070678_1000093226 134
127 3300005456 Ga0070678_100035189 Ga0070678_1000351894 134
128 3300005456 Ga0070678_100757065 Ga0070678_1007570651 134
129 3300005459 Ga0068867_100390648 Ga0068867_1003906482 134
130 3300005467 Ga0070706_101170018 Ga0070706_1011700181 134
131 3300005468 Ga0070707_100501785 Ga0070707_1005017851 134
132 3300005518 Ga0070699_100192929 Ga0070699_1001929292 134
133 3300005530 Ga0070679_100171985 Ga0070679_1001719852 134
134 3300005539 Ga0068853_101016984 Ga0068853_1010169841 134
135 3300005539 Ga0068853_101204973 Ga0068853_1012049732 134
136 3300005543 Ga0070672_100186961 Ga0070672_1001869612 134
137 3300005548 Ga0070665_100090374 Ga0070665_1000903743 134
138 3300005548 Ga0070665_100148690 Ga0070665_1001486903 134
139 3300005563 Ga0068855_100000093 Ga0068855_10000009372 134
140 3300005563 Ga0068855_100012151 Ga0068855_1000121518 134
141 3300005563 Ga0068855_100084571 Ga0068855_1000845716 134
142 3300005563 Ga0068855_100111487 Ga0068855_1001114873 134
143 3300005563 Ga0068855_101264020 Ga0068855_1012640201 134
144 3300005563 Ga0068855_101566558 Ga0068855_1015665581 134
145 3300005577 Ga0068857_100984519 Ga0068857_1009845192 134
146 3300005578 Ga0068854_100016048 Ga0068854_1000160485 134
147 3300005578 Ga0068854_101802390 Ga0068854_1018023901 134
148 3300005614 Ga0068856_100013920 Ga0068856_1000139206 134
149 3300005616 Ga0068852_100840434 Ga0068852_1008404342 134
150 3300005616 Ga0068852_101711196 Ga0068852_1017111961 134
151 3300005617 Ga0068859_101854632 Ga0068859_1018546322 134
152 3300005719 Ga0068861_100329635 Ga0068861_1003296352 134
153 3300005841 Ga0068863_100723677 Ga0068863_1007236772 134
154 3300005843 Ga0068860_100221984 Ga0068860_1002219841 134
155 3300005843 Ga0068860_102080711 Ga0068860_1020807111 134
156 3300006038 Ga0075365_10046994 Ga0075365_100469942 134
157 3300006038 Ga0075365_10068037 Ga0075365_100680372 134
158 3300006038 Ga0075365_10135142 Ga0075365_101351422 134
159 3300006042 Ga0075368_10014008 Ga0075368_100140082 134
160 3300006177 Ga0075362_10005026 Ga0075362_100050266 134
161 3300006178 Ga0075367_10003071 Ga0075367_1000307111 134
162 3300006194 Ga0075427_10043037 Ga0075427_100430371 134
163 3300006195 Ga0075366_10009535 Ga0075366_100095352 134
164 3300006195 Ga0075366_10209122 Ga0075366_102091222 134
165 3300006195 Ga0075366_10344763 Ga0075366_103447632 134
166 3300006195 Ga0075366_10535211 Ga0075366_105352112 134
167 3300006237 Ga0097621_100000212 Ga0097621_10000021225 134
168 3300006353 Ga0075370_10047529 Ga0075370_100475291 134
169 3300006358 Ga0068871_100007236 Ga0068871_1000072362 134
170 3300006844 Ga0075428_100054805 Ga0075428_1000548057 134
171 3300006846 Ga0075430_100765624 Ga0075430_1007656242 134
172 3300006880 Ga0075429_100088482 Ga0075429_1000884824 134
173 3300006880 Ga0075429_101068495 Ga0075429_1010684951 134
174 3300006881 Ga0068865_100000112 Ga0068865_10000011227 134
175 3300006931 Ga0097620_101854222 Ga0097620_1018542222 134
176 3300009093 Ga0105240_10000143 Ga0105240_1000014335 134
177 3300009093 Ga0105240_10035919 Ga0105240_100359193 134
178 3300009093 Ga0105240_10547437 Ga0105240_105474372 134
179 3300009093 Ga0105240_10876689 Ga0105240_108766892 134
180 3300009094 Ga0111539_10466100 Ga0111539_104661001 134
181 3300009098 Ga0105245_10046747 Ga0105245_100467475 134
182 3300009147 Ga0114129_11586981 Ga0114129_115869812 134
183 3300009148 Ga0105243_12550387 Ga0105243_125503871 134
184 3300009174 Ga0105241_10026571 Ga0105241_100265716 134
185 3300009174 Ga0105241_10145470 Ga0105241_101454702 134
186 3300009176 Ga0105242_10037600 Ga0105242_100376004 134
187 3300009176 Ga0105242_10670889 Ga0105242_106708891 134
188 3300009545 Ga0105237_10000834 Ga0105237_1000083428 134
189 3300009545 Ga0105237_10000980 Ga0105237_1000098027 134
190 3300009545 Ga0105237_10002186 Ga0105237_1000218617 134
191 3300009545 Ga0105237_10039581 Ga0105237_100395815 134
192 3300009545 Ga0105237_10063233 Ga0105237_100632334 134
193 3300009545 Ga0105237_10173948 Ga0105237_101739483 134
194 3300009545 Ga0105237_11111400 Ga0105237_111114002 134
195 3300009551 Ga0105238_10014279 Ga0105238_100142793 134
196 3300009551 Ga0105238_11171987 Ga0105238_111719872 134
197 3300009553 Ga0105249_10495351 Ga0105249_104953512 134
198 3300010375 Ga0105239_10004839 Ga0105239_100048392 134
199 3300010375 Ga0105239_10015639 Ga0105239_100156395 134
200 3300010375 Ga0105239_10032983 Ga0105239_100329838 134
201 3300010375 Ga0105239_10126096 Ga0105239_101260961 134
202 3300010375 Ga0105239_10449039 Ga0105239_104490393 134
203 3300010375 Ga0105239_11389283 Ga0105239_113892832 134
204 3300011119 Ga0105246_10283980 Ga0105246_102839802 134
205 3300013102 Ga0157371_10098411 Ga0157371_100984112 134
206 3300013102 Ga0157371_10308525 Ga0157371_103085252 134
207 3300013104 Ga0157370_10000421 Ga0157370_1000042123 134
208 3300013104 Ga0157370_10543087 Ga0157370_105430871 134
209 3300013105 Ga0157369_10232033 Ga0157369_102320332 134
210 3300013296 Ga0157374_10000029 Ga0157374_10000029102 134
211 3300013296 Ga0157374_10003360 Ga0157374_1000336012 134
212 3300013297 Ga0157378_10006681 Ga0157378_100066817 134
213 3300013297 Ga0157378_10081082 Ga0157378_100810825 134
214 3300013297 Ga0157378_12487393 Ga0157378_124873931 134
215 3300013307 Ga0157372_10323103 Ga0157372_103231032 134
216 3300013307 Ga0157372_11517595 Ga0157372_115175952 134
217 3300013308 Ga0157375_11622596 Ga0157375_116225962 134
218 3300013308 Ga0157375_12135450 Ga0157375_121354501 134
219 3300014326 Ga0157380_13046171 Ga0157380_130461711 134
220 3300014745 Ga0157377_10318919 Ga0157377_103189192 134
221 3300014969 Ga0157376_10000288 Ga0157376_1000028814 134
222 3300014969 Ga0157376_10260912 Ga0157376_102609122 134
223 3300015262 Ga0182007_10269536 Ga0182007_102695361 134
224 3300017792 Ga0163161_10002846 Ga0163161_1000284616 134
225 3300017792 Ga0163161_10040350 Ga0163161_100403505 134
226 3300025233 Ga0209437_100135 Ga0209437_10013557 134
227 3300025258 Ga0209129_1008765 Ga0209129_10087653 134
228 3300025273 Ga0209673_1029930 Ga0209673_10299302 134
229 3300025284 Ga0209130_1030840 Ga0209130_10308402 134
230 3300025303 Ga0209051_1000025 Ga0209051_1000025120 134
231 3300025304 Ga0209257_1000039 Ga0209257_1000039488 134
232 3300025904 Ga0207647_10096112 Ga0207647_100961122 134
233 3300025907 Ga0207645_10000167 Ga0207645_1000016746 134
234 3300025907 Ga0207645_10689214 Ga0207645_106892141 134
235 3300025909 Ga0207705_10623729 Ga0207705_106237292 134
236 3300025913 Ga0207695_10000016 Ga0207695_10000016486 134
237 3300025913 Ga0207695_10785019 Ga0207695_107850191 134
238 3300025913 Ga0207695_10832269 Ga0207695_108322692 134
239 3300025914 Ga0207671_10002157 Ga0207671_1000215718 134
240 3300025914 Ga0207671_10003170 Ga0207671_100031705 134
241 3300025914 Ga0207671_10023891 Ga0207671_100238913 134
242 3300025914 Ga0207671_10036301 Ga0207671_100363012 134
243 3300025917 Ga0207660_10110658 Ga0207660_101106583 134
244 3300025919 Ga0207657_10040853 Ga0207657_100408535 134
245 3300025921 Ga0207652_10342460 Ga0207652_103424602 134
246 3300025924 Ga0207694_10224164 Ga0207694_102241642 134
247 3300025924 Ga0207694_10305772 Ga0207694_103057723 134
248 3300025927 Ga0207687_10026703 Ga0207687_100267033 134
249 3300025934 Ga0207686_11084392 Ga0207686_110843922 134
250 3300025937 Ga0207669_10675037 Ga0207669_106750371 134
251 3300025938 Ga0207704_10000062 Ga0207704_1000006228 134
252 3300025942 Ga0207689_10159406 Ga0207689_101594063 134
253 3300025942 Ga0207689_11198737 Ga0207689_111987372 134
254 3300025949 Ga0207667_10000939 Ga0207667_1000093930 134
255 3300025949 Ga0207667_10036805 Ga0207667_100368053 134
256 3300025949 Ga0207667_10050636 Ga0207667_100506365 134
257 3300025949 Ga0207667_10500135 Ga0207667_105001352 134
258 3300025949 Ga0207667_10626343 Ga0207667_106263432 134
259 3300025949 Ga0207667_11024676 Ga0207667_110246762 134
260 3300025960 Ga0207651_10231041 Ga0207651_102310412 134
261 3300025960 Ga0207651_10235859 Ga0207651_102358593 134
262 3300025960 Ga0207651_10659399 Ga0207651_106593992 134
263 3300025960 Ga0207651_10684884 Ga0207651_106848842 134
264 3300025981 Ga0207640_10044036 Ga0207640_100440363 134
265 3300025986 Ga0207658_11074224 Ga0207658_110742241 134
266 3300026023 Ga0207677_10119467 Ga0207677_101194674 134
267 3300026041 Ga0207639_10761593 Ga0207639_107615932 134
268 3300026088 Ga0207641_11566149 Ga0207641_115661492 134
269 3300026089 Ga0207648_10491970 Ga0207648_104919702 134
270 3300026089 Ga0207648_10699438 Ga0207648_106994382 134
271 3300026116 Ga0207674_10064228 Ga0207674_100642281 134
272 3300026116 Ga0207674_10317454 Ga0207674_103174541 134
273 3300026118 Ga0207675_100290592 Ga0207675_1002905921 134
274 3300026121 Ga0207683_10015959 Ga0207683_100159593 134
275 3300026121 Ga0207683_10053398 Ga0207683_100533986 134
276 3300026121 Ga0207683_10500084 Ga0207683_105000842 134
277 3300026121 Ga0207683_10616837 Ga0207683_106168371 134
278 3300026142 Ga0207698_10840136 Ga0207698_108401361 134
279 3300026142 Ga0207698_11463864 Ga0207698_114638642 134
280 3300028379 Ga0268266_10061927 Ga0268266_100619273 134
281 3300028379 Ga0268266_10212818 Ga0268266_102128182 134
282 3300028794 Ga0307515_10000138 Ga0307515_10000138130 134
283 3300028794 Ga0307515_10002326 Ga0307515_1000232634 134
284 3300028794 Ga0307515_10249508 Ga0307515_102495081 134
285 3300030522 Ga0307512_10031091 Ga0307512_100310914 134
286 3300031456 Ga0307513_10011501 Ga0307513_1001150113 134
287 3300031456 Ga0307513_10110167 Ga0307513_101101673 134
288 3300031548 Ga0307408_100081721 Ga0307408_1000817213 134
289 3300031548 Ga0307408_100232430 Ga0307408_1002324302 134
290 3300031548 Ga0307408_100773248 Ga0307408_1007732482 134
291 3300031548 Ga0307408_101690818 Ga0307408_1016908181 134
292 3300031730 Ga0307516_10175199 Ga0307516_101751993 134
293 3300031731 Ga0307405_10582553 Ga0307405_105825532 134
294 3300032002 Ga0307416_100205166 Ga0307416_1002051663 134
295 3300032004 Ga0307414_10288232 Ga0307414_102882322 134
296 3300032005 Ga0307411_10276191 Ga0307411_102761912 134
297 3300032005 Ga0307411_10558590 Ga0307411_105585902 134
298 3300035120 Ga0373957_0444567 Ga0373957_0444567_58_468 134
299 3300035695 Ga0373927_0483043 Ga0373927_0483043_59_466 134
300 3300037312 Ga0395899_0026008 Ga0395899_0026008_429_839 134
301 3300037312 Ga0395899_0050036 Ga0395899_0050036_877_1284 134
302 3300037312 Ga0395899_0473165 Ga0395899_0473165_86_496 134
303 3300037418 Ga0395900_0013770 Ga0395900_0013770_7155_7565 134
304 3300037418 Ga0395900_0146359 Ga0395900_0146359_1346_1753 134
305 3300037418 Ga0395900_0227056 Ga0395900_0227056_258_668 134
306 3300037466 Ga0395898_0041268 Ga0395898_0041268_3578_3988 134
307 3300037466 Ga0395898_0114808 Ga0395898_0114808_307_714 134
308 3300037471 Ga0395905_0000492 Ga0395905_0000492_33731_34141 134
309 3300037471 Ga0395905_0020892 Ga0395905_0020892_5324_5752 134
310 3300037471 Ga0395905_0026082 Ga0395905_0026082_4149_4556 134
311 3300037471 Ga0395905_0052899 Ga0395905_0052899_479_889 134
312 3300037471 Ga0395905_0125790 Ga0395905_0125790_1052_1462 134
313 3300037471 Ga0395905_0134603 Ga0395905_0134603_1380_1790 134
314 3300037471 Ga0395905_0172601 Ga0395905_0172601_1405_1815 134
315 3300038443 Ga0395901_0034384 Ga0395901_0034384_4706_5116 134
316 3300038443 Ga0395901_0071268 Ga0395901_0071268_1852_2259 134
317 3300038443 Ga0395901_0142322 Ga0395901_0142322_1770_2177 134
318 3300038443 Ga0395901_1163385 Ga0395901_1163385_120_530 134
319 3300041404 Ga0439436_0015745 Ga0439436_0015745_804_1220 134
320 3300041404 Ga0439436_0061426 Ga0439436_0061426_176_586 134
321 3300041406 Ga0439439_0011311 Ga0439439_0011311_1049_1465 134
322 3300041408 Ga0439453_0022653 Ga0439453_0022653_497_907 134
323 3300041410 Ga0439461_0074929 Ga0439461_0074929_132_542 134
324 3300041413 Ga0439465_0115037 Ga0439465_0115037_29_439 134
325 3300041443 Ga0451789_0965244 Ga0451789_0965244_110_520 134
326 3300041451 Ga0451791_0341307 Ga0451791_0341307_112_522 134
327 3300041452 Ga0451793_1933520 Ga0451793_1933520_1442_1852 134
328 3300041456 Ga0451795_0483915 Ga0451795_0483915_44_454 134
329 3300041456 Ga0451795_1457987 Ga0451795_1457987_638_1048 134
330 3300041458 Ga0451798_0070591 Ga0451798_0070591_188_592 134
331 3300041463 Ga0451804_0935367 Ga0451804_0935367_28_438 134
332 3300041486 Ga0451807_2055702 Ga0451807_2055702_120_530 134
333 3300041491 Ga0451833_0388163 Ga0451833_0388163_65_475 134
334 3300041492 Ga0451835_0308700 Ga0451835_0308700_312_722 134
335 3300041496 Ga0451839_0492226 Ga0451839_0492226_841_1251 134
336 3300041509 Ga0451843_1593968 Ga0451843_1593968_187_621 134
337 3300041511 Ga0451855_1584976 Ga0451855_1584976_401_811 134
338 3300041512 Ga0451853_1188011 Ga0451853_1188011_65_475 134
339 3300041512 Ga0451853_1874792 Ga0451853_1874792_109_522 134
340 3300041997 Ga0439431_0000046 Ga0439431_0000046_17357_17773 134
341 3300041999 Ga0439433_0004142 Ga0439433_0004142_2054_2470 134
342 3300042000 Ga0439437_007113 Ga0439437_007113_689_1114 134
343 3300042004 Ga0439445_0047892 Ga0439445_0047892_690_1106 134
344 3300042006 Ga0439432_142490 Ga0439432_142490_130_540 134
345 3300042007 Ga0439449_0000612 Ga0439449_0000612_4669_5085 134
346 3300042007 Ga0439449_0368654 Ga0439449_0368654_45_455 134
347 3300042012 Ga0439455_0065845 Ga0439455_0065845_503_913 134
348 3300042014 Ga0439457_034210 Ga0439457_034210_224_640 134
349 3300042015 Ga0439462_0001383 Ga0439462_0001383_3748_4164 134
350 3300042015 Ga0439462_0014214 Ga0439462_0014214_915_1331 134
351 3300042118 Ga0450914_008551 Ga0450914_008551_124_543 134
352 3300042123 Ga0450921_003836 Ga0450921_003836_131_541 134
353 3300042127 Ga0450890_004182 Ga0450890_004182_1145_1555 134
354 3300042134 Ga0450898_017798 Ga0450898_017798_130_540 134
355 3300042138 Ga0450903_014634 Ga0450903_014634_191_601 134
356 3300042139 Ga0450904_016244 Ga0450904_016244_65_475 134
357 3300042157 Ga0439458_0028651 Ga0439458_0028651_288_698 134
358 3300042185 Ga0450909_010056 Ga0450909_010056_695_1111 134
359 3300042435 Ga0439434_0022553 Ga0439434_0022553_115_525 134
360 3300042436 Ga0439435_0015951 Ga0439435_0015951_403_819 134
361 3300042437 Ga0439444_0021697 Ga0439444_0021697_199_609 134
362 3300042439 Ga0439464_0086814 Ga0439464_0086814_189_599 134
363 3300042876 Ga0451577_0009013 Ga0451577_0009013_7327_7737 134
364 3300042876 Ga0451577_0339077 Ga0451577_0339077_423_884 134
365 3300044656 Ga0466969_0021648 Ga0466969_0021648_747_1157 134
366 3300044658 Ga0466972_0070923 Ga0466972_0070923_1211_1621 134
367 3300044684 Ga0466966_0006478 Ga0466966_0006478_2230_2640 134
368 3300044684 Ga0466966_0327928 Ga0466966_0327928_297_707 134
369 3300044693 Ga0466961_0043621 Ga0466961_0043621_2044_2454 134
370 3300044706 Ga0466964_0226230 Ga0466964_0226230_378_788 134
371 3300044712 Ga0453684_0728884 Ga0453684_0728884_204_614 134
372 3300044735 Ga0466968_0242701 Ga0466968_0242701_112_522 134
373 3300044765 Ga0466970_0038575 Ga0466970_0038575_725_1135 134
374 3300044765 Ga0466970_0905852 Ga0466970_0905852_80_490 134
375 3300045049 Ga0466959_0098747 Ga0466959_0098747_1484_1894 134
376 3300045049 Ga0466959_0139428 Ga0466959_0139428_68_484 134
377 3300045051 Ga0451576_0709760 Ga0451576_0709760_520_981 134
378 3300046512 Ga0495610_0068597 Ga0495610_0068597_1167_1577 134
379 3300046513 Ga0495616_0012336 Ga0495616_0012336_3662_4072 134
380 3300046519 Ga0495632_0021999 Ga0495632_0021999_37_447 134
381 3300046519 Ga0495632_0426234 Ga0495632_0426234_124_534 134
382 3300046522 Ga0495643_0101131 Ga0495643_0101131_810_1220 134
383 3300046522 Ga0495643_0102925 Ga0495643_0102925_309_749 134
384 3300046539 Ga0495621_0083055 Ga0495621_0083055_512_922 134
385 3300046616 Ga0495668_0000112 Ga0495668_0000112_29846_30316 134
386 3300046660 Ga0495625_0004022 Ga0495625_0004022_6823_7233 134
387 3300046660 Ga0495625_0006096 Ga0495625_0006096_1132_1542 134
388 3300046660 Ga0495625_0078429 Ga0495625_0078429_1200_1610 134
389 3300047443 Ga0495687_091665 Ga0495687_091665_448_858 134
390 3300047472 Ga0495686_0001502 Ga0495686_0001502_384_794 134
391 3300047472 Ga0495686_0065671 Ga0495686_0065671_418_828 134
392 3300048912 Ga0496109_0068236 Ga0496109_0068236_702_1115 134
393 3300048912 Ga0496109_1881053 Ga0496109_1881053_77_487 134
394 3300048925 Ga0496122_0004931 Ga0496122_0004931_3493_3903 134
395 3300048926 Ga0496123_0032769 Ga0496123_0032769_2518_2928 134
396 3300048928 Ga0496125_0141209 Ga0496125_0141209_690_1100 134
397 3300049459 Ga0495678_012445 Ga0495678_012445_3297_3707 134
398 3300049460 Ga0495682_0018266 Ga0495682_0018266_382_795 134
399 3300049572 Ga0501036_0579443 Ga0501036_0579443_128_538 134
400 3300049574 Ga0501038_0466236 Ga0501038_0466236_495_905 134
401 3300049574 Ga0501038_1022589 Ga0501038_1022589_132_542 134
402 3300049576 Ga0501040_0591260 Ga0501040_0591260_135_545 134
403 3300049577 Ga0501041_0710429 Ga0501041_0710429_112_522 134
404 3300049578 Ga0501042_0389348 Ga0501042_0389348_289_699 134
405 3300049579 Ga0501043_0184113 Ga0501043_0184113_836_1246 134
406 3300049581 Ga0501047_0017151 Ga0501047_0017151_5883_6293 134
407 3300049581 Ga0501047_0648088 Ga0501047_0648088_129_539 134
408 3300049582 Ga0501048_0696274 Ga0501048_0696274_132_542 134
409 3300049588 Ga0501072_0313121 Ga0501072_0313121_369_779 134
410 3300049822 Ga0501035_0166949 Ga0501035_0166949_1362_1772 134
411 3300049823 Ga0501044_0089475 Ga0501044_0089475_46_456 134
412 3300050489 nmdc:mga03683_361295_c1 nmdc:mga03683_361295_c1_237_650 134
413 3300050489 nmdc:mga03683_534207_c1 nmdc:mga03683_534207_c1_148_558 134
414 3300050489 nmdc:mga03683_646317_c1 nmdc:mga03683_646317_c1_69_476 134
415 3300050490 nmdc:mga03n38_19742_c1 nmdc:mga03n38_19742_c1_325_738 134
416 3300050492 nmdc:mga0yw44_337155_c1 nmdc:mga0yw44_337155_c1_93_503 134
417 3300050492 nmdc:mga0yw44_42035_c1 nmdc:mga0yw44_42035_c1_644_1054 134
418 3300050492 nmdc:mga0yw44_76358_c1 nmdc:mga0yw44_76358_c1_630_1043 134
419 3300050493 nmdc:mga0k408_108920_c1 nmdc:mga0k408_108920_c1_390_800 134
420 3300050493 nmdc:mga0k408_179522_c1 nmdc:mga0k408_179522_c1_674_1084 134
421 3300050493 nmdc:mga0k408_1866_c1 nmdc:mga0k408_1866_c1_10637_11047 134
422 3300050493 nmdc:mga0k408_20379_c1 nmdc:mga0k408_20379_c1_37_474 134
423 3300050493 nmdc:mga0k408_4657_c1 nmdc:mga0k408_4657_c1_4523_4933 134
424 3300050494 nmdc:mga06z11_45366_c1 nmdc:mga06z11_45366_c1_1701_2114 134
425 3300050494 nmdc:mga06z11_628535_c1 nmdc:mga06z11_628535_c1_61_486 134
426 3300050496 nmdc:mga07m45_218163_c1 nmdc:mga07m45_218163_c1_138_548 134
427 3300050508 nmdc:mga09592_89734_c1 nmdc:mga09592_89734_c1_1486_1896 134
428 3300050509 nmdc:mga0qj67_235269_c1 nmdc:mga0qj67_235269_c1_268_675 134
429 3300050509 nmdc:mga0qj67_47040_c1 nmdc:mga0qj67_47040_c1_1343_1753 134
430 3300050510 nmdc:mga06r32_2021014_c1 nmdc:mga06r32_2021014_c1_41_451 134
431 3300050511 nmdc:mga08y16_336880_c1 nmdc:mga08y16_336880_c1_866_1273 134
432 3300050516 nmdc:mga0sz30_111132_c1 nmdc:mga0sz30_111132_c1_380_790 134
433 3300053093 Ga0500651_0010317 Ga0500651_0010317_1763_2173 134
434 3300053156 Ga0500622_0008277 Ga0500622_0008277_4847_5260 134
435 3300053161 Ga0500634_0168274 Ga0500634_0168274_123_533 134
436 3300053730 Ga0500645_048596 Ga0500645_048596_265_672 134
437 3300053739 Ga0500587_000372 Ga0500587_000372_412_822 134
438 3300054114 Ga0501084_0752762 Ga0501084_0752762_263_673 134
439 3300059421 Ga0590071_043097 Ga0590071_043097_401_877 134
440 3300059424 Ga0590075_081242 Ga0590075_081242_270_686 134

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22677

Ble-like_N

Bleomycin resistance protein-like N-terminal

24

64

0.94

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

24

146

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9652 1 130
4gym-assembly1.cif.gz_B error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9303 1 130
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9288 1 134
4gym-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.9221 1 134
4pav-assembly1.cif.gz_A structure of hypothetical protein sa1046 from s. aureus. 0.8829 1 126
ID Description Score Start End Superfamily
af_A0A0G2K339_23_447_1.10.630.10 Mainly Alpha;Orthogonal Bundle;Cytochrome p450;Cytochrome P450 0.9536 37 50 1.10.630.10
4gymA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9164 1 134 3.10.180.10
4gymA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9029 1 134 3.10.180.10
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8844 73 127 3.30.720.110
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8679 72 127 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A4V3IIL6-F1-model_v4 deleted 0.9888 1 132
AF-A0A4U9WAT0-F1-model_v4 Predicted lactoylglutathione lyase 0.9886 73 130 GO:0016829
AF-A0A4Q6EJ63-F1-model_v4 VOC domain-containing protein 0.9879 2 129
AF-A0A317ZSQ5-F1-model_v4 Glyoxalase 0.9866 1 134
AF-A0A7X6S8H6-F1-model_v4 deleted 0.9866 1 130

Feature Viewer

pLDDT pTM Quality
95.92 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map