metagRoot

F444476

General Info

Members	Datasets	Scaffolds	Average Seq Length
440	238	402	261

Family's Representative Sequence

Representative Sequence	3300042876\|Ga0451577_0061839\|Ga0451577_0061839_1215_2051
Length	278
Sequence	MPIGSRFHYKTPEEIEIIRKNCLLVSETLAEVAKHIKPGVTGLMLDTLAETFIRDHGAEPAFKGYPGSISDFPASLCISFNEVIVHGIPDKREIKEGDILSVDCGVKMNGYFGDAAFTFAIGEIKPEELDLLVTTRECLDLAIGQAVAGNRLGDIGFAVQQHAEVEHGYGVIREMVGHGIGKKLHEKPEVPNYGKRGKGPVLHEGLTIAIEPMINLGTREVVLKKDGWTLVTRDLKPSAHYEHTIAIQKSAADVLSDHKVIDQAIKNNVNLSEVWIKR

Samples

	Sample ID	Description	Type	Environment
1	2162886007	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1	Metagenome	Rhizosphere
2	2585427687	Pedobacter borealis DSM 19626	Isolate	Rhizosphere
3	2599185184	Mucilaginibacter sp. NFR10	Isolate	Rhizoplane
4	2721755487	Sphingobacterium sp. B29	Isolate	Rhizosphere
5	2738541283	Pedobacter sp. OK701	Isolate	Unclassified
6	2738541284	Pedobacter sp. YR016	Isolate	Unclassified
7	2738541302	Pedobacter sp. CF074	Isolate	Unclassified
8	2738543023	Pedobacter sp. OK628	Isolate	Unclassified
9	2739367651	Pedobacter sp. OK291	Isolate	Unclassified
10	2739367656	Pedobacter sp. CF523	Isolate	Unclassified
11	2739367663	Pedobacter sp. YR510	Isolate	Unclassified
12	2775506987	Pedobacter ginsengisoli T01R-27	Isolate	Unclassified
13	2818991437	Pedobacter terrae 518	Isolate	Unclassified
14	2842722452	Pedobacter sp. R-72249	Isolate	Unclassified
15	2842903701	Olivibacter sp. R-72191	Isolate	Unclassified
16	2842909656	Pedobacter sp. R-72393	Isolate	Unclassified
17	2849281842	Pedobacter sp. AK013	Isolate	Rhizosphere
18	2852623160	Mucilaginibacter sp. AK015	Isolate	Rhizosphere
19	2852627209	Pedobacter sp. AK017	Isolate	Rhizosphere
20	2857627736	Pedobacter sp. R-74587	Isolate	Unclassified
21	2884933994	Mucilaginibacter sp. 14171R-50	Isolate	Rhizosphere
22	2890737413	Parapedobacter sp. SGR-10	Isolate	Rhizosphere
23	2896317667	Sphingobacterium sp. SGR-19	Isolate	Rhizosphere
24	2896344016	Sphingobacterium sp. SGL-16	Isolate	Rhizosphere
25	2898713307	Sphingobacterium sp. SGG-5	Isolate	Rhizosphere
26	2902048731	Pedobacter ureilyticus THG-T11	Isolate	Rhizosphere
27	2904445276	Pedobacter terrae 1734	Isolate	Rhizosphere
28	2904780799	Sphingobacterium sp. 1304	Isolate	Rhizosphere
29	2919177583	Sphingobacterium sp. 2149	Isolate	Rhizosphere
30	2919186247	Pedobacter africanus 2697	Isolate	Rhizosphere
31	2919437846	Mucilaginibacter pocheonensis 3262	Isolate	Rhizosphere
32	2928078545	Mucilaginibacter rubeus 1215	Isolate	Unclassified
33	2928147474	Mucilaginibacter rubeus 2025	Isolate	Unclassified
34	2932082852	Mucilaginibacter sp. 3215	Isolate	Rhizosphere
35	2939664404	Pedobacter africanus 2990	Isolate	Rhizosphere
36	2945997725	Pedobacter sp. W3I1	Isolate	Rhizosphere
37	2954016120	Flavobacterium sp. W4I14	Isolate	Rhizosphere
38	2977232053	Mucilaginibacter terrae SORGH_AS 422	Isolate	Unclassified
39	3003233435	Sphingobacterium shayense CrR18	Isolate	Unclassified
40	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
41	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
42	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
43	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
44	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
45	3300002773	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS	Metagenome	Endosphere
46	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
47	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
48	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
49	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
50	3300003316	Sugarcane root Sample L1	Metagenome	Unclassified
51	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
52	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
53	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
54	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
55	3300004799	Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
56	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
57	3300005288	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
58	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
59	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
60	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
61	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
62	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
63	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
64	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
65	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
66	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
67	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
68	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
69	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
70	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
71	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
72	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
73	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
74	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
75	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
76	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
77	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
78	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
79	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
80	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
81	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
82	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
83	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
84	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
85	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
86	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
87	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
88	3300009036	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG	Metagenome	Rhizosphere
89	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
90	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
91	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
92	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
93	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
94	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
95	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
96	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
97	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
98	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
99	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
100	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
101	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
102	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
103	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
104	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
105	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
106	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
107	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
108	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
109	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
110	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
111	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
112	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
113	3300015682	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01	Metagenome	Rhizosphere
114	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
115	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
116	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
117	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
118	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
119	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
120	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
121	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
122	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
123	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
124	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
125	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
126	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
127	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
128	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
129	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
130	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025728	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
160	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
161	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
162	3300030742	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9	Metagenome	Rhizosphere
163	3300030744	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7	Metagenome	Rhizosphere
164	3300030745	Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8	Metagenome	Rhizosphere
165	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
166	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
167	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
168	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
169	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
170	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
171	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
172	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
173	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
174	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
175	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
176	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
177	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
178	3300033524	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
179	3300033528	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
180	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
181	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
182	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
183	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
184	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
185	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
186	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
187	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
188	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
189	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
190	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
191	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
192	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
193	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
194	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
195	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
196	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
197	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
198	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
199	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
200	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
201	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
202	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
203	3300046520	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere	Metagenome	Rhizosphere
204	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
205	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
206	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
207	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
208	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
209	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
210	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
211	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
212	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
213	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
214	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
215	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
216	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
217	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
218	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
219	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
220	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
221	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
222	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
223	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
224	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
225	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
226	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
227	3300049527	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
228	3300049539	Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
229	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
230	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
231	3300049776	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought	Metagenome	Rhizosphere
232	3300050493	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation	Metagenome	Endosphere
233	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
234	3300053093	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere	Metagenome	Endosphere
235	3300053122	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere	Metagenome	Endosphere
236	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
237	3300053143	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere	Metagenome	Endosphere
238	3300053156	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere	Metagenome	Endosphere

Type Distribution

Type	Percentage (%)
Metagenomes	88.64
Metatranscriptomes	2.73
Isolates	8.64

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	8.64
Nodule	0
Rhizoplane	0.45
Rhizosphere	80.91
Stem	0
Stem Tuber	0
Unclassified	10

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	SwRhRL2b_contig_1197142	2162886007	Bacteria	2304
2	JGI24740J21852_10008913	3300001979	Bacteria	3965
3	JGI24737J22298_10001860	3300001990	Bacteria	7545
4	JGI24737J22298_10007583	3300001990	Bacteria	3656
5	JGI24735J21928_10000003	3300002067	Bacteria	385983
6	JGI25162J39368_1000039	3300002737	Bacteria	175976
7	JGI25162J39368_1001202	3300002737	Bacteria	15113
8	JGI25164J39214_1001166	3300002772	Bacteria	7290
9	JGI25152J39213_1000006	3300002773	Bacteria	158516
10	JGI25150J39212_1000005	3300002774	Bacteria	311800
11	JGI25151J46595_10000004	3300003187	Bacteria	494006
12	JGI25165J46597_1000678	3300003214	Bacteria	27401
13	JGI25153J46596_10000004	3300003215	Bacteria	494006
14	rootH1_10027299	3300003316	Bacteria	5608
15	rootH2_10026380	3300003320	Bacteria	6469
16	rootH2_10026382	3300003320	Bacteria	1425
17	rootH2_10040379	3300003320	Bacteria	2055
18	rootH1_10006680	3300003323	Bacteria	5974
19	rootH1_10018837	3300003323	Bacteria	2097
20	rootH1_10132210	3300003323	Bacteria	2506
21	Ga0055536_1000004	3300003781	Bacteria	411108
22	Ga0055530_10000817	3300003791	Bacteria	25836
23	Ga0058863_10160658	3300004799	Bacteria	11335
24	Ga0065165_1000831	3300005262	Bacteria	40595
25	Ga0065714_10002624	3300005288	Bacteria	24311
26	Ga0065714_10009709	3300005288	Bacteria	2483
27	Ga0065714_10083802	3300005288	Bacteria	2230
28	Ga0065714_10087799	3300005288	Bacteria	2041
29	Ga0065714_10190290	3300005288	Bacteria	928
30	Ga0065714_10226071	3300005288	Bacteria	826
31	Ga0065704_10000307	3300005289	Bacteria	35767
32	Ga0065704_10075644	3300005289	Bacteria	5484
33	Ga0070658_10000153	3300005327	Bacteria	60625
34	Ga0070658_10090878	3300005327	Bacteria	2516
35	Ga0070658_10140676	3300005327	Bacteria	2016
36	Ga0070658_10259438	3300005327	Bacteria	1476
37	Ga0070676_10000312	3300005328	Bacteria	21945
38	Ga0070680_100005676	3300005336	Bacteria	9464
39	Ga0070660_100047075	3300005339	Bacteria	3308
40	Ga0070660_100053292	3300005339	Bacteria	3120
41	Ga0070660_100341644	3300005339	Bacteria	1232
42	Ga0070691_10023134	3300005341	Bacteria	2885
43	Ga0070688_100073921	3300005365	Bacteria	2187
44	Ga0070659_100000375	3300005366	Bacteria	33764
45	Ga0070659_100017452	3300005366	Bacteria	5404
46	Ga0070663_100101524	3300005455	Bacteria	2147
47	Ga0070678_100001208	3300005456	Bacteria	13700
48	Ga0070662_100000074	3300005457	Bacteria	54943
49	Ga0070681_10002985	3300005458	Bacteria	15692
50	Ga0068867_100010877	3300005459	Bacteria	6418
51	Ga0070685_10093213	3300005466	Bacteria	1826
52	Ga0070679_100006255	3300005530	Bacteria	11090
53	Ga0070684_100167813	3300005535	Bacteria	1993
54	Ga0068853_100058721	3300005539	Bacteria	3321
55	Ga0068853_100090362	3300005539	Bacteria	2691
56	Ga0070672_100092632	3300005543	Bacteria	2440
57	Ga0070665_100000372	3300005548	Bacteria	66748
58	Ga0068855_100000360	3300005563	Bacteria	56448
59	Ga0068855_100012268	3300005563	Bacteria	10356
60	Ga0068855_100071470	3300005563	Bacteria	4035
61	Ga0068855_100359969	3300005563	Bacteria	1601
62	Ga0068855_100527471	3300005563	Bacteria	1280
63	Ga0068857_100112855	3300005577	Bacteria	2444
64	Ga0068856_100004718	3300005614	Bacteria	13531
65	Ga0068856_100016148	3300005614	Bacteria	7219
66	Ga0068856_100230141	3300005614	Bacteria	1869
67	Ga0068852_100010466	3300005616	Bacteria	6935
68	Ga0068852_100399350	3300005616	Bacteria	1352
69	Ga0068851_10000177	3300005834	Bacteria	31928
70	Ga0068858_100127549	3300005842	Bacteria	2384
71	Ga0075366_10000284	3300006195	Bacteria	22680
72	Ga0075366_10000288	3300006195	Bacteria	22515
73	Ga0075366_10204183	3300006195	Bacteria	1202
74	Ga0097621_100007799	3300006237	Bacteria	7678
75	Ga0075370_10027039	3300006353	Bacteria	3181
76	Ga0068871_100000141	3300006358	Bacteria	46656
77	Ga0068865_100000917	3300006881	Bacteria	16715
78	Ga0105244_10015827	3300009036	Bacteria	4315
79	Ga0105240_10000082	3300009093	Bacteria	195184
80	Ga0105240_10110375	3300009093	Bacteria	3329
81	Ga0105240_10237431	3300009093	Bacteria	2115
82	Ga0105240_10387298	3300009093	Bacteria	1577
83	Ga0111539_10616286	3300009094	Bacteria	1264
84	Ga0105243_10000009	3300009148	Bacteria	354419
85	Ga0105242_10089716	3300009176	Bacteria	2585
86	Ga0105237_10000794	3300009545	Bacteria	43200
87	Ga0105237_10002553	3300009545	Bacteria	22488
88	Ga0105237_10006510	3300009545	Bacteria	12935
89	Ga0105237_10015313	3300009545	Bacteria	7986
90	Ga0105237_10015662	3300009545	Bacteria	7882
91	Ga0105237_10071252	3300009545	Bacteria	3471
92	Ga0105237_10143356	3300009545	Bacteria	2383
93	Ga0105237_10221628	3300009545	Bacteria	1891
94	Ga0105238_10017754	3300009551	Bacteria	7234
95	Ga0105238_10369988	3300009551	Bacteria	1423
96	Ga0105249_10426658	3300009553	Bacteria	1361
97	Ga0105239_10000011	3300010375	Bacteria	337500
98	Ga0105239_10015682	3300010375	Bacteria	8387
99	Ga0105239_10075656	3300010375	Bacteria	3702
100	Ga0105239_10150240	3300010375	Bacteria	2600
101	Ga0105239_10190824	3300010375	Bacteria	2293
102	Ga0105239_10356241	3300010375	Bacteria	1652
103	Ga0105239_10436481	3300010375	Bacteria	1484
104	Ga0157373_10000129	3300013100	Bacteria	59252
105	Ga0157373_10001033	3300013100	Bacteria	21448
106	Ga0157373_10009996	3300013100	Bacteria	6992
107	Ga0157373_10028999	3300013100	Bacteria	3989
108	Ga0157373_10048319	3300013100	Bacteria	3034
109	Ga0157373_10077078	3300013100	Bacteria	2352
110	Ga0157371_10000041	3300013102	Bacteria	203957
111	Ga0157371_10001664	3300013102	Bacteria	22687
112	Ga0157371_10003367	3300013102	Bacteria	14536
113	Ga0157371_10021684	3300013102	Bacteria	4713
114	Ga0157371_10033811	3300013102	Bacteria	3672
115	Ga0157371_10035324	3300013102	Bacteria	3582
116	Ga0157370_10012207	3300013104	Bacteria	8929
117	Ga0157370_10014051	3300013104	Bacteria	8215
118	Ga0157370_10019720	3300013104	Bacteria	6751
119	Ga0157370_10060489	3300013104	Bacteria	3596
120	Ga0157370_10061379	3300013104	Bacteria	3568
121	Ga0157370_10084704	3300013104	Bacteria	2979
122	Ga0157370_10134256	3300013104	Bacteria	2307
123	Ga0157370_10333493	3300013104	Bacteria	1398
124	Ga0157369_10000016	3300013105	Bacteria	257827
125	Ga0157369_10004050	3300013105	Bacteria	17366
126	Ga0157369_10122617	3300013105	Bacteria	2757
127	Ga0157369_10294778	3300013105	Bacteria	1688
128	Ga0157369_10393357	3300013105	Bacteria	1438
129	Ga0157374_10030641	3300013296	Bacteria	4886
130	Ga0157374_10077301	3300013296	Bacteria	3150
131	Ga0157378_10008303	3300013297	Bacteria	9048
132	Ga0157378_10060889	3300013297	Bacteria	3368
133	Ga0157378_10186521	3300013297	Bacteria	1954
134	Ga0157378_10629553	3300013297	Bacteria	1087
135	Ga0163162_10001202	3300013306	Bacteria	24155
136	Ga0163162_10044820	3300013306	Bacteria	4431
137	Ga0163162_10070743	3300013306	Bacteria	3540
138	Ga0163162_10339588	3300013306	Bacteria	1634
139	Ga0157372_10000030	3300013307	Bacteria	179925
140	Ga0157372_10000332	3300013307	Bacteria	51907
141	Ga0157372_10001364	3300013307	Bacteria	26417
142	Ga0157372_10003430	3300013307	Bacteria	17111
143	Ga0157372_10011651	3300013307	Bacteria	9360
144	Ga0157372_10037880	3300013307	Bacteria	5321
145	Ga0157372_10086212	3300013307	Bacteria	3563
146	Ga0157372_10123218	3300013307	Bacteria	2980
147	Ga0157375_10022074	3300013308	Bacteria	5854
148	Ga0157375_10081872	3300013308	Bacteria	3269
149	Ga0157375_10187566	3300013308	Bacteria	2222
150	Ga0157375_10369293	3300013308	Bacteria	1601
151	Ga0163163_10277413	3300014325	Bacteria	1727
152	Ga0157380_10004578	3300014326	Bacteria	9601
153	Ga0182008_10000034	3300014497	Bacteria	138235
154	Ga0182008_10000600	3300014497	Bacteria	26471
155	Ga0182008_10003643	3300014497	Bacteria	9192
156	Ga0157377_10134890	3300014745	Bacteria	1511
157	Ga0157376_10436747	3300014969	Bacteria	1274
158	Ga0182006_1000103	3300015261	Bacteria	93638
159	Ga0182006_1006389	3300015261	Bacteria	5486
160	Ga0182006_1008481	3300015261	Bacteria	4656
161	Ga0182006_1020413	3300015261	Bacteria	2776
162	Ga0182006_1032340	3300015261	Bacteria	2103
163	Ga0182007_10000002	3300015262	Bacteria	564661
164	Ga0182007_10005771	3300015262	Bacteria	5382
165	Ga0183373_1004	3300015682	Bacteria	537398
166	Ga0163161_10013535	3300017792	Bacteria	5680
167	Ga0163161_10044157	3300017792	Bacteria	3210
168	Ga0163161_10050338	3300017792	Bacteria	3014
169	Ga0163161_10087977	3300017792	Bacteria	2296
170	Ga0163161_10098092	3300017792	Bacteria	2177
171	Ga0163161_10347618	3300017792	Bacteria	1178
172	Ga0197907_11036902	3300020069	Bacteria	5494
173	Ga0206351_10267476	3300020077	Bacteria	15418
174	Ga0206351_10512829	3300020077	Bacteria	15076
175	Ga0154015_1037437	3300020610	Bacteria	13281
176	Ga0154015_1495562	3300020610	Bacteria	11881
177	Ga0213872_10006418	3300021361	Bacteria	5910
178	Ga0207427_100025	3300025231	Bacteria	433726
179	Ga0209437_100010	3300025233	Bacteria	838447
180	Ga0209437_100135	3300025233	Bacteria	176455
181	Ga0207425_1000008	3300025245	Bacteria	618024
182	Ga0209026_1000610	3300025250	Bacteria	22917
183	Ga0209026_1004500	3300025250	Bacteria	4111
184	Ga0209129_1000040	3300025258	Bacteria	313043
185	Ga0209233_1000017	3300025261	Bacteria	898076
186	Ga0209233_1001079	3300025261	Bacteria	11257
187	Ga0209455_1001879	3300025272	Bacteria	8760
188	Ga0209676_1000009	3300025292	Bacteria	981719
189	Ga0209025_1000020	3300025294	Bacteria	618024
190	Ga0209758_1000022	3300025297	Bacteria	618024
191	Ga0209050_1000048	3300025298	Bacteria	371553
192	Ga0207656_10002394	3300025321	Bacteria	6311
193	Ga0207655_1034651	3300025728	Bacteria	2266
194	Ga0207647_10000171	3300025904	Bacteria	51875
195	Ga0207647_10022536	3300025904	Bacteria	4181
196	Ga0207647_10032931	3300025904	Bacteria	3324
197	Ga0207645_10000035	3300025907	Bacteria	89345
198	Ga0207705_10000108	3300025909	Bacteria	93501
199	Ga0207654_10034290	3300025911	Bacteria	2819
200	Ga0207654_10138162	3300025911	Bacteria	1551
201	Ga0207707_10032972	3300025912	Bacteria	4534
202	Ga0207695_10000053	3300025913	Bacteria	396740
203	Ga0207695_10039657	3300025913	Bacteria	5060
204	Ga0207695_10057771	3300025913	Bacteria	4030
205	Ga0207695_10080728	3300025913	Bacteria	3293
206	Ga0207695_10501005	3300025913	Bacteria	1096
207	Ga0207695_10611693	3300025913	Bacteria	971
208	Ga0207671_10005849	3300025914	Bacteria	11173
209	Ga0207671_10011776	3300025914	Bacteria	7082
210	Ga0207671_10013363	3300025914	Bacteria	6541
211	Ga0207671_10014424	3300025914	Bacteria	6246
212	Ga0207671_10018120	3300025914	Bacteria	5410
213	Ga0207671_10034795	3300025914	Bacteria	3742
214	Ga0207671_10053614	3300025914	Bacteria	2988
215	Ga0207671_10129273	3300025914	Bacteria	1938
216	Ga0207660_10024307	3300025917	Bacteria	4102
217	Ga0207657_10023513	3300025919	Bacteria	5737
218	Ga0207657_10058573	3300025919	Bacteria	3314
219	Ga0207657_10280514	3300025919	Bacteria	1323
220	Ga0207657_10316176	3300025919	Bacteria	1235
221	Ga0207652_10002419	3300025921	Bacteria	15754
222	Ga0207694_10009649	3300025924	Bacteria	7276
223	Ga0207694_10042226	3300025924	Bacteria	3517
224	Ga0207644_10013551	3300025931	Bacteria	5439
225	Ga0207690_10000936	3300025932	Bacteria	18684
226	Ga0207690_10005948	3300025932	Bacteria	7224
227	Ga0207706_10019009	3300025933	Bacteria	6180
228	Ga0207709_10000026	3300025935	Bacteria	354467
229	Ga0207704_10000036	3300025938	Bacteria	94574
230	Ga0207667_10000430	3300025949	Bacteria	56466
231	Ga0207667_10023666	3300025949	Bacteria	6761
232	Ga0207667_10041900	3300025949	Bacteria	4869
233	Ga0207667_10076563	3300025949	Bacteria	3471
234	Ga0207667_10152883	3300025949	Bacteria	2375
235	Ga0207651_10009416	3300025960	Bacteria	5347
236	Ga0207677_10112728	3300026023	Bacteria	2029
237	Ga0207639_10030197	3300026041	Bacteria	3973
238	Ga0207639_10034930	3300026041	Bacteria	3719
239	Ga0207639_10131675	3300026041	Bacteria	2071
240	Ga0207678_10131111	3300026067	Bacteria	2138
241	Ga0207702_10010443	3300026078	Bacteria	7766
242	Ga0207702_10010590	3300026078	Bacteria	7707
243	Ga0207702_10218656	3300026078	Bacteria	1775
244	Ga0207648_10000333	3300026089	Bacteria	51656
245	Ga0207674_10090260	3300026116	Bacteria	3055
246	Ga0207683_10003418	3300026121	Bacteria	13828
247	Ga0207698_10013453	3300026142	Bacteria	5399
248	Ga0207698_10102517	3300026142	Bacteria	2376
249	Ga0268266_10000658	3300028379	Bacteria	46741
250	Ga0307517_10012583	3300028786	Bacteria	11593
251	Ga0307515_10007084	3300028794	Bacteria	22272
252	Ga0307515_10067820	3300028794	Bacteria	4914
253	Ga0307515_10212142	3300028794	Bacteria	1777
254	Ga0307515_10315415	3300028794	Bacteria	1234
255	Ga0265338_10007954	3300028800	Bacteria	12991
256	Ga0316183_1033300	3300030742	Bacteria	31987
257	Ga0316181_1034557	3300030744	Bacteria	9867
258	Ga0316182_1296934	3300030745	Bacteria	1368
259	Ga0265327_10000370	3300031251	Bacteria	84921
260	Ga0265327_10041391	3300031251	Bacteria	2484
261	Ga0307408_100073008	3300031548	Bacteria	2541
262	Ga0307408_100134877	3300031548	Bacteria	1930
263	Ga0316576_10219645	3300031727	Bacteria	1430
264	Ga0307405_10000006	3300031731	Bacteria	361477
265	Ga0307405_10047315	3300031731	Bacteria	2648
266	Ga0307413_10054157	3300031824	Bacteria	2433
267	Ga0307407_10000003	3300031903	Bacteria	271723
268	Ga0307412_10002079	3300031911	Bacteria	11112
269	Ga0307412_10003796	3300031911	Bacteria	8399
270	Ga0307412_10041647	3300031911	Bacteria	2978
271	Ga0307412_10183233	3300031911	Bacteria	1577
272	Ga0307412_10185828	3300031911	Bacteria	1567
273	Ga0307409_100068515	3300031995	Bacteria	2807
274	Ga0307409_100104059	3300031995	Bacteria	2363
275	Ga0307416_100000002	3300032002	Bacteria	509907
276	Ga0307416_100079899	3300032002	Bacteria	2758
277	Ga0307416_100920455	3300032002	Bacteria	975
278	Ga0307414_10005329	3300032004	Bacteria	7075
279	Ga0307414_10005856	3300032004	Bacteria	6798
280	Ga0307414_10009488	3300032004	Bacteria	5593
281	Ga0307414_10012166	3300032004	Bacteria	5077
282	Ga0307414_10014141	3300032004	Bacteria	4772
283	Ga0307414_10078172	3300032004	Bacteria	2411
284	Ga0307414_10110482	3300032004	Bacteria	2091
285	Ga0307414_10163161	3300032004	Bacteria	1772
286	Ga0307414_10236098	3300032004	Bacteria	1510
287	Ga0307414_10274833	3300032004	Bacteria	1413
288	Ga0307411_10126165	3300032005	Bacteria	1862
289	Ga0307411_10296538	3300032005	Bacteria	1294
290	Ga0307507_10000034	3300033179	Bacteria	188697
291	Ga0307510_10003892	3300033180	Bacteria	17498
292	Ga0316592_1005027	3300033524	Bacteria	2492
293	Ga0316592_1045321	3300033524	Bacteria	978
294	Ga0316592_1049986	3300033524	Bacteria	933
295	Ga0316588_1035814	3300033528	Bacteria	1177
296	Ga0395899_0000021	3300037312	Bacteria	391702
297	Ga0395899_0000034	3300037312	Bacteria	302623
298	Ga0395899_0000472	3300037312	Bacteria	45477
299	Ga0395899_0000499	3300037312	Bacteria	43572
300	Ga0395899_0050121	3300037312	Bacteria	3101
301	Ga0395900_0000346	3300037418	Bacteria	68020
302	Ga0395900_0001482	3300037418	Bacteria	28015
303	Ga0395900_0199077	3300037418	Bacteria	2028
304	Ga0395898_0021701	3300037466	Bacteria	6509
305	Ga0395898_0063979	3300037466	Bacteria	3569
306	Ga0395905_0000001	3300037471	Bacteria	2037079
307	Ga0395905_0000528	3300037471	Bacteria	52404
308	Ga0395905_0002993	3300037471	Bacteria	18335
309	Ga0395905_0127136	3300037471	Bacteria	2397
310	Ga0395901_0000351	3300038443	Bacteria	56004
311	Ga0395901_0007776	3300038443	Bacteria	10816
312	Ga0436361_0433548	3300039447	Bacteria	14679
313	Ga0439448_0011844	3300042005	Bacteria	2601
314	Ga0439457_021694	3300042014	Bacteria	1424
315	Ga0451577_0061839	3300042876	Bacteria	3339
316	Ga0466969_0040631	3300044656	Bacteria	2330
317	Ga0453683_0313753	3300044673	Unclassified	1004
318	Ga0466966_0001476	3300044684	Bacteria	15131
319	Ga0466961_0160913	3300044693	Bacteria	1399
320	Ga0453684_0004131	3300044712	Bacteria	31439
321	Ga0453684_0133450	3300044712	Bacteria	2976
322	Ga0453684_0156006	3300044712	Bacteria	2706
323	Ga0453684_0162796	3300044712	Bacteria	2637
324	Ga0466959_0100874	3300045049	Bacteria	2066
325	Ga0466959_0209237	3300045049	Bacteria	1356
326	Ga0466958_0007843	3300045836	Bacteria	5897
327	Ga0495650_0000023	3300046471	Bacteria	527763
328	Ga0495585_0000476	3300046492	Bacteria	38316
329	Ga0495585_0001907	3300046492	Bacteria	15677
330	Ga0495583_0034187	3300046506	Bacteria	2438
331	Ga0495583_0105868	3300046506	Bacteria	1196
332	Ga0495606_0003554	3300046507	Bacteria	16456
333	Ga0495606_0006936	3300046507	Bacteria	10302
334	Ga0495606_0010457	3300046507	Bacteria	7698
335	Ga0495606_0049128	3300046507	Bacteria	2769
336	Ga0495606_0363794	3300046507	Bacteria	764
337	Ga0495610_0020639	3300046512	Bacteria	3652
338	Ga0495610_0044214	3300046512	Bacteria	2212
339	Ga0495616_0029922	3300046513	Bacteria	2868
340	Ga0495616_0136857	3300046513	Bacteria	1118
341	Ga0495631_0002385	3300046518	Bacteria	10650
342	Ga0495631_0076583	3300046518	Bacteria	1444
343	Ga0495637_0047921	3300046520	Bacteria	1802
344	Ga0495637_0083256	3300046520	Bacteria	1272
345	Ga0495648_0017616	3300046524	Bacteria	5097
346	Ga0495652_0121985	3300046529	Bacteria	2077
347	Ga0495609_0004523	3300046538	Bacteria	7572
348	Ga0495609_0006730	3300046538	Bacteria	5828
349	Ga0495633_0000072	3300046558	Bacteria	131197
350	Ga0495633_0016150	3300046558	Bacteria	3858
351	Ga0495633_0025488	3300046558	Bacteria	2910
352	Ga0495668_0000165	3300046616	Bacteria	98016
353	Ga0495611_0059991	3300046648	Bacteria	1728
354	Ga0495625_0000308	3300046660	Bacteria	74661
355	Ga0495625_0047299	3300046660	Bacteria	3102
356	Ga0495625_0072461	3300046660	Bacteria	2416
357	Ga0495625_0077697	3300046660	Bacteria	2318
358	Ga0495625_0137903	3300046660	Bacteria	1647
359	Ga0495625_0176714	3300046660	Bacteria	1422
360	Ga0495625_0207069	3300046660	Bacteria	1291
361	Ga0495625_0209952	3300046660	Bacteria	1280
362	Ga0495625_0289001	3300046660	Bacteria	1052
363	Ga0495661_0022092	3300046665	Bacteria	4141
364	Ga0495661_0040831	3300046665	Bacteria	2874
365	Ga0495599_0161066	3300046678	Bacteria	1387
366	Ga0495649_0000105	3300046694	Bacteria	74750
367	Ga0495649_0167431	3300046694	Bacteria	1151
368	Ga0495660_0086890	3300046810	Bacteria	1632
369	Ga0495687_000233	3300047443	Bacteria	77056
370	Ga0495673_0013740	3300047469	Bacteria	4239
371	Ga0495686_0002422	3300047472	Bacteria	17639
372	Ga0495686_0010199	3300047472	Bacteria	6696
373	Ga0495686_0092084	3300047472	Bacteria	1839
374	Ga0495686_0241084	3300047472	Bacteria	1019
375	Ga0496114_0091395	3300048917	Bacteria	2585
376	Ga0496116_0005535	3300048919	Bacteria	11653
377	Ga0496117_0001863	3300048920	Bacteria	28457
378	Ga0496118_0025644	3300048921	Bacteria	5047
379	Ga0496122_0000862	3300048925	Bacteria	57049
380	Ga0496122_0006922	3300048925	Bacteria	12808
381	Ga0496123_0013292	3300048926	Bacteria	6932
382	Ga0496123_0015001	3300048926	Bacteria	6383
383	Ga0496124_0039503	3300048927	Bacteria	4091
384	Ga0496125_0048493	3300048928	Bacteria	3541
385	Ga0496125_0134546	3300048928	Bacteria	1732
386	Ga0496126_0060412	3300048929	Bacteria	3409
387	Ga0501311_005256	3300049527	Bacteria	1412
388	Ga0501323_009281	3300049539	Bacteria	1157
389	Ga0501198_003579	3300049649	Bacteria	2128
390	Ga0501223_000581	3300049663	Bacteria	8828
391	Ga0501280_012957	3300049776	Bacteria	1175
392	nmdc:mga0k408_2228_c1	3300050493	Bacteria	10371
393	nmdc:mga0k408_22365_c1	3300050493	Bacteria	3560
394	nmdc:mga0k408_349_c1	3300050493	Bacteria	23383
395	nmdc:mga0k408_86571_c2	3300050493	Bacteria	1204
396	nmdc:mga07m45_50194_c1	3300050496	Bacteria	1975
397	Ga0500651_0000078	3300053093	Bacteria	62741
398	Ga0500608_040061	3300053122	Bacteria	2245
399	Ga0500618_000057	3300053125	Bacteria	98383
400	Ga0500618_030023	3300053125	Bacteria	1280
401	Ga0500579_100265	3300053143	Bacteria	1513
402	Ga0500622_0000385	3300053156	Bacteria	42685

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300003323	rootH1_10132210	rootH1_101322102	220
2	3300046507	Ga0495606_0363794	Ga0495606_0363794_43_741	230
3	3300049539	Ga0501323_009281	Ga0501323_009281_11_706	231
4	iso_pu_bacteria	2585427687	2586210038	238
5	iso_pu_bacteria	2738541302	2738854410	238
6	iso_pu_bacteria	2842909656	2842913597	238
7	iso_pu_bacteria	2904445276	2904449078	238
8	3300046648	Ga0495611_0059991	Ga0495611_0059991_27_755	240
9	3300003781	Ga0055536_1000004	Ga0055536_1000004118	242
10	3300005563	Ga0068855_100359969	Ga0068855_1003599692	242
11	3300015682	Ga0183373_1004	Ga0183373_100472	242
12	3300017792	Ga0163161_10098092	Ga0163161_100980921	242
13	3300025292	Ga0209676_1000009	Ga0209676_1000009435	242
14	3300025298	Ga0209050_1000048	Ga0209050_1000048231	242
15	3300025728	Ga0207655_1034651	Ga0207655_10346512	242
16	3300025949	Ga0207667_10152883	Ga0207667_101528834	242
17	3300031731	Ga0307405_10000006	Ga0307405_1000000669	242
18	3300031903	Ga0307407_10000003	Ga0307407_10000003179	242
19	3300032002	Ga0307416_100000002	Ga0307416_100000002423	242
20	3300032005	Ga0307411_10126165	Ga0307411_101261652	242
21	3300033524	Ga0316592_1049986	Ga0316592_10499861	248
22	3300013102	Ga0157371_10000041	Ga0157371_1000004115	251
23	3300049527	Ga0501311_005256	Ga0501311_005256_19_786	255
24	iso_pu_bacteria	2721755487	2722726186	256
25	iso_pu_bacteria	2890737413	2890740654	256
26	iso_pu_bacteria	2896317667	2896320829	256
27	iso_pu_bacteria	2896344016	2896346878	256
28	iso_pu_bacteria	2898713307	2898716217	256
29	iso_pu_bacteria	2904780799	2904782797	256
30	iso_pu_bacteria	2919177583	2919180407	256
31	iso_pu_bacteria	3003233435	3003234783	256
32	iso_pu_bacteria	2599185184	2599479373	257
33	iso_pu_bacteria	2738541283	2738755668	257
34	iso_pu_bacteria	2738541284	2738762115	257
35	iso_pu_bacteria	2738543023	2739301905	257
36	iso_pu_bacteria	2739367651	2739587962	257
37	iso_pu_bacteria	2739367656	2739614387	257
38	iso_pu_bacteria	2739367663	2739646681	257
39	iso_pu_bacteria	2775506987	2776615259	257
40	iso_pu_bacteria	2818991437	2819545838	257
41	iso_pu_bacteria	2842722452	2842724269	257
42	iso_pu_bacteria	2842903701	2842908287	257
43	iso_pu_bacteria	2849281842	2849282591	257
44	iso_pu_bacteria	2852623160	2852625385	257
45	iso_pu_bacteria	2852627209	2852629122	257
46	iso_pu_bacteria	2857627736	2857631660	257
47	iso_pu_bacteria	2884933994	2884934396	257
48	iso_pu_bacteria	2902048731	2902051179	257
49	iso_pu_bacteria	2919186247	2919189080	257
50	iso_pu_bacteria	2919437846	2919438026	257
51	iso_pu_bacteria	2928078545	2928082317	257
52	iso_pu_bacteria	2928147474	2928149104	257
53	iso_pu_bacteria	2932082852	2932085029	257
54	iso_pu_bacteria	2939664404	2939666765	257
55	iso_pu_bacteria	2945997725	2945998908	257
56	iso_pu_bacteria	2954016120	2954021351	257
57	iso_pu_bacteria	2977232053	2977235862	257
58	3300006195	Ga0075366_10204183	Ga0075366_102041832	258
59	3300013307	Ga0157372_10037880	Ga0157372_100378805	258
60	3300020069	Ga0197907_11036902	Ga0197907_110369023	258
61	3300020077	Ga0206351_10512829	Ga0206351_105128297	258
62	3300020610	Ga0154015_1037437	Ga0154015_10374377	258
63	3300025250	Ga0209026_1000610	Ga0209026_100061028	258
64	3300031727	Ga0316576_10219645	Ga0316576_102196452	258
65	3300033524	Ga0316592_1005027	Ga0316592_10050273	258
66	3300033524	Ga0316592_1045321	Ga0316592_10453212	258
67	3300033528	Ga0316588_1035814	Ga0316588_10358142	258
68	3300050493	nmdc:mga0k408_86571_c2	nmdc:mga0k408_86571_c2_359_1135	258
69	3300005262	Ga0065165_1000831	Ga0065165_100083128	259
70	3300005365	Ga0070688_100073921	Ga0070688_1000739213	259
71	3300005466	Ga0070685_10093213	Ga0070685_100932131	259
72	3300013297	Ga0157378_10186521	Ga0157378_101865211	259
73	3300013308	Ga0157375_10369293	Ga0157375_103692933	259
74	3300014325	Ga0163163_10277413	Ga0163163_102774133	259
75	3300014969	Ga0157376_10436747	Ga0157376_104367472	259
76	3300031251	Ga0265327_10000370	Ga0265327_1000037051	259
77	3300037312	Ga0395899_0000021	Ga0395899_0000021_251827_252621	259
78	3300044673	Ga0453683_0313753	Ga0453683_0313753_63_845	259
79	3300044712	Ga0453684_0004131	Ga0453684_0004131_24344_25135	259
80	3300044712	Ga0453684_0133450	Ga0453684_0133450_1518_2309	259
81	3300044712	Ga0453684_0162796	Ga0453684_0162796_1488_2276	259
82	3300003320	rootH2_10040379	rootH2_100403792	260
83	3300005289	Ga0065704_10075644	Ga0065704_100756443	260
84	3300005535	Ga0070684_100167813	Ga0070684_1001678132	260
85	3300005834	Ga0068851_10000177	Ga0068851_100001773	260
86	3300006195	Ga0075366_10000288	Ga0075366_1000028818	260
87	3300009094	Ga0111539_10616286	Ga0111539_106162862	260
88	3300009148	Ga0105243_10000009	Ga0105243_10000009220	260
89	3300013100	Ga0157373_10000129	Ga0157373_1000012951	260
90	3300013102	Ga0157371_10035324	Ga0157371_100353244	260
91	3300013307	Ga0157372_10000332	Ga0157372_1000033214	260
92	3300013307	Ga0157372_10003430	Ga0157372_100034309	260
93	3300025321	Ga0207656_10002394	Ga0207656_1000239411	260
94	3300025935	Ga0207709_10000026	Ga0207709_10000026221	260
95	3300032004	Ga0307414_10009488	Ga0307414_100094886	260
96	3300032004	Ga0307414_10274833	Ga0307414_102748331	260
97	3300037471	Ga0395905_0000001	Ga0395905_0000001_264619_265404	260
98	3300046660	Ga0495625_0072461	Ga0495625_0072461_974_1756	260
99	3300048919	Ga0496116_0005535	Ga0496116_0005535_6900_7682	260
100	3300048920	Ga0496117_0001863	Ga0496117_0001863_14912_15694	260
101	3300048921	Ga0496118_0025644	Ga0496118_0025644_2369_3151	260
102	3300048925	Ga0496122_0006922	Ga0496122_0006922_1105_1887	260
103	3300048926	Ga0496123_0013292	Ga0496123_0013292_4236_5018	260
104	3300048927	Ga0496124_0039503	Ga0496124_0039503_2982_3764	260
105	3300048928	Ga0496125_0134546	Ga0496125_0134546_895_1677	260
106	3300048929	Ga0496126_0060412	Ga0496126_0060412_1590_2372	260
107	3300050493	nmdc:mga0k408_2228_c1	nmdc:mga0k408_2228_c1_7694_8476	260
108	3300053156	Ga0500622_0000385	Ga0500622_0000385_29399_30181	260
109	2162886007	SwRhRL2b_contig_1197142	SwRhRL2b_0319.00000410	261
110	3300001979	JGI24740J21852_10008913	JGI24740J21852_100089137	261
111	3300001990	JGI24737J22298_10001860	JGI24737J22298_100018606	261
112	3300001990	JGI24737J22298_10007583	JGI24737J22298_100075837	261
113	3300002067	JGI24735J21928_10000003	JGI24735J21928_10000003356	261
114	3300002737	JGI25162J39368_1000039	JGI25162J39368_1000039101	261
115	3300002737	JGI25162J39368_1001202	JGI25162J39368_100120215	261
116	3300002772	JGI25164J39214_1001166	JGI25164J39214_10011662	261
117	3300002773	JGI25152J39213_1000006	JGI25152J39213_100000624	261
118	3300002774	JGI25150J39212_1000005	JGI25150J39212_1000005209	261
119	3300003187	JGI25151J46595_10000004	JGI25151J46595_10000004377	261
120	3300003214	JGI25165J46597_1000678	JGI25165J46597_10006789	261
121	3300003215	JGI25153J46596_10000004	JGI25153J46596_10000004377	261
122	3300003316	rootH1_10027299	rootH1_100272999	261
123	3300003320	rootH2_10026380	rootH2_1002638012	261
124	3300003320	rootH2_10026382	rootH2_100263822	261
125	3300003323	rootH1_10006680	rootH1_100066804	261
126	3300003323	rootH1_10018837	rootH1_100188372	261
127	3300003791	Ga0055530_10000817	Ga0055530_1000081710	261
128	3300004799	Ga0058863_10160658	Ga0058863_1016065821	261
129	3300005288	Ga0065714_10002624	Ga0065714_1000262424	261
130	3300005288	Ga0065714_10009709	Ga0065714_100097092	261
131	3300005288	Ga0065714_10083802	Ga0065714_100838021	261
132	3300005288	Ga0065714_10087799	Ga0065714_100877992	261
133	3300005288	Ga0065714_10190290	Ga0065714_101902901	261
134	3300005288	Ga0065714_10226071	Ga0065714_102260711	261
135	3300005289	Ga0065704_10000307	Ga0065704_1000030733	261
136	3300005327	Ga0070658_10000153	Ga0070658_1000015317	261
137	3300005327	Ga0070658_10090878	Ga0070658_100908781	261
138	3300005327	Ga0070658_10140676	Ga0070658_101406762	261
139	3300005327	Ga0070658_10259438	Ga0070658_102594382	261
140	3300005328	Ga0070676_10000312	Ga0070676_1000031224	261
141	3300005336	Ga0070680_100005676	Ga0070680_1000056768	261
142	3300005339	Ga0070660_100047075	Ga0070660_1000470755	261
143	3300005339	Ga0070660_100053292	Ga0070660_1000532924	261
144	3300005339	Ga0070660_100341644	Ga0070660_1003416442	261
145	3300005341	Ga0070691_10023134	Ga0070691_100231342	261
146	3300005366	Ga0070659_100000375	Ga0070659_10000037517	261
147	3300005366	Ga0070659_100017452	Ga0070659_1000174525	261
148	3300005455	Ga0070663_100101524	Ga0070663_1001015242	261
149	3300005456	Ga0070678_100001208	Ga0070678_10000120824	261
150	3300005457	Ga0070662_100000074	Ga0070662_10000007410	261
151	3300005458	Ga0070681_10002985	Ga0070681_1000298515	261
152	3300005459	Ga0068867_100010877	Ga0068867_1000108777	261
153	3300005530	Ga0070679_100006255	Ga0070679_10000625510	261
154	3300005539	Ga0068853_100058721	Ga0068853_1000587213	261
155	3300005539	Ga0068853_100090362	Ga0068853_1000903622	261
156	3300005543	Ga0070672_100092632	Ga0070672_1000926321	261
157	3300005548	Ga0070665_100000372	Ga0070665_10000037230	261
158	3300005563	Ga0068855_100000360	Ga0068855_10000036031	261
159	3300005563	Ga0068855_100012268	Ga0068855_10001226812	261
160	3300005563	Ga0068855_100071470	Ga0068855_1000714706	261
161	3300005563	Ga0068855_100527471	Ga0068855_1005274712	261
162	3300005577	Ga0068857_100112855	Ga0068857_1001128553	261
163	3300005614	Ga0068856_100004718	Ga0068856_10000471811	261
164	3300005614	Ga0068856_100016148	Ga0068856_1000161485	261
165	3300005614	Ga0068856_100230141	Ga0068856_1002301412	261
166	3300005616	Ga0068852_100010466	Ga0068852_10001046610	261
167	3300005616	Ga0068852_100399350	Ga0068852_1003993502	261
168	3300005842	Ga0068858_100127549	Ga0068858_1001275494	261
169	3300006195	Ga0075366_10000284	Ga0075366_1000028432	261
170	3300006237	Ga0097621_100007799	Ga0097621_10000779912	261
171	3300006353	Ga0075370_10027039	Ga0075370_100270395	261
172	3300006358	Ga0068871_100000141	Ga0068871_10000014116	261
173	3300006881	Ga0068865_100000917	Ga0068865_10000091712	261
174	3300009036	Ga0105244_10015827	Ga0105244_100158273	261
175	3300009093	Ga0105240_10000082	Ga0105240_100000828	261
176	3300009093	Ga0105240_10110375	Ga0105240_101103755	261
177	3300009093	Ga0105240_10237431	Ga0105240_102374315	261
178	3300009093	Ga0105240_10387298	Ga0105240_103872981	261
179	3300009176	Ga0105242_10089716	Ga0105242_100897163	261
180	3300009545	Ga0105237_10000794	Ga0105237_100007942	261
181	3300009545	Ga0105237_10002553	Ga0105237_1000255332	261
182	3300009545	Ga0105237_10006510	Ga0105237_100065103	261
183	3300009545	Ga0105237_10015313	Ga0105237_1001531310	261
184	3300009545	Ga0105237_10015662	Ga0105237_100156627	261
185	3300009545	Ga0105237_10071252	Ga0105237_100712526	261
186	3300009545	Ga0105237_10143356	Ga0105237_101433562	261
187	3300009545	Ga0105237_10221628	Ga0105237_102216282	261
188	3300009551	Ga0105238_10017754	Ga0105238_1001775410	261
189	3300009551	Ga0105238_10369988	Ga0105238_103699882	261
190	3300009553	Ga0105249_10426658	Ga0105249_104266582	261
191	3300010375	Ga0105239_10000011	Ga0105239_10000011116	261
192	3300010375	Ga0105239_10015682	Ga0105239_100156828	261
193	3300010375	Ga0105239_10075656	Ga0105239_100756563	261
194	3300010375	Ga0105239_10150240	Ga0105239_101502403	261
195	3300010375	Ga0105239_10190824	Ga0105239_101908242	261
196	3300010375	Ga0105239_10356241	Ga0105239_103562413	261
197	3300010375	Ga0105239_10436481	Ga0105239_104364812	261
198	3300013100	Ga0157373_10001033	Ga0157373_1000103319	261
199	3300013100	Ga0157373_10009996	Ga0157373_100099962	261
200	3300013100	Ga0157373_10028999	Ga0157373_100289997	261
201	3300013100	Ga0157373_10048319	Ga0157373_100483193	261
202	3300013100	Ga0157373_10077078	Ga0157373_100770782	261
203	3300013102	Ga0157371_10001664	Ga0157371_1000166414	261
204	3300013102	Ga0157371_10003367	Ga0157371_100033674	261
205	3300013102	Ga0157371_10021684	Ga0157371_100216847	261
206	3300013102	Ga0157371_10033811	Ga0157371_100338112	261
207	3300013104	Ga0157370_10012207	Ga0157370_100122079	261
208	3300013104	Ga0157370_10014051	Ga0157370_100140519	261
209	3300013104	Ga0157370_10019720	Ga0157370_1001972010	261
210	3300013104	Ga0157370_10060489	Ga0157370_100604893	261
211	3300013104	Ga0157370_10061379	Ga0157370_100613794	261
212	3300013104	Ga0157370_10084704	Ga0157370_100847043	261
213	3300013104	Ga0157370_10134256	Ga0157370_101342565	261
214	3300013104	Ga0157370_10333493	Ga0157370_103334932	261
215	3300013105	Ga0157369_10000016	Ga0157369_10000016225	261
216	3300013105	Ga0157369_10004050	Ga0157369_1000405027	261
217	3300013105	Ga0157369_10122617	Ga0157369_101226175	261
218	3300013105	Ga0157369_10294778	Ga0157369_102947782	261
219	3300013105	Ga0157369_10393357	Ga0157369_103933572	261
220	3300013296	Ga0157374_10030641	Ga0157374_100306416	261
221	3300013296	Ga0157374_10077301	Ga0157374_100773012	261
222	3300013297	Ga0157378_10008303	Ga0157378_1000830310	261
223	3300013297	Ga0157378_10060889	Ga0157378_100608895	261
224	3300013297	Ga0157378_10629553	Ga0157378_106295532	261
225	3300013306	Ga0163162_10001202	Ga0163162_1000120234	261
226	3300013306	Ga0163162_10044820	Ga0163162_100448206	261
227	3300013306	Ga0163162_10070743	Ga0163162_100707435	261
228	3300013306	Ga0163162_10339588	Ga0163162_103395884	261
229	3300013307	Ga0157372_10000030	Ga0157372_1000003015	261
230	3300013307	Ga0157372_10001364	Ga0157372_1000136422	261
231	3300013307	Ga0157372_10011651	Ga0157372_1001165116	261
232	3300013307	Ga0157372_10086212	Ga0157372_100862123	261
233	3300013307	Ga0157372_10123218	Ga0157372_101232182	261
234	3300013308	Ga0157375_10022074	Ga0157375_100220749	261
235	3300013308	Ga0157375_10081872	Ga0157375_100818723	261
236	3300013308	Ga0157375_10187566	Ga0157375_101875662	261
237	3300014326	Ga0157380_10004578	Ga0157380_100045788	261
238	3300014497	Ga0182008_10000034	Ga0182008_1000003413	261
239	3300014497	Ga0182008_10000600	Ga0182008_1000060037	261
240	3300014497	Ga0182008_10003643	Ga0182008_1000364312	261
241	3300014745	Ga0157377_10134890	Ga0157377_101348902	261
242	3300015261	Ga0182006_1000103	Ga0182006_100010376	261
243	3300015261	Ga0182006_1006389	Ga0182006_10063895	261
244	3300015261	Ga0182006_1008481	Ga0182006_10084812	261
245	3300015261	Ga0182006_1020413	Ga0182006_10204132	261
246	3300015261	Ga0182006_1032340	Ga0182006_10323402	261
247	3300015262	Ga0182007_10000002	Ga0182007_10000002424	261
248	3300015262	Ga0182007_10005771	Ga0182007_100057712	261
249	3300017792	Ga0163161_10013535	Ga0163161_1001353510	261
250	3300017792	Ga0163161_10044157	Ga0163161_100441572	261
251	3300017792	Ga0163161_10050338	Ga0163161_100503382	261
252	3300017792	Ga0163161_10087977	Ga0163161_100879773	261
253	3300017792	Ga0163161_10347618	Ga0163161_103476181	261
254	3300020077	Ga0206351_10267476	Ga0206351_102674768	261
255	3300020610	Ga0154015_1495562	Ga0154015_14955622	261
256	3300021361	Ga0213872_10006418	Ga0213872_1000641810	261
257	3300025231	Ga0207427_100025	Ga0207427_100025318	261
258	3300025233	Ga0209437_100010	Ga0209437_100010580	261
259	3300025233	Ga0209437_100135	Ga0209437_10013580	261
260	3300025245	Ga0207425_1000008	Ga0207425_100000861	261
261	3300025250	Ga0209026_1004500	Ga0209026_10045007	261
262	3300025258	Ga0209129_1000040	Ga0209129_1000040204	261
263	3300025261	Ga0209233_1000017	Ga0209233_1000017593	261
264	3300025261	Ga0209233_1001079	Ga0209233_100107914	261
265	3300025272	Ga0209455_1001879	Ga0209455_10018795	261
266	3300025294	Ga0209025_1000020	Ga0209025_100002061	261
267	3300025297	Ga0209758_1000022	Ga0209758_100002261	261
268	3300025904	Ga0207647_10000171	Ga0207647_1000017134	261
269	3300025904	Ga0207647_10022536	Ga0207647_100225365	261
270	3300025904	Ga0207647_10032931	Ga0207647_100329312	261
271	3300025907	Ga0207645_10000035	Ga0207645_1000003565	261
272	3300025909	Ga0207705_10000108	Ga0207705_1000010895	261
273	3300025911	Ga0207654_10034290	Ga0207654_100342904	261
274	3300025911	Ga0207654_10138162	Ga0207654_101381622	261
275	3300025912	Ga0207707_10032972	Ga0207707_100329726	261
276	3300025913	Ga0207695_10000053	Ga0207695_10000053343	261
277	3300025913	Ga0207695_10039657	Ga0207695_100396577	261
278	3300025913	Ga0207695_10057771	Ga0207695_100577715	261
279	3300025913	Ga0207695_10080728	Ga0207695_100807281	261
280	3300025913	Ga0207695_10501005	Ga0207695_105010052	261
281	3300025913	Ga0207695_10611693	Ga0207695_106116931	261
282	3300025914	Ga0207671_10005849	Ga0207671_1000584916	261
283	3300025914	Ga0207671_10011776	Ga0207671_100117768	261
284	3300025914	Ga0207671_10013363	Ga0207671_100133637	261
285	3300025914	Ga0207671_10014424	Ga0207671_1001442410	261
286	3300025914	Ga0207671_10018120	Ga0207671_100181208	261
287	3300025914	Ga0207671_10034795	Ga0207671_100347952	261
288	3300025914	Ga0207671_10053614	Ga0207671_100536143	261
289	3300025914	Ga0207671_10129273	Ga0207671_101292732	261
290	3300025917	Ga0207660_10024307	Ga0207660_100243075	261
291	3300025919	Ga0207657_10023513	Ga0207657_1002351310	261
292	3300025919	Ga0207657_10058573	Ga0207657_100585732	261
293	3300025919	Ga0207657_10280514	Ga0207657_102805143	261
294	3300025919	Ga0207657_10316176	Ga0207657_103161761	261
295	3300025921	Ga0207652_10002419	Ga0207652_100024198	261
296	3300025924	Ga0207694_10009649	Ga0207694_1000964911	261
297	3300025924	Ga0207694_10042226	Ga0207694_100422262	261
298	3300025931	Ga0207644_10013551	Ga0207644_100135518	261
299	3300025932	Ga0207690_10000936	Ga0207690_1000093617	261
300	3300025932	Ga0207690_10005948	Ga0207690_100059487	261
301	3300025933	Ga0207706_10019009	Ga0207706_100190094	261
302	3300025938	Ga0207704_10000036	Ga0207704_1000003665	261
303	3300025949	Ga0207667_10000430	Ga0207667_1000043031	261
304	3300025949	Ga0207667_10023666	Ga0207667_1002366611	261
305	3300025949	Ga0207667_10041900	Ga0207667_100419007	261
306	3300025949	Ga0207667_10076563	Ga0207667_100765635	261
307	3300025960	Ga0207651_10009416	Ga0207651_100094167	261
308	3300026023	Ga0207677_10112728	Ga0207677_101127284	261
309	3300026041	Ga0207639_10030197	Ga0207639_100301975	261
310	3300026041	Ga0207639_10034930	Ga0207639_100349301	261
311	3300026041	Ga0207639_10131675	Ga0207639_101316752	261
312	3300026067	Ga0207678_10131111	Ga0207678_101311114	261
313	3300026078	Ga0207702_10010443	Ga0207702_1001044312	261
314	3300026078	Ga0207702_10010590	Ga0207702_100105902	261
315	3300026078	Ga0207702_10218656	Ga0207702_102186564	261
316	3300026089	Ga0207648_10000333	Ga0207648_1000033323	261
317	3300026116	Ga0207674_10090260	Ga0207674_100902604	261
318	3300026121	Ga0207683_10003418	Ga0207683_100034185	261
319	3300026142	Ga0207698_10013453	Ga0207698_100134536	261
320	3300026142	Ga0207698_10102517	Ga0207698_101025174	261
321	3300028379	Ga0268266_10000658	Ga0268266_1000065830	261
322	3300028786	Ga0307517_10012583	Ga0307517_100125837	261
323	3300028794	Ga0307515_10007084	Ga0307515_1000708427	261
324	3300028794	Ga0307515_10067820	Ga0307515_100678202	261
325	3300028794	Ga0307515_10212142	Ga0307515_102121421	261
326	3300028794	Ga0307515_10315415	Ga0307515_103154152	261
327	3300028800	Ga0265338_10007954	Ga0265338_1000795417	261
328	3300030742	Ga0316183_1033300	Ga0316183_103330016	261
329	3300030744	Ga0316181_1034557	Ga0316181_10345577	261
330	3300030745	Ga0316182_1296934	Ga0316182_12969342	261
331	3300031251	Ga0265327_10041391	Ga0265327_100413912	261
332	3300031548	Ga0307408_100073008	Ga0307408_1000730082	261
333	3300031548	Ga0307408_100134877	Ga0307408_1001348772	261
334	3300031731	Ga0307405_10047315	Ga0307405_100473152	261
335	3300031824	Ga0307413_10054157	Ga0307413_100541572	261
336	3300031911	Ga0307412_10002079	Ga0307412_100020797	261
337	3300031911	Ga0307412_10003796	Ga0307412_100037962	261
338	3300031911	Ga0307412_10041647	Ga0307412_100416472	261
339	3300031911	Ga0307412_10183233	Ga0307412_101832332	261
340	3300031911	Ga0307412_10185828	Ga0307412_101858281	261
341	3300031995	Ga0307409_100068515	Ga0307409_1000685155	261
342	3300031995	Ga0307409_100104059	Ga0307409_1001040593	261
343	3300032002	Ga0307416_100079899	Ga0307416_1000798992	261
344	3300032002	Ga0307416_100920455	Ga0307416_1009204552	261
345	3300032004	Ga0307414_10005329	Ga0307414_100053297	261
346	3300032004	Ga0307414_10005856	Ga0307414_100058567	261
347	3300032004	Ga0307414_10012166	Ga0307414_100121665	261
348	3300032004	Ga0307414_10014141	Ga0307414_100141417	261
349	3300032004	Ga0307414_10078172	Ga0307414_100781722	261
350	3300032004	Ga0307414_10110482	Ga0307414_101104824	261
351	3300032004	Ga0307414_10163161	Ga0307414_101631613	261
352	3300032004	Ga0307414_10236098	Ga0307414_102360982	261
353	3300032005	Ga0307411_10296538	Ga0307411_102965381	261
354	3300033179	Ga0307507_10000034	Ga0307507_10000034121	261
355	3300033180	Ga0307510_10003892	Ga0307510_1000389215	261
356	3300037312	Ga0395899_0000034	Ga0395899_0000034_30378_31169	261
357	3300037312	Ga0395899_0000472	Ga0395899_0000472_40676_41464	261
358	3300037312	Ga0395899_0000499	Ga0395899_0000499_40533_41321	261
359	3300037312	Ga0395899_0050121	Ga0395899_0050121_1398_2189	261
360	3300037418	Ga0395900_0000346	Ga0395900_0000346_44048_44836	261
361	3300037418	Ga0395900_0001482	Ga0395900_0001482_27004_27795	261
362	3300037418	Ga0395900_0199077	Ga0395900_0199077_1058_1846	261
363	3300037466	Ga0395898_0021701	Ga0395898_0021701_2948_3736	261
364	3300037466	Ga0395898_0063979	Ga0395898_0063979_763_1554	261
365	3300037471	Ga0395905_0000528	Ga0395905_0000528_23168_23956	261
366	3300037471	Ga0395905_0002993	Ga0395905_0002993_9644_10435	261
367	3300037471	Ga0395905_0127136	Ga0395905_0127136_167_955	261
368	3300038443	Ga0395901_0000351	Ga0395901_0000351_22669_23457	261
369	3300038443	Ga0395901_0007776	Ga0395901_0007776_5641_6432	261
370	3300039447	Ga0436361_0433548	Ga0436361_0433548_4871_5662	261
371	3300042005	Ga0439448_0011844	Ga0439448_0011844_1415_2203	261
372	3300042014	Ga0439457_021694	Ga0439457_021694_582_1367	261
373	3300042876	Ga0451577_0061839	Ga0451577_0061839_1215_2051	261
374	3300044656	Ga0466969_0040631	Ga0466969_0040631_1264_2052	261
375	3300044684	Ga0466966_0001476	Ga0466966_0001476_10955_11743	261
376	3300044693	Ga0466961_0160913	Ga0466961_0160913_223_1011	261
377	3300044712	Ga0453684_0156006	Ga0453684_0156006_67_903	261
378	3300045049	Ga0466959_0100874	Ga0466959_0100874_1080_1871	261
379	3300045049	Ga0466959_0209237	Ga0466959_0209237_212_1000	261
380	3300045836	Ga0466958_0007843	Ga0466958_0007843_3742_4530	261
381	3300046471	Ga0495650_0000023	Ga0495650_0000023_59563_60354	261
382	3300046492	Ga0495585_0000476	Ga0495585_0000476_34613_35404	261
383	3300046492	Ga0495585_0001907	Ga0495585_0001907_11074_11865	261
384	3300046506	Ga0495583_0034187	Ga0495583_0034187_370_1161	261
385	3300046506	Ga0495583_0105868	Ga0495583_0105868_294_1085	261
386	3300046507	Ga0495606_0003554	Ga0495606_0003554_3548_4339	261
387	3300046507	Ga0495606_0006936	Ga0495606_0006936_1393_2178	261
388	3300046507	Ga0495606_0010457	Ga0495606_0010457_148_933	261
389	3300046507	Ga0495606_0049128	Ga0495606_0049128_1740_2531	261
390	3300046512	Ga0495610_0020639	Ga0495610_0020639_1515_2300	261
391	3300046512	Ga0495610_0044214	Ga0495610_0044214_371_1156	261
392	3300046513	Ga0495616_0029922	Ga0495616_0029922_1939_2730	261
393	3300046513	Ga0495616_0136857	Ga0495616_0136857_53_844	261
394	3300046518	Ga0495631_0002385	Ga0495631_0002385_3108_3899	261
395	3300046518	Ga0495631_0076583	Ga0495631_0076583_620_1411	261
396	3300046520	Ga0495637_0047921	Ga0495637_0047921_979_1764	261
397	3300046520	Ga0495637_0083256	Ga0495637_0083256_98_889	261
398	3300046524	Ga0495648_0017616	Ga0495648_0017616_2210_3001	261
399	3300046529	Ga0495652_0121985	Ga0495652_0121985_115_906	261
400	3300046538	Ga0495609_0004523	Ga0495609_0004523_1070_1861	261
401	3300046538	Ga0495609_0006730	Ga0495609_0006730_2363_3154	261
402	3300046558	Ga0495633_0000072	Ga0495633_0000072_82575_83366	261
403	3300046558	Ga0495633_0016150	Ga0495633_0016150_961_1746	261
404	3300046558	Ga0495633_0025488	Ga0495633_0025488_911_1702	261
405	3300046616	Ga0495668_0000165	Ga0495668_0000165_5979_6770	261
406	3300046660	Ga0495625_0000308	Ga0495625_0000308_12023_12814	261
407	3300046660	Ga0495625_0047299	Ga0495625_0047299_509_1300	261
408	3300046660	Ga0495625_0077697	Ga0495625_0077697_982_1773	261
409	3300046660	Ga0495625_0137903	Ga0495625_0137903_80_871	261
410	3300046660	Ga0495625_0176714	Ga0495625_0176714_24_815	261
411	3300046660	Ga0495625_0207069	Ga0495625_0207069_37_828	261
412	3300046660	Ga0495625_0209952	Ga0495625_0209952_24_815	261
413	3300046660	Ga0495625_0289001	Ga0495625_0289001_141_932	261
414	3300046665	Ga0495661_0022092	Ga0495661_0022092_1146_1937	261
415	3300046665	Ga0495661_0040831	Ga0495661_0040831_1021_1812	261
416	3300046678	Ga0495599_0161066	Ga0495599_0161066_268_1059	261
417	3300046694	Ga0495649_0000105	Ga0495649_0000105_61938_62729	261
418	3300046694	Ga0495649_0167431	Ga0495649_0167431_287_1078	261
419	3300046810	Ga0495660_0086890	Ga0495660_0086890_71_862	261
420	3300047443	Ga0495687_000233	Ga0495687_000233_60097_60888	261
421	3300047469	Ga0495673_0013740	Ga0495673_0013740_883_1674	261
422	3300047472	Ga0495686_0002422	Ga0495686_0002422_11583_12371	261
423	3300047472	Ga0495686_0010199	Ga0495686_0010199_2218_3009	261
424	3300047472	Ga0495686_0092084	Ga0495686_0092084_295_1086	261
425	3300047472	Ga0495686_0241084	Ga0495686_0241084_141_932	261
426	3300048917	Ga0496114_0091395	Ga0496114_0091395_84_869	261
427	3300048925	Ga0496122_0000862	Ga0496122_0000862_27290_28078	261
428	3300048926	Ga0496123_0015001	Ga0496123_0015001_1765_2553	261
429	3300048928	Ga0496125_0048493	Ga0496125_0048493_1679_2467	261
430	3300049649	Ga0501198_003579	Ga0501198_003579_975_1760	261
431	3300049663	Ga0501223_000581	Ga0501223_000581_6769_7554	261
432	3300049776	Ga0501280_012957	Ga0501280_012957_102_887	261
433	3300050493	nmdc:mga0k408_22365_c1	nmdc:mga0k408_22365_c1_653_1444	261
434	3300050493	nmdc:mga0k408_349_c1	nmdc:mga0k408_349_c1_22141_22932	261
435	3300050496	nmdc:mga07m45_50194_c1	nmdc:mga07m45_50194_c1_108_899	261
436	3300053093	Ga0500651_0000078	Ga0500651_0000078_17291_18076	261
437	3300053122	Ga0500608_040061	Ga0500608_040061_115_906	261
438	3300053125	Ga0500618_000057	Ga0500618_000057_2536_3327	261
439	3300053125	Ga0500618_030023	Ga0500618_030023_65_856	261
440	3300053143	Ga0500579_100265	Ga0500579_100265_496_1287	261

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00557

Peptidase_M24

Metallopeptidase family M24

16

249

0.9 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
4juq-assembly1.cif.gz_A	pseudomonas aeruginosa metap t2n mutant, in mn form	0.9884	3	251
3tb5-assembly2.cif.gz_B	crystal structure of the enterococcus faecalis methionine aminopeptidase apo form	0.9838	3	250
1o0x-assembly1.cif.gz_A	crystal structure of methionine aminopeptidase (tm1478) from thermotoga maritima at 1.90 a resolution	0.9804	3	249
8bqx-assembly1.cif.gz_x	yeast 80s ribosome in complex with map1 (conformation 2)	0.977	3	249
2b3k-assembly1.cif.gz_A	crystal structure of human methionine aminopeptidase type i in the holo form	0.9749	1	249

ID	Description	Score	Start	End	Superfamily
4juqD00	Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily	0.9875	3	249	3.90.230.10
af_I1J6Q1_1_201_3.90.230.10	Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily	0.9812	50	249	3.90.230.10
af_Q6Z3V9_1_121_3.90.230.10	Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily	0.981	16	126	3.90.230.10
1o0xA00	Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily	0.9804	3	249	3.90.230.10
af_Q4VBS4_53_336_3.90.230.10	Alpha Beta;Alpha-Beta Complex;Creatine Amidinohydrolase;Creatinase/methionine aminopeptidase superfamily	0.978	3	249	3.90.230.10

ID	Description	Score	Start	End	GO Terms
AF-A6EHP3-F1-model_v4	Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M)	1.002	25	261	GO:0004239 GO:0005829 GO:0006508 GO:0046872 GO:0070006
AF-A0A317EX38-F1-model_v4	Methionine aminopeptidase (MAP) (MetAP) (EC 3.4.11.18) (Peptidase M)	0.9981	3	259	GO:0004239 GO:0005829 GO:0006508 GO:0046872 GO:0070006
AF-A0A4Q3Q0Z2-F1-model_v4	deleted	0.9976	69	256
AF-A0A661YHV2-F1-model_v4	deleted	0.9965	3	224
AF-A0A356ZCU1-F1-model_v4	Type I methionyl aminopeptidase	0.9956	85	190	GO:0005829 GO:0006508 GO:0070006

Feature Viewer

pLDDT	pTM	Quality
97.81	0.94	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F444476

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00557

Peptidase_M24

Metallopeptidase family M24

16

249

0.9

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map