F444431

General Info

Members Datasets Scaffolds Average Seq Length
440 239 880 136

Family's Representative Sequence

Representative Sequence 3300015262|Ga0182007_10016602|Ga0182007_100166023
Length 166
Sequence MLLRRFTSILSCCLVGARTAPGLTSEGITMTNPSAVALTGFIAWALLLLVLMEIIRTQLVLRGKIPANGFVPDNANLSPFMQRLARAHANCIESLPVFGGLLLLAIITGHTSVTDPAAYLFLACRVFQSLVHLASVSAAAVTVRFSAFAVQMAIGVYWAVGLLAVV

Samples

Sample ID Description Type Environment
1 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
9 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
99 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
102 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
165 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
166 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
167 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
173 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
174 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
175 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
176 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
184 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
185 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
186 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
187 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
188 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
189 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
190 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
191 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
195 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
196 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
197 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
198 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
204 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
205 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
206 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
212 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
226 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
232 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
233 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
236 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
237 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
239 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.18
Metatranscriptomes 1.36
Isolates 0.45

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.36
Nodule 0.23
Rhizoplane 3.18
Rhizosphere 91.82
Stem 0
Stem Tuber 0
Unclassified 11.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182007_10016602 3300015262 Bacteria 2713
2 JGI24741J21665_1001269 3300001915 Bacteria 7414
3 JGI24740J21852_10004958 3300001979 Bacteria 5660
4 JGI24743J22301_10102345 3300001991 Bacteria 618
5 JGI24735J21928_10054887 3300002067 Unclassified 1148
6 JGI25157J39369_1000987 3300002741 Bacteria 13315
7 JGI25157J39369_1004340 3300002741 Bacteria 2607
8 rootH1_10076101 3300003323 Bacteria 3634
9 Ga0055529_1001571 3300003763 Bacteria 6393
10 Ga0058862_11742014 3300004803 Bacteria 805
11 Ga0065715_10389425 3300005293 Bacteria 896
12 Ga0065715_10684798 3300005293 Unclassified 661
13 Ga0070658_10090940 3300005327 Bacteria 2515
14 Ga0070658_10115881 3300005327 Bacteria 2223
15 Ga0070676_10007998 3300005328 Bacteria 5685
16 Ga0070676_10052660 3300005328 Bacteria 2394
17 Ga0070676_10053786 3300005328 Bacteria 2372
18 Ga0070676_10336177 3300005328 Bacteria 1034
19 Ga0070683_100385385 3300005329 Bacteria 1336
20 Ga0070690_100040558 3300005330 Bacteria 2944
21 Ga0070690_100190608 3300005330 Unclassified 1421
22 Ga0070670_100051282 3300005331 Bacteria 3544
23 Ga0070670_100179432 3300005331 Bacteria 1838
24 Ga0068869_100054811 3300005334 Bacteria 2904
25 Ga0070666_10134821 3300005335 Bacteria 1717
26 Ga0070680_100018747 3300005336 Bacteria 5475
27 Ga0070680_100099698 3300005336 Bacteria 2411
28 Ga0070680_100229583 3300005336 Unclassified 1567
29 Ga0070680_100558997 3300005336 Bacteria 981
30 Ga0070680_100709261 3300005336 Unclassified 866
31 Ga0070682_100066912 3300005337 Bacteria 2287
32 Ga0070682_100086788 3300005337 Bacteria 2038
33 Ga0070682_100599513 3300005337 Bacteria 870
34 Ga0068868_100078915 3300005338 Bacteria 2636
35 Ga0068868_100134810 3300005338 Unclassified 2023
36 Ga0070660_100041825 3300005339 Bacteria 3495
37 Ga0070689_100035116 3300005340 Bacteria 3829
38 Ga0070661_100196570 3300005344 Bacteria 1540
39 Ga0070661_100219210 3300005344 Unclassified 1459
40 Ga0070692_11088595 3300005345 Unclassified 563
41 Ga0070668_100685427 3300005347 Bacteria 903
42 Ga0070669_100010770 3300005353 Bacteria 6491
43 Ga0070669_100198387 3300005353 Bacteria 1578
44 Ga0070675_100016329 3300005354 Bacteria 5890
45 Ga0070675_100198262 3300005354 Unclassified 1742
46 Ga0070675_101119398 3300005354 Bacteria 724
47 Ga0070671_100008984 3300005355 Bacteria 8021
48 Ga0070671_100011557 3300005355 Bacteria 7101
49 Ga0070671_100873020 3300005355 Bacteria 785
50 Ga0070673_100008166 3300005364 Bacteria 6946
51 Ga0070673_100111071 3300005364 Unclassified 2273
52 Ga0070688_100731699 3300005365 Bacteria 769
53 Ga0070659_100002053 3300005366 Bacteria 14376
54 Ga0070659_100086352 3300005366 Bacteria 2510
55 Ga0070659_100245595 3300005366 Bacteria 1482
56 Ga0070659_100886360 3300005366 Unclassified 779
57 Ga0070667_100104305 3300005367 Bacteria 2452
58 Ga0070714_100285579 3300005435 Bacteria 1534
59 Ga0070710_11068552 3300005437 Unclassified 591
60 Ga0070663_100082161 3300005455 Bacteria 2370
61 Ga0070663_100303571 3300005455 Bacteria 1278
62 Ga0070663_100452619 3300005455 Bacteria 1058
63 Ga0070678_100056850 3300005456 Bacteria 2863
64 Ga0070678_100172068 3300005456 Unclassified 1765
65 Ga0070662_100272988 3300005457 Bacteria 1366
66 Ga0070662_100378254 3300005457 Bacteria 1165
67 Ga0070681_10001436 3300005458 Bacteria 20972
68 Ga0070681_10016124 3300005458 Bacteria 7449
69 Ga0070681_10052548 3300005458 Bacteria 4064
70 Ga0070681_10068182 3300005458 Bacteria 3525
71 Ga0070681_10077175 3300005458 Bacteria 3289
72 Ga0070681_10101199 3300005458 Unclassified 2827
73 Ga0070681_10187704 3300005458 Bacteria 1987
74 Ga0070681_10360792 3300005458 Bacteria 1363
75 Ga0070681_10411064 3300005458 Bacteria 1265
76 Ga0068867_100017915 3300005459 Bacteria 5031
77 Ga0068867_100045257 3300005459 Bacteria 3226
78 Ga0068867_100296375 3300005459 Bacteria 1332
79 Ga0070685_10086984 3300005466 Bacteria 1885
80 Ga0070679_100008182 3300005530 Bacteria 9831
81 Ga0070679_100049381 3300005530 Bacteria 4190
82 Ga0070679_100073308 3300005530 Bacteria 3416
83 Ga0070679_100172677 3300005530 Bacteria 2134
84 Ga0070684_100920079 3300005535 Bacteria 820
85 Ga0070684_101252671 3300005535 Bacteria 698
86 Ga0068853_100007531 3300005539 Bacteria 8712
87 Ga0068853_100045606 3300005539 Bacteria 3755
88 Ga0068853_100619432 3300005539 Bacteria 1029
89 Ga0068853_101435032 3300005539 Bacteria 668
90 Ga0070672_100035649 3300005543 Bacteria 3783
91 Ga0070672_100539608 3300005543 Unclassified 1012
92 Ga0070686_100064370 3300005544 Bacteria 2378
93 Ga0070696_100015600 3300005546 Bacteria 5104
94 Ga0070696_100263652 3300005546 Bacteria 1307
95 Ga0070696_100578470 3300005546 Unclassified 903
96 Ga0070693_100016850 3300005547 Bacteria 3788
97 Ga0070693_100034187 3300005547 Bacteria 2811
98 Ga0070665_100907197 3300005548 Bacteria 894
99 Ga0070665_101798758 3300005548 Bacteria 619
100 Ga0068855_100007796 3300005563 Bacteria 12932
101 Ga0068855_100512350 3300005563 Bacteria 1302
102 Ga0068855_100726507 3300005563 Bacteria 1061
103 Ga0070664_100070997 3300005564 Bacteria 2984
104 Ga0070664_100233481 3300005564 Bacteria 1649
105 Ga0068854_100065217 3300005578 Bacteria 2647
106 Ga0068854_100088408 3300005578 Bacteria 2301
107 Ga0068854_100101124 3300005578 Bacteria 2161
108 Ga0068854_100138759 3300005578 Bacteria 1863
109 Ga0068854_101748224 3300005578 Bacteria 569
110 Ga0068852_101057902 3300005616 Bacteria 831
111 Ga0068859_100024860 3300005617 Bacteria 6011
112 Ga0068864_100018033 3300005618 Bacteria 5891
113 Ga0068864_101456809 3300005618 Bacteria 687
114 Ga0068861_100243917 3300005719 Bacteria 1529
115 Ga0068851_10028433 3300005834 Bacteria 2762
116 Ga0068851_10049435 3300005834 Bacteria 2133
117 Ga0068851_10125329 3300005834 Bacteria 1384
118 Ga0068863_100020958 3300005841 Bacteria 6243
119 Ga0068858_100014044 3300005842 Bacteria 7556
120 Ga0068858_100608889 3300005842 Unclassified 1060
121 Ga0068860_100248266 3300005843 Bacteria 1732
122 Ga0068862_100460311 3300005844 Bacteria 1201
123 Ga0075362_10554713 3300006177 Bacteria 591
124 Ga0097621_100013140 3300006237 Bacteria 6159
125 Ga0075370_10079505 3300006353 Bacteria 1883
126 Ga0068871_100014294 3300006358 Bacteria 5914
127 Ga0068871_100037663 3300006358 Bacteria 3858
128 Ga0075428_100014820 3300006844 Bacteria 8663
129 Ga0075431_100071583 3300006847 Bacteria 3577
130 Ga0075429_100000003 3300006880 Bacteria 130377
131 Ga0097620_100024866 3300006931 Bacteria 6011
132 Ga0105240_10037050 3300009093 Bacteria 6269
133 Ga0105240_10069596 3300009093 Bacteria 4355
134 Ga0105240_10104430 3300009093 Bacteria 3441
135 Ga0105240_10184495 3300009093 Bacteria 2459
136 Ga0105240_10791198 3300009093 Unclassified 1028
137 Ga0114129_10025522 3300009147 Bacteria 8373
138 Ga0105243_10970184 3300009148 Bacteria 850
139 Ga0105241_10034487 3300009174 Bacteria 3802
140 Ga0105241_10116713 3300009174 Bacteria 2144
141 Ga0105241_10138031 3300009174 Bacteria 1982
142 Ga0105241_10149646 3300009174 Bacteria 1908
143 Ga0105241_12254832 3300009174 Unclassified 541
144 Ga0105248_10030299 3300009177 Bacteria 6041
145 Ga0105237_10001049 3300009545 Bacteria 37114
146 Ga0105237_10002537 3300009545 Bacteria 22597
147 Ga0105237_10030865 3300009545 Bacteria 5438
148 Ga0105237_10347866 3300009545 Bacteria 1487
149 Ga0105237_10435853 3300009545 Bacteria 1316
150 Ga0105237_10605667 3300009545 Unclassified 1102
151 Ga0105237_11405978 3300009545 Bacteria 704
152 Ga0105238_10007829 3300009551 Bacteria 10682
153 Ga0105238_10057211 3300009551 Bacteria 3910
154 Ga0105238_10244739 3300009551 Bacteria 1771
155 Ga0105238_10350936 3300009551 Bacteria 1464
156 Ga0105238_12556571 3300009551 Unclassified 547
157 Ga0105249_10000273 3300009553 Bacteria 54501
158 Ga0105249_10103776 3300009553 Bacteria 2678
159 Ga0105239_10072730 3300010375 Bacteria 3780
160 Ga0105239_10879624 3300010375 Unclassified 1028
161 Ga0105239_10962928 3300010375 Bacteria 981
162 Ga0105239_11496029 3300010375 Bacteria 780
163 Ga0105246_11416246 3300011119 Bacteria 649
164 Ga0157373_10239334 3300013100 Bacteria 1283
165 Ga0157373_10707852 3300013100 Bacteria 738
166 Ga0157373_11181416 3300013100 Unclassified 576
167 Ga0157371_10107835 3300013102 Bacteria 1976
168 Ga0157371_10894366 3300013102 Bacteria 673
169 Ga0157370_10009888 3300013104 Bacteria 10107
170 Ga0157370_10059095 3300013104 Bacteria 3644
171 Ga0157370_10091906 3300013104 Bacteria 2849
172 Ga0157370_10158180 3300013104 Bacteria 2108
173 Ga0157370_10518500 3300013104 Bacteria 1094
174 Ga0157369_10150199 3300013105 Bacteria 2462
175 Ga0157369_10875119 3300013105 Bacteria 922
176 Ga0157369_11938631 3300013105 Bacteria 598
177 Ga0157374_10020418 3300013296 Bacteria 5878
178 Ga0157374_11297904 3300013296 Bacteria 750
179 Ga0157378_10020301 3300013297 Bacteria 5843
180 Ga0157378_10147790 3300013297 Unclassified 2187
181 Ga0157378_11049255 3300013297 Archaea 851
182 Ga0163162_10025092 3300013306 Bacteria 5891
183 Ga0163162_10139548 3300013306 Bacteria 2536
184 Ga0157372_10071177 3300013307 Bacteria 3916
185 Ga0157372_10150850 3300013307 Bacteria 2683
186 Ga0157372_10230197 3300013307 Bacteria 2148
187 Ga0157375_10021711 3300013308 Bacteria 5893
188 Ga0157375_12677523 3300013308 Bacteria 596
189 Ga0163163_10023041 3300014325 Bacteria 5905
190 Ga0157380_10176859 3300014326 Bacteria 1871
191 Ga0182008_10067763 3300014497 Bacteria 1756
192 Ga0182008_10119713 3300014497 Bacteria 1308
193 Ga0182008_10217529 3300014497 Bacteria 977
194 Ga0157379_10055039 3300014968 Bacteria 3555
195 Ga0157379_10095962 3300014968 Plasmid 2661
196 Ga0157376_10003610 3300014969 Bacteria 10676
197 Ga0182006_1012594 3300015261 Bacteria 3698
198 Ga0182006_1021440 3300015261 Bacteria 2695
199 Ga0182006_1034281 3300015261 Bacteria 2031
200 Ga0182007_10018683 3300015262 Bacteria 2508
201 Ga0182007_10022012 3300015262 Bacteria 2255
202 Ga0182007_10098692 3300015262 Bacteria 966
203 Ga0163161_10033050 3300017792 Bacteria 3697
204 Ga0163161_10112970 3300017792 Unclassified 2032
205 Ga0206356_10547182 3300020070 Bacteria 2135
206 Ga0206354_10449777 3300020081 Bacteria 4265
207 Ga0206354_10752943 3300020081 Bacteria 772
208 Ga0206353_10057860 3300020082 Bacteria 2117
209 Ga0154015_1226205 3300020610 Bacteria 1717
210 Ga0209646_1030771 3300025246 Unclassified 722
211 Ga0209026_1011867 3300025250 Bacteria 1543
212 Ga0209759_1008346 3300025256 Bacteria 3237
213 Ga0209233_1001521 3300025261 Bacteria 9089
214 Ga0209455_1000189 3300025272 Bacteria 92877
215 Ga0207656_10013911 3300025321 Bacteria 3087
216 Ga0207656_10183351 3300025321 Bacteria 1005
217 Ga0207656_10209993 3300025321 Bacteria 943
218 Ga0207682_10008486 3300025893 Bacteria 4062
219 Ga0207682_10009748 3300025893 Bacteria 3784
220 Ga0207688_10112779 3300025901 Unclassified 1580
221 Ga0207680_10020139 3300025903 Bacteria 3583
222 Ga0207647_10032480 3300025904 Bacteria 3352
223 Ga0207647_10055498 3300025904 Bacteria 2434
224 Ga0207647_10086877 3300025904 Bacteria 1869
225 Ga0207647_10481381 3300025904 Unclassified 693
226 Ga0207645_10005557 3300025907 Bacteria 9126
227 Ga0207645_10031783 3300025907 Bacteria 3394
228 Ga0207645_10086957 3300025907 Bacteria 2008
229 Ga0207645_10187312 3300025907 Unclassified 1359
230 Ga0207643_10053945 3300025908 Bacteria 2284
231 Ga0207705_10282311 3300025909 Bacteria 1271
232 Ga0207705_10291493 3300025909 Bacteria 1250
233 Ga0207705_10321169 3300025909 Bacteria 1190
234 Ga0207654_10101480 3300025911 Bacteria 1774
235 Ga0207654_10155151 3300025911 Bacteria 1474
236 Ga0207707_10000494 3300025912 Bacteria 40531
237 Ga0207707_10001601 3300025912 Bacteria 20877
238 Ga0207707_10027423 3300025912 Bacteria 4981
239 Ga0207707_10034040 3300025912 Bacteria 4458
240 Ga0207707_10162688 3300025912 Bacteria 1951
241 Ga0207707_10499734 3300025912 Unclassified 1037
242 Ga0207707_10785288 3300025912 Unclassified 794
243 Ga0207707_10861332 3300025912 Unclassified 751
244 Ga0207695_10010992 3300025913 Bacteria 10997
245 Ga0207695_10142498 3300025913 Bacteria 2344
246 Ga0207695_10447648 3300025913 Bacteria 1175
247 Ga0207695_10832930 3300025913 Unclassified 803
248 Ga0207671_10000697 3300025914 Bacteria 43453
249 Ga0207671_10001484 3300025914 Bacteria 27105
250 Ga0207671_10024524 3300025914 Bacteria 4532
251 Ga0207671_10279489 3300025914 Bacteria 1316
252 Ga0207671_10286352 3300025914 Bacteria 1300
253 Ga0207671_10891203 3300025914 Bacteria 704
254 Ga0207660_10012340 3300025917 Bacteria 5589
255 Ga0207660_10500396 3300025917 Bacteria 986
256 Ga0207657_10085963 3300025919 Bacteria 2633
257 Ga0207649_10164918 3300025920 Bacteria 1538
258 Ga0207652_10000415 3300025921 Bacteria 44199
259 Ga0207652_10235829 3300025921 Bacteria 1649
260 Ga0207652_10355832 3300025921 Bacteria 1321
261 Ga0207652_10694478 3300025921 Bacteria 908
262 Ga0207652_10694545 3300025921 Unclassified 908
263 Ga0207681_10009504 3300025923 Bacteria 5943
264 Ga0207681_10255348 3300025923 Bacteria 1370
265 Ga0207694_10023439 3300025924 Bacteria 4685
266 Ga0207694_10035577 3300025924 Bacteria 3822
267 Ga0207694_10582662 3300025924 Bacteria 940
268 Ga0207650_10034819 3300025925 Bacteria 3653
269 Ga0207650_10039054 3300025925 Bacteria 3469
270 Ga0207650_10074308 3300025925 Bacteria 2562
271 Ga0207650_10198395 3300025925 Bacteria 1606
272 Ga0207659_10006937 3300025926 Bacteria 6958
273 Ga0207659_10238785 3300025926 Unclassified 1469
274 Ga0207644_10120886 3300025931 Bacteria 1993
275 Ga0207690_10001623 3300025932 Bacteria 13976
276 Ga0207690_10019214 3300025932 Bacteria 4202
277 Ga0207706_10097163 3300025933 Bacteria 2590
278 Ga0207706_11122224 3300025933 Unclassified 656
279 Ga0207686_11619711 3300025934 Bacteria 535
280 Ga0207670_10028444 3300025936 Bacteria 3549
281 Ga0207670_10630878 3300025936 Unclassified 882
282 Ga0207670_10749426 3300025936 Bacteria 811
283 Ga0207691_10530196 3300025940 Bacteria 999
284 Ga0207691_10844913 3300025940 Bacteria 768
285 Ga0207711_10018240 3300025941 Bacteria 5833
286 Ga0207711_10905091 3300025941 Bacteria 820
287 Ga0207689_10158126 3300025942 Bacteria 1868
288 Ga0207661_10141931 3300025944 Bacteria 2068
289 Ga0207661_10266467 3300025944 Bacteria 1527
290 Ga0207679_10213559 3300025945 Bacteria 1619
291 Ga0207679_10386407 3300025945 Bacteria 1228
292 Ga0207679_10461539 3300025945 Bacteria 1128
293 Ga0207667_10187146 3300025949 Bacteria 2125
294 Ga0207667_10422484 3300025949 Bacteria 1356
295 Ga0207667_11168554 3300025949 Unclassified 750
296 Ga0207667_11501747 3300025949 Unclassified 645
297 Ga0207651_10001224 3300025960 Bacteria 11514
298 Ga0207712_10000267 3300025961 Bacteria 50698
299 Ga0207712_10173409 3300025961 Bacteria 1688
300 Ga0207668_10525085 3300025972 Bacteria 1022
301 Ga0207640_10070099 3300025981 Bacteria 2356
302 Ga0207640_10477055 3300025981 Bacteria 1034
303 Ga0207640_10642184 3300025981 Bacteria 903
304 Ga0207640_11830730 3300025981 Bacteria 549
305 Ga0207658_10082818 3300025986 Bacteria 2464
306 Ga0207658_10541958 3300025986 Unclassified 1040
307 Ga0207677_10019711 3300026023 Bacteria 4079
308 Ga0207677_10211185 3300026023 Bacteria 1550
309 Ga0207703_10005239 3300026035 Bacteria 10461
310 Ga0207703_11239173 3300026035 Unclassified 717
311 Ga0207639_10015279 3300026041 Bacteria 5412
312 Ga0207639_10083714 3300026041 Bacteria 2532
313 Ga0207639_10110602 3300026041 Bacteria 2238
314 Ga0207639_10381254 3300026041 Bacteria 1266
315 Ga0207678_10003785 3300026067 Bacteria 13604
316 Ga0207678_10310289 3300026067 Bacteria 1356
317 Ga0207678_10423743 3300026067 Bacteria 1154
318 Ga0207702_10219007 3300026078 Bacteria 1773
319 Ga0207641_10007814 3300026088 Bacteria 8880
320 Ga0207648_10006171 3300026089 Bacteria 11938
321 Ga0207648_10132776 3300026089 Bacteria 2192
322 Ga0207648_10442285 3300026089 Bacteria 1183
323 Ga0207648_11836137 3300026089 Bacteria 568
324 Ga0207676_10013504 3300026095 Bacteria 5865
325 Ga0207674_10594002 3300026116 Bacteria 1069
326 Ga0207675_100194978 3300026118 Bacteria 1944
327 Ga0207683_10017632 3300026121 Bacteria 6087
328 Ga0207683_10205184 3300026121 Unclassified 1793
329 Ga0207698_10112146 3300026142 Bacteria 2288
330 Ga0207698_10167025 3300026142 Bacteria 1933
331 Ga0207698_10175399 3300026142 Bacteria 1892
332 Ga0207698_11061589 3300026142 Bacteria 822
333 Ga0209967_1031798 3300027364 Bacteria 790
334 Ga0209999_1039249 3300027543 Bacteria 886
335 Ga0209970_1052948 3300027614 Bacteria 736
336 Ga0210002_1062897 3300027617 Bacteria 649
337 Ga0209983_1002718 3300027665 Bacteria 3841
338 Ga0209971_1010515 3300027682 Bacteria 2192
339 Ga0209974_10003384 3300027876 Bacteria 5764
340 Ga0268265_11059101 3300028380 Bacteria 803
341 Ga0268264_10223051 3300028381 Bacteria 1736
342 Ga0307515_10104973 3300028794 Bacteria 3369
343 Ga0307515_10105145 3300028794 Bacteria 3364
344 Ga0307513_10006250 3300031456 Bacteria 15603
345 Ga0307513_10042196 3300031456 Bacteria 5026
346 Ga0307513_10256327 3300031456 Bacteria 1542
347 Ga0307408_100625673 3300031548 Bacteria 959
348 Ga0307405_10016774 3300031731 Bacteria 4001
349 Ga0307413_10195957 3300031824 Bacteria 1454
350 Ga0307410_10052859 3300031852 Bacteria 2746
351 Ga0307406_10079301 3300031901 Bacteria 2177
352 Ga0307407_10047446 3300031903 Bacteria 2438
353 Ga0307412_10046523 3300031911 Bacteria 2843
354 Ga0307409_100021126 3300031995 Bacteria 4456
355 Ga0307416_100029615 3300032002 Bacteria 4093
356 Ga0307414_10141523 3300032004 Bacteria 1884
357 Ga0307414_10427916 3300032004 Bacteria 1156
358 Ga0307411_10006015 3300032005 Bacteria 6027
359 Ga0307411_10425909 3300032005 Bacteria 1104
360 Ga0307415_100021838 3300032126 Bacteria 3942
361 Ga0307507_10385861 3300033179 Unclassified 804
362 Ga0373944_0077460 3300035089 Bacteria 1093
363 Ga0373927_0361108 3300035695 Bacteria 957
364 Ga0373925_0010353 3300037068 Bacteria 6767
365 Ga0373925_0395254 3300037068 Bacteria 1127
366 Ga0395899_0080455 3300037312 Bacteria 2371
367 Ga0395899_0296013 3300037312 Bacteria 1097
368 Ga0395900_0013487 3300037418 Bacteria 8350
369 Ga0395900_0076630 3300037418 Bacteria 3436
370 Ga0395900_0192428 3300037418 Bacteria 2068
371 Ga0395898_0021949 3300037466 Bacteria 6466
372 Ga0395898_0158446 3300037466 Bacteria 2165
373 Ga0395898_0308066 3300037466 Bacteria 1510
374 Ga0395901_0097062 3300038443 Bacteria 3088
375 Ga0395901_0235412 3300038443 Bacteria 1911
376 Ga0395901_0675359 3300038443 Unclassified 1033
377 Ga0451791_0797218 3300041451 Unclassified 695
378 Ga0451793_0837739 3300041452 Unclassified 1944
379 Ga0451797_1369856 3300041453 Bacteria 544
380 Ga0451804_0840779 3300041463 Unclassified 536
381 Ga0439445_0174917 3300042004 Bacteria 630
382 Ga0439432_152031 3300042006 Bacteria 679
383 Ga0439459_0001791 3300042438 Bacteria 3220
384 Ga0451577_0149166 3300042876 Bacteria 2103
385 Ga0453684_0623682 3300044712 Bacteria 1179
386 Ga0466958_0343115 3300045836 Bacteria 961
387 Ga0466967_0062056 3300045976 Bacteria 3317
388 Ga0495643_0119579 3300046522 Bacteria 1332
389 Ga0495598_0024935 3300046537 Bacteria 1626
390 Ga0495597_0360742 3300046542 Unclassified 556
391 Ga0495645_0044909 3300046543 Bacteria 3222
392 Ga0495588_0641652 3300046674 Unclassified 556
393 Ga0495599_0531597 3300046678 Bacteria 690
394 Ga0495687_085745 3300047443 Bacteria 1220
395 Ga0496100_0327024 3300048903 Bacteria 1153
396 Ga0496102_0379253 3300048905 Bacteria 1331
397 Ga0496102_0564536 3300048905 Unclassified 1061
398 Ga0496104_0275646 3300048907 Bacteria 1595
399 Ga0496104_0368761 3300048907 Bacteria 1348
400 Ga0496105_0017409 3300048908 Bacteria 5761
401 Ga0496108_0140045 3300048911 Bacteria 2084
402 Ga0496109_0061249 3300048912 Bacteria 3440
403 Ga0496114_0011626 3300048917 Bacteria 7039
404 Ga0496115_1171302 3300048918 Bacteria 579
405 Ga0496125_0337873 3300048928 Bacteria 905
406 Ga0496126_0037707 3300048929 Bacteria 4507
407 Ga0501292_118753 3300049515 Bacteria 538
408 Ga0501032_0007273 3300049569 Bacteria 8100
409 Ga0501032_0328959 3300049569 Bacteria 986
410 Ga0501033_0000455 3300049570 Bacteria 38949
411 Ga0501034_0022057 3300049571 Bacteria 6487
412 Ga0501036_0019985 3300049572 Bacteria 5622
413 Ga0501037_0010070 3300049573 Bacteria 6935
414 Ga0501038_0005178 3300049574 Bacteria 12129
415 Ga0501039_0295471 3300049575 Bacteria 1273
416 Ga0501043_0003023 3300049579 Bacteria 13984
417 Ga0501043_0068455 3300049579 Bacteria 2787
418 Ga0501046_0275835 3300049580 Bacteria 1232
419 Ga0501047_0006322 3300049581 Bacteria 11141
420 Ga0501067_0064773 3300049583 Bacteria 2023
421 Ga0501073_0001358 3300049589 Bacteria 18073
422 Ga0501073_0489992 3300049589 Bacteria 850
423 Ga0501074_0031501 3300049590 Bacteria 3841
424 Ga0501249_092917 3300049679 Bacteria 717
425 Ga0501258_024915 3300049687 Bacteria 725
426 Ga0501079_0091156 3300049741 Bacteria 2362
427 Ga0501080_0003688 3300049742 Bacteria 13514
428 Ga0501080_0388269 3300049742 Bacteria 1257
429 Ga0501083_0304567 3300049744 Bacteria 1036
430 Ga0501044_0595171 3300049823 Bacteria 999
431 Ga0501044_1310717 3300049823 Bacteria 590
432 nmdc:mga07m45_29523_c2 3300050496 Bacteria 2572
433 nmdc:mga05p37_77_c1 3300050507 Bacteria 86224
434 nmdc:mga09592_140_c1 3300050508 Bacteria 48059
435 Ga0495601_0072035 3300053077 Bacteria 2207
436 Ga0495612_0151841 3300053078 Bacteria 1008
437 Ga0495655_0130585 3300053083 Bacteria 773
438 Ga0590075_142111 3300059424 Bacteria 631
439 2919690602 2919688452 Bacteria 4595932
440 2977869963 2977864932 Bacteria 7534097
441 Ga0182007_10016602
442 JGI24741J21665_1001269
443 JGI24740J21852_10004958
444 JGI24743J22301_10102345
445 JGI24735J21928_10054887
446 JGI25157J39369_1000987
447 JGI25157J39369_1004340
448 rootH1_10076101
449 Ga0055529_1001571
450 Ga0058862_11742014
451 Ga0065715_10389425
452 Ga0065715_10684798
453 Ga0070658_10090940
454 Ga0070658_10115881
455 Ga0070676_10007998
456 Ga0070676_10052660
457 Ga0070676_10053786
458 Ga0070676_10336177
459 Ga0070683_100385385
460 Ga0070690_100040558
461 Ga0070690_100190608
462 Ga0070670_100051282
463 Ga0070670_100179432
464 Ga0068869_100054811
465 Ga0070666_10134821
466 Ga0070680_100018747
467 Ga0070680_100099698
468 Ga0070680_100229583
469 Ga0070680_100558997
470 Ga0070680_100709261
471 Ga0070682_100066912
472 Ga0070682_100086788
473 Ga0070682_100599513
474 Ga0068868_100078915
475 Ga0068868_100134810
476 Ga0070660_100041825
477 Ga0070689_100035116
478 Ga0070661_100196570
479 Ga0070661_100219210
480 Ga0070692_11088595
481 Ga0070668_100685427
482 Ga0070669_100010770
483 Ga0070669_100198387
484 Ga0070675_100016329
485 Ga0070675_100198262
486 Ga0070675_101119398
487 Ga0070671_100008984
488 Ga0070671_100011557
489 Ga0070671_100873020
490 Ga0070673_100008166
491 Ga0070673_100111071
492 Ga0070688_100731699
493 Ga0070659_100002053
494 Ga0070659_100086352
495 Ga0070659_100245595
496 Ga0070659_100886360
497 Ga0070667_100104305
498 Ga0070714_100285579
499 Ga0070710_11068552
500 Ga0070663_100082161
501 Ga0070663_100303571
502 Ga0070663_100452619
503 Ga0070678_100056850
504 Ga0070678_100172068
505 Ga0070662_100272988
506 Ga0070662_100378254
507 Ga0070681_10001436
508 Ga0070681_10016124
509 Ga0070681_10052548
510 Ga0070681_10068182
511 Ga0070681_10077175
512 Ga0070681_10101199
513 Ga0070681_10187704
514 Ga0070681_10360792
515 Ga0070681_10411064
516 Ga0068867_100017915
517 Ga0068867_100045257
518 Ga0068867_100296375
519 Ga0070685_10086984
520 Ga0070679_100008182
521 Ga0070679_100049381
522 Ga0070679_100073308
523 Ga0070679_100172677
524 Ga0070684_100920079
525 Ga0070684_101252671
526 Ga0068853_100007531
527 Ga0068853_100045606
528 Ga0068853_100619432
529 Ga0068853_101435032
530 Ga0070672_100035649
531 Ga0070672_100539608
532 Ga0070686_100064370
533 Ga0070696_100015600
534 Ga0070696_100263652
535 Ga0070696_100578470
536 Ga0070693_100016850
537 Ga0070693_100034187
538 Ga0070665_100907197
539 Ga0070665_101798758
540 Ga0068855_100007796
541 Ga0068855_100512350
542 Ga0068855_100726507
543 Ga0070664_100070997
544 Ga0070664_100233481
545 Ga0068854_100065217
546 Ga0068854_100088408
547 Ga0068854_100101124
548 Ga0068854_100138759
549 Ga0068854_101748224
550 Ga0068852_101057902
551 Ga0068859_100024860
552 Ga0068864_100018033
553 Ga0068864_101456809
554 Ga0068861_100243917
555 Ga0068851_10028433
556 Ga0068851_10049435
557 Ga0068851_10125329
558 Ga0068863_100020958
559 Ga0068858_100014044
560 Ga0068858_100608889
561 Ga0068860_100248266
562 Ga0068862_100460311
563 Ga0075362_10554713
564 Ga0097621_100013140
565 Ga0075370_10079505
566 Ga0068871_100014294
567 Ga0068871_100037663
568 Ga0075428_100014820
569 Ga0075431_100071583
570 Ga0075429_100000003
571 Ga0097620_100024866
572 Ga0105240_10037050
573 Ga0105240_10069596
574 Ga0105240_10104430
575 Ga0105240_10184495
576 Ga0105240_10791198
577 Ga0114129_10025522
578 Ga0105243_10970184
579 Ga0105241_10034487
580 Ga0105241_10116713
581 Ga0105241_10138031
582 Ga0105241_10149646
583 Ga0105241_12254832
584 Ga0105248_10030299
585 Ga0105237_10001049
586 Ga0105237_10002537
587 Ga0105237_10030865
588 Ga0105237_10347866
589 Ga0105237_10435853
590 Ga0105237_10605667
591 Ga0105237_11405978
592 Ga0105238_10007829
593 Ga0105238_10057211
594 Ga0105238_10244739
595 Ga0105238_10350936
596 Ga0105238_12556571
597 Ga0105249_10000273
598 Ga0105249_10103776
599 Ga0105239_10072730
600 Ga0105239_10879624
601 Ga0105239_10962928
602 Ga0105239_11496029
603 Ga0105246_11416246
604 Ga0157373_10239334
605 Ga0157373_10707852
606 Ga0157373_11181416
607 Ga0157371_10107835
608 Ga0157371_10894366
609 Ga0157370_10009888
610 Ga0157370_10059095
611 Ga0157370_10091906
612 Ga0157370_10158180
613 Ga0157370_10518500
614 Ga0157369_10150199
615 Ga0157369_10875119
616 Ga0157369_11938631
617 Ga0157374_10020418
618 Ga0157374_11297904
619 Ga0157378_10020301
620 Ga0157378_10147790
621 Ga0157378_11049255
622 Ga0163162_10025092
623 Ga0163162_10139548
624 Ga0157372_10071177
625 Ga0157372_10150850
626 Ga0157372_10230197
627 Ga0157375_10021711
628 Ga0157375_12677523
629 Ga0163163_10023041
630 Ga0157380_10176859
631 Ga0182008_10067763
632 Ga0182008_10119713
633 Ga0182008_10217529
634 Ga0157379_10055039
635 Ga0157379_10095962
636 Ga0157376_10003610
637 Ga0182006_1012594
638 Ga0182006_1021440
639 Ga0182006_1034281
640 Ga0182007_10018683
641 Ga0182007_10022012
642 Ga0182007_10098692
643 Ga0163161_10033050
644 Ga0163161_10112970
645 Ga0206356_10547182
646 Ga0206354_10449777
647 Ga0206354_10752943
648 Ga0206353_10057860
649 Ga0154015_1226205
650 Ga0209646_1030771
651 Ga0209026_1011867
652 Ga0209759_1008346
653 Ga0209233_1001521
654 Ga0209455_1000189
655 Ga0207656_10013911
656 Ga0207656_10183351
657 Ga0207656_10209993
658 Ga0207682_10008486
659 Ga0207682_10009748
660 Ga0207688_10112779
661 Ga0207680_10020139
662 Ga0207647_10032480
663 Ga0207647_10055498
664 Ga0207647_10086877
665 Ga0207647_10481381
666 Ga0207645_10005557
667 Ga0207645_10031783
668 Ga0207645_10086957
669 Ga0207645_10187312
670 Ga0207643_10053945
671 Ga0207705_10282311
672 Ga0207705_10291493
673 Ga0207705_10321169
674 Ga0207654_10101480
675 Ga0207654_10155151
676 Ga0207707_10000494
677 Ga0207707_10001601
678 Ga0207707_10027423
679 Ga0207707_10034040
680 Ga0207707_10162688
681 Ga0207707_10499734
682 Ga0207707_10785288
683 Ga0207707_10861332
684 Ga0207695_10010992
685 Ga0207695_10142498
686 Ga0207695_10447648
687 Ga0207695_10832930
688 Ga0207671_10000697
689 Ga0207671_10001484
690 Ga0207671_10024524
691 Ga0207671_10279489
692 Ga0207671_10286352
693 Ga0207671_10891203
694 Ga0207660_10012340
695 Ga0207660_10500396
696 Ga0207657_10085963
697 Ga0207649_10164918
698 Ga0207652_10000415
699 Ga0207652_10235829
700 Ga0207652_10355832
701 Ga0207652_10694478
702 Ga0207652_10694545
703 Ga0207681_10009504
704 Ga0207681_10255348
705 Ga0207694_10023439
706 Ga0207694_10035577
707 Ga0207694_10582662
708 Ga0207650_10034819
709 Ga0207650_10039054
710 Ga0207650_10074308
711 Ga0207650_10198395
712 Ga0207659_10006937
713 Ga0207659_10238785
714 Ga0207644_10120886
715 Ga0207690_10001623
716 Ga0207690_10019214
717 Ga0207706_10097163
718 Ga0207706_11122224
719 Ga0207686_11619711
720 Ga0207670_10028444
721 Ga0207670_10630878
722 Ga0207670_10749426
723 Ga0207691_10530196
724 Ga0207691_10844913
725 Ga0207711_10018240
726 Ga0207711_10905091
727 Ga0207689_10158126
728 Ga0207661_10141931
729 Ga0207661_10266467
730 Ga0207679_10213559
731 Ga0207679_10386407
732 Ga0207679_10461539
733 Ga0207667_10187146
734 Ga0207667_10422484
735 Ga0207667_11168554
736 Ga0207667_11501747
737 Ga0207651_10001224
738 Ga0207712_10000267
739 Ga0207712_10173409
740 Ga0207668_10525085
741 Ga0207640_10070099
742 Ga0207640_10477055
743 Ga0207640_10642184
744 Ga0207640_11830730
745 Ga0207658_10082818
746 Ga0207658_10541958
747 Ga0207677_10019711
748 Ga0207677_10211185
749 Ga0207703_10005239
750 Ga0207703_11239173
751 Ga0207639_10015279
752 Ga0207639_10083714
753 Ga0207639_10110602
754 Ga0207639_10381254
755 Ga0207678_10003785
756 Ga0207678_10310289
757 Ga0207678_10423743
758 Ga0207702_10219007
759 Ga0207641_10007814
760 Ga0207648_10006171
761 Ga0207648_10132776
762 Ga0207648_10442285
763 Ga0207648_11836137
764 Ga0207676_10013504
765 Ga0207674_10594002
766 Ga0207675_100194978
767 Ga0207683_10017632
768 Ga0207683_10205184
769 Ga0207698_10112146
770 Ga0207698_10167025
771 Ga0207698_10175399
772 Ga0207698_11061589
773 Ga0209967_1031798
774 Ga0209999_1039249
775 Ga0209970_1052948
776 Ga0210002_1062897
777 Ga0209983_1002718
778 Ga0209971_1010515
779 Ga0209974_10003384
780 Ga0268265_11059101
781 Ga0268264_10223051
782 Ga0307515_10104973
783 Ga0307515_10105145
784 Ga0307513_10006250
785 Ga0307513_10042196
786 Ga0307513_10256327
787 Ga0307408_100625673
788 Ga0307405_10016774
789 Ga0307413_10195957
790 Ga0307410_10052859
791 Ga0307406_10079301
792 Ga0307407_10047446
793 Ga0307412_10046523
794 Ga0307409_100021126
795 Ga0307416_100029615
796 Ga0307414_10141523
797 Ga0307414_10427916
798 Ga0307411_10006015
799 Ga0307411_10425909
800 Ga0307415_100021838
801 Ga0307507_10385861
802 Ga0373944_0077460
803 Ga0373927_0361108
804 Ga0373925_0010353
805 Ga0373925_0395254
806 Ga0395899_0080455
807 Ga0395899_0296013
808 Ga0395900_0013487
809 Ga0395900_0076630
810 Ga0395900_0192428
811 Ga0395898_0021949
812 Ga0395898_0158446
813 Ga0395898_0308066
814 Ga0395901_0097062
815 Ga0395901_0235412
816 Ga0395901_0675359
817 Ga0451791_0797218
818 Ga0451793_0837739
819 Ga0451797_1369856
820 Ga0451804_0840779
821 Ga0439445_0174917
822 Ga0439432_152031
823 Ga0439459_0001791
824 Ga0451577_0149166
825 Ga0453684_0623682
826 Ga0466958_0343115
827 Ga0466967_0062056
828 Ga0495643_0119579
829 Ga0495598_0024935
830 Ga0495597_0360742
831 Ga0495645_0044909
832 Ga0495588_0641652
833 Ga0495599_0531597
834 Ga0495687_085745
835 Ga0496100_0327024
836 Ga0496102_0379253
837 Ga0496102_0564536
838 Ga0496104_0275646
839 Ga0496104_0368761
840 Ga0496105_0017409
841 Ga0496108_0140045
842 Ga0496109_0061249
843 Ga0496114_0011626
844 Ga0496115_1171302
845 Ga0496125_0337873
846 Ga0496126_0037707
847 Ga0501292_118753
848 Ga0501032_0007273
849 Ga0501032_0328959
850 Ga0501033_0000455
851 Ga0501034_0022057
852 Ga0501036_0019985
853 Ga0501037_0010070
854 Ga0501038_0005178
855 Ga0501039_0295471
856 Ga0501043_0003023
857 Ga0501043_0068455
858 Ga0501046_0275835
859 Ga0501047_0006322
860 Ga0501067_0064773
861 Ga0501073_0001358
862 Ga0501073_0489992
863 Ga0501074_0031501
864 Ga0501249_092917
865 Ga0501258_024915
866 Ga0501079_0091156
867 Ga0501080_0003688
868 Ga0501080_0388269
869 Ga0501083_0304567
870 Ga0501044_0595171
871 Ga0501044_1310717
872 nmdc:mga07m45_29523_c2
873 nmdc:mga05p37_77_c1
874 nmdc:mga09592_140_c1
875 Ga0495601_0072035
876 Ga0495612_0151841
877 Ga0495655_0130585
878 Ga0590075_142111
879 2919690602
880 2977869963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01124

MAPEG

MAPEG family

35

164

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sss-assembly1.cif.gz_C crystal structure of human microsomal glutathione s-transferase 2 0.6248 5 131
6ssr-assembly1.cif.gz_A crystal structure of human microsomal glutathione s-transferase 2 at 3.8 angstroms resolution 0.6132 10 131
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.594 8 137
4bpm-assembly1.cif.gz_A crystal structure of a human integral membrane enzyme 0.5693 8 137
6sss-assembly1.cif.gz_C crystal structure of human microsomal glutathione s-transferase 2 0.5587 5 131
ID Description Score Start End Superfamily
af_P10620_2_155_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6976 3 134 1.20.120.550
af_B4FHI1_161_358_1.20.1410.10 Mainly Alpha;Up-down Bundle;I/LWEQ domain;I/LWEQ domain 0.6945 51 129 1.20.1410.10
af_B0R1E9_1_152_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6911 4 134 1.20.120.550
af_A2RST1_1_145_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6761 5 131 1.20.120.550
af_P10620_2_155_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6724 3 134 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A534U073-F1-model_v4 MAPEG family protein 0.9852 53 134 GO:0016020
AF-A0A562NHS3-F1-model_v4 MAPEG family protein 0.9785 53 135 GO:0016020
AF-A0A5A7VYN6-F1-model_v4 MAPEG family protein 0.9777 2 134 GO:0016020
AF-A0A1E4HFW4-F1-model_v4 MAPEG family protein 0.9734 2 118 GO:0016020
AF-A0A661FT05-F1-model_v4 MAPEG family protein 0.9729 2 134 GO:0016020

Map