F444357

General Info

Members Datasets Scaffolds Average Seq Length
440 223 425 311

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100124434|Ga0070680_1001244343
Length 334
Sequence LSSPPVNVPADATRNPMGTGSKTRDHIATAIVWAVLLTMPYWMAMIGGYTELAIRIVVMGLAAMSLNFLLGFTGVLSFGHAAYFGLGGYGVAMTIKYLVPSTPVSMLVGIATGTIAAMIIGAMIVKLRGVYFAMVTIAFGQVFYFIAFRWNSVTGGDDGLNNWRRQAIDFGIAKLDITNDVTFYYFALIVFALSAAAMGLLIKSPFGRTLIAIRENERRARFLGIPVEQHIWLSFVISCFFVSLAGTLFALLSNFTDPRALRWDQSGNFVIMAVLGGMRSFWGPLIGAAIFVVLQDYVSSHTENWMSFIGLFFMAVVLFFPRGILGIVKRRLAS

Samples

Sample ID Description Type Environment
1 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
4 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
5 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
6 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
7 2883291878 Hypericibacter terrae R5913 Isolate Rhizosphere
8 2883354860 Hypericibacter adhaerens R5959 Isolate Rhizosphere
9 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
10 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
11 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
12 2906610324
13 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
14 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
15 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
16 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
17 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
46 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
48 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
49 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
50 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
51 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
52 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
56 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
62 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
65 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
66 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
67 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
101 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
102 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
103 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
108 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
114 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
117 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
118 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
119 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
120 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
121 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
122 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
123 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
124 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
127 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
128 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
129 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
132 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
136 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
137 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
138 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
142 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
143 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
144 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
145 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
148 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
149 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
150 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
151 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
152 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
153 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
154 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
163 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
164 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
165 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
166 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
181 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
203 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
204 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
205 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
209 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
216 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
217 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
218 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
219 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
220 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
221 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
222 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
223 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.36
Metatranscriptomes 0.46
Isolates 3.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.18
Nodule 2.5
Rhizoplane 2.27
Rhizosphere 86.36
Stem 0
Stem Tuber 0
Unclassified 5.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000014 3300003215 Bacteria 298101
2 rootL2_10028868 3300003322 Bacteria 2314
3 Ga0070658_10004122 3300005327 Bacteria 11908
4 Ga0070658_10024438 3300005327 Bacteria 4847
5 Ga0070658_10108264 3300005327 Bacteria 2300
6 Ga0070658_10110406 3300005327 Bacteria 2278
7 Ga0070658_10248520 3300005327 Bacteria 1509
8 Ga0070683_100006919 3300005329 Bacteria 9532
9 Ga0070683_100152906 3300005329 Bacteria 2188
10 Ga0070683_100343189 3300005329 Bacteria 1422
11 Ga0068869_100084703 3300005334 Bacteria 2373
12 Ga0070680_100022519 3300005336 Bacteria 5019
13 Ga0070680_100051933 3300005336 Bacteria 3346
14 Ga0070680_100075955 3300005336 Bacteria 2766
15 Ga0070680_100124434 3300005336 Bacteria 2154
16 Ga0070680_100165355 3300005336 Bacteria 1860
17 Ga0070682_100073744 3300005337 Bacteria 2190
18 Ga0068868_100061471 3300005338 Bacteria 2976
19 Ga0070660_100014752 3300005339 Bacteria 5637
20 Ga0070661_100110316 3300005344 Bacteria 2054
21 Ga0070661_100113420 3300005344 Bacteria 2025
22 Ga0070659_100046995 3300005366 Bacteria 3384
23 Ga0070659_100073907 3300005366 Bacteria 2714
24 Ga0070659_100350764 3300005366 Bacteria 1238
25 Ga0070714_100026112 3300005435 Bacteria 4826
26 Ga0070714_100032775 3300005435 Bacteria 4339
27 Ga0070714_100033817 3300005435 Bacteria 4277
28 Ga0070714_100089425 3300005435 Bacteria 2696
29 Ga0070713_100011673 3300005436 Bacteria 6410
30 Ga0070713_100040585 3300005436 Bacteria 3784
31 Ga0070711_100022598 3300005439 Bacteria 4078
32 Ga0070711_100110988 3300005439 Bacteria 2013
33 Ga0070711_100291443 3300005439 Bacteria 1294
34 Ga0070663_100089424 3300005455 Bacteria 2279
35 Ga0070681_10002561 3300005458 Bacteria 16682
36 Ga0070681_10005544 3300005458 Bacteria 12196
37 Ga0070681_10013774 3300005458 Bacteria 8051
38 Ga0070681_10024240 3300005458 Bacteria 6107
39 Ga0070681_10034696 3300005458 Bacteria 5066
40 Ga0070698_100090408 3300005471 Bacteria 3045
41 Ga0070679_100018803 3300005530 Bacteria 6708
42 Ga0070679_100025761 3300005530 Bacteria 5772
43 Ga0070679_100041264 3300005530 Bacteria 4592
44 Ga0070679_100046473 3300005530 Bacteria 4327
45 Ga0070679_100184093 3300005530 Bacteria 2060
46 Ga0070679_100196842 3300005530 Bacteria 1982
47 Ga0070679_100217273 3300005530 Bacteria 1874
48 Ga0070679_100257607 3300005530 Bacteria 1700
49 Ga0070679_100429774 3300005530 Bacteria 1266
50 Ga0070684_100021426 3300005535 Bacteria 5379
51 Ga0070684_100375094 3300005535 Bacteria 1310
52 Ga0068855_100006840 3300005563 Bacteria 13834
53 Ga0068855_100008775 3300005563 Bacteria 12219
54 Ga0068855_100010307 3300005563 Bacteria 11273
55 Ga0068855_100058618 3300005563 Bacteria 4508
56 Ga0068855_100063258 3300005563 Bacteria 4318
57 Ga0068855_100080132 3300005563 Bacteria 3786
58 Ga0070664_100000225 3300005564 Bacteria 40336
59 Ga0068857_100009780 3300005577 Bacteria 8328
60 Ga0068857_100046469 3300005577 Bacteria 3853
61 Ga0068857_100156843 3300005577 Bacteria 2064
62 Ga0068857_100352921 3300005577 Bacteria 1362
63 Ga0068854_100006320 3300005578 Bacteria 7533
64 Ga0068856_100009377 3300005614 Bacteria 9507
65 Ga0068856_100010154 3300005614 Bacteria 9150
66 Ga0068856_100019568 3300005614 Bacteria 6572
67 Ga0068852_100001480 3300005616 Bacteria 15894
68 Ga0068852_100002821 3300005616 Bacteria 12039
69 Ga0068852_100005433 3300005616 Bacteria 9110
70 Ga0068852_100114321 3300005616 Bacteria 2459
71 Ga0068852_100130717 3300005616 Bacteria 2312
72 Ga0068864_100037137 3300005618 Bacteria 4155
73 Ga0068851_10003897 3300005834 Bacteria 6680
74 Ga0068860_100106994 3300005843 Bacteria 2672
75 Ga0070717_10007694 3300006028 Bacteria 8013
76 Ga0070717_10031106 3300006028 Bacteria 4292
77 Ga0070717_10063610 3300006028 Bacteria 3063
78 Ga0070712_100068125 3300006175 Bacteria 2535
79 Ga0070712_100152305 3300006175 Bacteria 1777
80 Ga0070712_100157890 3300006175 Bacteria 1749
81 Ga0097621_100047901 3300006237 Bacteria 3465
82 Ga0068871_100238582 3300006358 Bacteria 1580
83 Ga0099824_1006466 3300006942 Bacteria 16057
84 Ga0099822_1036254 3300006943 Bacteria 3110
85 Ga0099794_10003307 3300007265 Bacteria 6123
86 Ga0105240_10018908 3300009093 Bacteria 9225
87 Ga0105240_10038910 3300009093 Bacteria 6097
88 Ga0105240_10065644 3300009093 Bacteria 4504
89 Ga0105240_10065667 3300009093 Bacteria 4503
90 Ga0105240_10085037 3300009093 Bacteria 3877
91 Ga0105240_10100934 3300009093 Bacteria 3511
92 Ga0105240_10106323 3300009093 Bacteria 3404
93 Ga0105240_10165313 3300009093 Bacteria 2625
94 Ga0105240_10224511 3300009093 Bacteria 2186
95 Ga0105240_10282423 3300009093 Bacteria 1906
96 Ga0105241_10042593 3300009174 Bacteria 3436
97 Ga0105241_10067415 3300009174 Bacteria 2770
98 Ga0105248_10033127 3300009177 Bacteria 5771
99 Ga0105237_10050694 3300009545 Bacteria 4170
100 Ga0105237_10059407 3300009545 Bacteria 3825
101 Ga0105237_10065576 3300009545 Bacteria 3627
102 Ga0105237_10084221 3300009545 Bacteria 3170
103 Ga0105238_10000931 3300009551 Bacteria 29986
104 Ga0105238_10005309 3300009551 Bacteria 12730
105 Ga0105238_10032270 3300009551 Bacteria 5329
106 Ga0105238_10038849 3300009551 Bacteria 4833
107 Ga0105238_10116390 3300009551 Bacteria 2652
108 Ga0105238_10469108 3300009551 Bacteria 1257
109 Ga0105238_10487172 3300009551 Bacteria 1233
110 Ga0105239_10005755 3300010375 Bacteria 14459
111 Ga0105239_10625014 3300010375 Bacteria 1229
112 Ga0105239_10662470 3300010375 Bacteria 1192
113 Ga0157373_10130577 3300013100 Bacteria 1767
114 Ga0157371_10118444 3300013102 Bacteria 1883
115 Ga0157370_10008171 3300013104 Bacteria 11311
116 Ga0157370_10011477 3300013104 Bacteria 9261
117 Ga0157370_10128295 3300013104 Bacteria 2367
118 Ga0157369_10003589 3300013105 Bacteria 18428
119 Ga0157369_10010449 3300013105 Bacteria 10575
120 Ga0157369_10037783 3300013105 Bacteria 5285
121 Ga0157369_10089053 3300013105 Bacteria 3295
122 Ga0157369_10267835 3300013105 Bacteria 1781
123 Ga0157372_10032166 3300013307 Bacteria 5749
124 Ga0157372_10032526 3300013307 Bacteria 5721
125 Ga0157375_10019529 3300013308 Bacteria 6166
126 Ga0157379_10119417 3300014968 Bacteria 2371
127 Ga0213874_10039063 3300021377 Bacteria 1412
128 Ga0213875_10073503 3300021388 Bacteria 1595
129 Ga0213875_10129955 3300021388 Bacteria 1178
130 Ga0213871_10013565 3300021441 Bacteria 1917
131 Ga0209148_1000366 3300025254 Bacteria 55841
132 Ga0209455_1001439 3300025272 Bacteria 10753
133 Ga0209758_1000005 3300025297 Bacteria 1368918
134 Ga0207656_10001962 3300025321 Bacteria 6843
135 Ga0207656_10007472 3300025321 Bacteria 3981
136 Ga0207656_10012991 3300025321 Bacteria 3173
137 Ga0207692_10005671 3300025898 Bacteria 5013
138 Ga0207692_10024525 3300025898 Bacteria 2805
139 Ga0207685_10086661 3300025905 Bacteria 1309
140 Ga0207699_10141143 3300025906 Bacteria 1583
141 Ga0207699_10186013 3300025906 Bacteria 1399
142 Ga0207705_10071926 3300025909 Bacteria 2508
143 Ga0207705_10072972 3300025909 Bacteria 2490
144 Ga0207705_10262123 3300025909 Bacteria 1320
145 Ga0207654_10034458 3300025911 Bacteria 2813
146 Ga0207707_10001007 3300025912 Bacteria 27013
147 Ga0207707_10005081 3300025912 Bacteria 11538
148 Ga0207707_10038849 3300025912 Bacteria 4160
149 Ga0207707_10092405 3300025912 Bacteria 2644
150 Ga0207707_10199220 3300025912 Bacteria 1746
151 Ga0207707_10312716 3300025912 Bacteria 1357
152 Ga0207695_10086963 3300025913 Bacteria 3150
153 Ga0207695_10093743 3300025913 Bacteria 3012
154 Ga0207695_10171027 3300025913 Bacteria 2098
155 Ga0207695_10219508 3300025913 Bacteria 1809
156 Ga0207695_10302569 3300025913 Bacteria 1490
157 Ga0207695_10433690 3300025913 Bacteria 1198
158 Ga0207671_10048755 3300025914 Bacteria 3134
159 Ga0207671_10098129 3300025914 Bacteria 2216
160 Ga0207671_10183035 3300025914 Bacteria 1631
161 Ga0207671_10325426 3300025914 Bacteria 1217
162 Ga0207693_10058846 3300025915 Bacteria 3010
163 Ga0207693_10290529 3300025915 Bacteria 1281
164 Ga0207663_10030594 3300025916 Bacteria 3177
165 Ga0207663_10044538 3300025916 Bacteria 2724
166 Ga0207660_10005369 3300025917 Bacteria 8322
167 Ga0207660_10033570 3300025917 Bacteria 3551
168 Ga0207660_10046374 3300025917 Bacteria 3066
169 Ga0207660_10182810 3300025917 Bacteria 1629
170 Ga0207657_10002081 3300025919 Bacteria 21643
171 Ga0207657_10024922 3300025919 Bacteria 5527
172 Ga0207649_10009420 3300025920 Bacteria 5343
173 Ga0207649_10143915 3300025920 Bacteria 1634
174 Ga0207649_10228991 3300025920 Bacteria 1328
175 Ga0207652_10040665 3300025921 Bacteria 3949
176 Ga0207652_10064296 3300025921 Bacteria 3175
177 Ga0207652_10109029 3300025921 Bacteria 2454
178 Ga0207652_10154214 3300025921 Bacteria 2057
179 Ga0207652_10344191 3300025921 Bacteria 1346
180 Ga0207694_10007792 3300025924 Bacteria 8111
181 Ga0207694_10019635 3300025924 Bacteria 5111
182 Ga0207694_10019893 3300025924 Bacteria 5079
183 Ga0207694_10027123 3300025924 Bacteria 4362
184 Ga0207694_10029705 3300025924 Bacteria 4172
185 Ga0207694_10045924 3300025924 Bacteria 3375
186 Ga0207694_10072788 3300025924 Bacteria 2687
187 Ga0207700_10004617 3300025928 Bacteria 8153
188 Ga0207700_10075312 3300025928 Bacteria 2615
189 Ga0207700_10152195 3300025928 Bacteria 1913
190 Ga0207700_10166642 3300025928 Bacteria 1834
191 Ga0207664_10019014 3300025929 Bacteria 5070
192 Ga0207664_10026808 3300025929 Bacteria 4360
193 Ga0207664_10030769 3300025929 Bacteria 4102
194 Ga0207664_10298880 3300025929 Bacteria 1416
195 Ga0207690_10224090 3300025932 Bacteria 1440
196 Ga0207661_10090528 3300025944 Bacteria 2547
197 Ga0207661_10278471 3300025944 Bacteria 1494
198 Ga0207679_10020713 3300025945 Bacteria 4443
199 Ga0207679_10291308 3300025945 Bacteria 1403
200 Ga0207667_10007087 3300025949 Bacteria 13534
201 Ga0207667_10008779 3300025949 Bacteria 11969
202 Ga0207667_10033421 3300025949 Bacteria 5529
203 Ga0207667_10052698 3300025949 Bacteria 4284
204 Ga0207651_10075531 3300025960 Bacteria 2405
205 Ga0207640_10003281 3300025981 Bacteria 8724
206 Ga0207677_10011532 3300026023 Bacteria 5046
207 Ga0207639_10062709 3300026041 Bacteria 2876
208 Ga0207639_10072063 3300026041 Bacteria 2704
209 Ga0207678_10111567 3300026067 Bacteria 2333
210 Ga0207702_10009328 3300026078 Bacteria 8244
211 Ga0207702_10049710 3300026078 Bacteria 3539
212 Ga0207674_10000380 3300026116 Bacteria 57884
213 Ga0207674_10058502 3300026116 Bacteria 3904
214 Ga0207674_10198404 3300026116 Bacteria 1956
215 Ga0207698_10016732 3300026142 Bacteria 4955
216 Ga0207698_10094599 3300026142 Bacteria 2457
217 Ga0207698_10188145 3300026142 Bacteria 1836
218 Ga0209589_1000001 3300027357 Bacteria 794224
219 Ga0209489_100001 3300027361 Bacteria 794224
220 Ga0209700_100001 3300027363 Bacteria 794224
221 Ga0209588_1001433 3300027671 Bacteria 6234
222 Ga0268264_10085746 3300028381 Bacteria 2704
223 Ga0265318_10012149 3300028577 Bacteria 3676
224 Ga0265338_10019112 3300028800 Bacteria 7291
225 Ga0265338_10088751 3300028800 Bacteria 2564
226 Ga0307511_10081197 3300030521 Bacteria 2278
227 Ga0265763_1000130 3300030763 Bacteria 3636
228 Ga0265760_10003527 3300031090 Bacteria 4539
229 Ga0265330_10018351 3300031235 Bacteria 3213
230 Ga0265328_10049580 3300031239 Bacteria 1542
231 Ga0265325_10003212 3300031241 Bacteria 10754
232 Ga0265325_10013664 3300031241 Bacteria 4615
233 Ga0265325_10016648 3300031241 Bacteria 4105
234 Ga0265325_10024598 3300031241 Bacteria 3275
235 Ga0265339_10009667 3300031249 Bacteria 6038
236 Ga0265339_10112507 3300031249 Bacteria 1407
237 Ga0265327_10088605 3300031251 Bacteria 1513
238 Ga0265316_10131757 3300031344 Bacteria 1883
239 Ga0265316_10307742 3300031344 Bacteria 1153
240 Ga0307513_10156405 3300031456 Bacteria 2179
241 Ga0265313_10003868 3300031595 Bacteria 11813
242 Ga0265313_10011604 3300031595 Bacteria 5465
243 Ga0265313_10012272 3300031595 Bacteria 5243
244 Ga0265313_10067406 3300031595 Bacteria 1656
245 Ga0307508_10000058 3300031616 Bacteria 125293
246 Ga0316579_10005374 3300031691 Bacteria 5164
247 Ga0265314_10006463 3300031711 Bacteria 10372
248 Ga0265314_10007271 3300031711 Bacteria 9620
249 Ga0265314_10027257 3300031711 Bacteria 4280
250 Ga0265314_10095539 3300031711 Bacteria 1924
251 Ga0265342_10000556 3300031712 Bacteria 39445
252 Ga0265342_10033596 3300031712 Bacteria 3152
253 Ga0316583_10014901 3300032133 Bacteria 2798
254 Ga0373926_0001584 3300035083 Bacteria 6997
255 Ga0373944_0006083 3300035089 Bacteria 3197
256 Ga0373936_0019043 3300035113 Bacteria 2658
257 Ga0373945_0010199 3300035116 Bacteria 3090
258 Ga0373945_0062276 3300035116 Unclassified 1394
259 Ga0373957_0037132 3300035120 Bacteria 1819
260 Ga0373943_0000567 3300035170 Bacteria 16034
261 Ga0373943_0076182 3300035170 Bacteria 1710
262 Ga0373935_0010070 3300035692 Bacteria 5664
263 Ga0373935_0094927 3300035692 Bacteria 1958
264 Ga0373927_0002426 3300035695 Bacteria 13595
265 Ga0373927_0003722 3300035695 Bacteria 10836
266 Ga0373927_0094897 3300035695 Bacteria 1938
267 Ga0373933_0000095 3300035724 Bacteria 55331
268 Ga0373933_0007585 3300035724 Bacteria 5923
269 Ga0373933_0329172 3300035724 Bacteria 991
270 Ga0373947_0000239 3300035725 Bacteria 30999
271 Ga0373947_0366481 3300035725 Bacteria 968
272 Ga0373937_0015432 3300036401 Bacteria 6753
273 Ga0373925_0003922 3300037068 Bacteria 11355
274 Ga0373925_0274171 3300037068 Bacteria 1357
275 Ga0395899_0004450 3300037312 Bacteria 10928
276 Ga0395899_0052681 3300037312 Bacteria 3015
277 Ga0395900_0016637 3300037418 Bacteria 7501
278 Ga0395900_0046154 3300037418 Bacteria 4486
279 Ga0395900_0146541 3300037418 Bacteria 2414
280 Ga0395900_0219332 3300037418 Bacteria 1918
281 Ga0395900_0608594 3300037418 Bacteria 1032
282 Ga0395898_0009907 3300037466 Bacteria 9983
283 Ga0395898_0023179 3300037466 Bacteria 6275
284 Ga0395898_0037067 3300037466 Bacteria 4838
285 Ga0395898_0115689 3300037466 Bacteria 2569
286 Ga0395905_0000959 3300037471 Bacteria 37058
287 Ga0395905_0031876 3300037471 Bacteria 4959
288 Ga0395905_0423719 3300037471 Bacteria 1227
289 Ga0395905_0433041 3300037471 Bacteria 1212
290 Ga0436364_0023207 3300037853 Bacteria 6246
291 Ga0436364_0059334 3300037853 Bacteria 7252
292 Ga0436364_1209993 3300037853 Bacteria 2526
293 Ga0395901_0002550 3300038443 Bacteria 18456
294 Ga0395901_0008727 3300038443 Bacteria 10244
295 Ga0395901_0010245 3300038443 Bacteria 9496
296 Ga0395901_0019507 3300038443 Bacteria 6933
297 Ga0395901_0053886 3300038443 Bacteria 4180
298 Ga0436365_0820808 3300039437 Bacteria 5049
299 Ga0436365_0879462 3300039437 Bacteria 3428
300 Ga0436365_1416688 3300039437 Bacteria 2797
301 Ga0436365_1756344 3300039437 Bacteria 1357
302 Ga0436360_0077961 3300039438 Bacteria 3308
303 Ga0436360_0330144 3300039438 Bacteria 2109
304 Ga0436361_0119961 3300039447 Bacteria 3910
305 Ga0436361_0383944 3300039447 Bacteria 2090
306 Ga0436363_0610729 3300039450 Bacteria 978
307 Ga0436363_1071055 3300039450 Bacteria 1472
308 Ga0436363_1547701 3300039450 Bacteria 8513
309 Ga0436362_1038557 3300039453 Bacteria 2366
310 Ga0436362_1160644 3300039453 Bacteria 5460
311 Ga0451577_0098924 3300042876 Bacteria 2605
312 Ga0466969_0004132 3300044656 Bacteria 7703
313 Ga0466969_0074307 3300044656 Bacteria 1631
314 Ga0466969_0094736 3300044656 Bacteria 1411
315 Ga0466972_0040047 3300044658 Bacteria 2284
316 Ga0453683_0048322 3300044673 Bacteria 2669
317 Ga0466965_0135475 3300044683 Bacteria 1279
318 Ga0466966_0087700 3300044684 Bacteria 1934
319 Ga0466966_0175204 3300044684 Bacteria 1303
320 Ga0466961_0146582 3300044693 Bacteria 1476
321 Ga0466963_0253548 3300044694 Bacteria 1235
322 Ga0453684_0001169 3300044712 Bacteria 81414
323 Ga0453684_0001321 3300044712 Bacteria 73247
324 Ga0453684_0008308 3300044712 Bacteria 18689
325 Ga0453684_0014559 3300044712 Bacteria 12559
326 Ga0453684_0031126 3300044712 Bacteria 7509
327 Ga0453684_0078766 3300044712 Bacteria 4122
328 Ga0453684_0157352 3300044712 Bacteria 2692
329 Ga0466968_0017684 3300044735 Bacteria 2853
330 Ga0466970_0143260 3300044765 Bacteria 1317
331 Ga0466957_0084605 3300044842 Bacteria 1980
332 Ga0466959_0012090 3300045049 Bacteria 6228
333 Ga0466967_0205382 3300045976 Bacteria 1867
334 Ga0466967_0592079 3300045976 Bacteria 1094
335 Ga0495603_0062329 3300046455 Bacteria 2202
336 Ga0495629_0034913 3300046459 Bacteria 3555
337 Ga0495629_0081455 3300046459 Bacteria 2259
338 Ga0495580_0099745 3300046472 Bacteria 2020
339 Ga0495639_0094443 3300046475 Unclassified 1406
340 Ga0495639_0140703 3300046475 Bacteria 1160
341 Ga0495662_0000280 3300046476 Bacteria 21964
342 Ga0495664_0000112 3300046477 Bacteria 40522
343 Ga0495618_0001016 3300046514 Bacteria 19217
344 Ga0495630_0009608 3300046517 Bacteria 6959
345 Ga0495652_0038922 3300046529 Bacteria 4115
346 Ga0495665_0039801 3300046531 Bacteria 2503
347 Ga0495640_0000871 3300046533 Bacteria 23106
348 Ga0495640_0056152 3300046533 Bacteria 2691
349 Ga0495645_0013723 3300046543 Bacteria 5739
350 Ga0495634_0003493 3300046642 Bacteria 12595
351 Ga0495635_0002093 3300046663 Bacteria 13548
352 Ga0495635_0099800 3300046663 Bacteria 1984
353 Ga0495613_0076099 3300046689 Bacteria 2443
354 Ga0495600_0086592 3300046809 Bacteria 2044
355 Ga0495581_0037593 3300047315 Bacteria 2802
356 Ga0495581_0107168 3300047315 Bacteria 1624
357 Ga0495674_0001513 3300047319 Bacteria 22779
358 Ga0495676_0094685 3300047321 Bacteria 2224
359 Ga0495684_0000264 3300047471 Bacteria 41677
360 Ga0495684_0001309 3300047471 Bacteria 20014
361 Ga0495593_0046702 3300047673 Bacteria 2306
362 Ga0495602_0057307 3300048088 Bacteria 3419
363 Ga0495602_0152559 3300048088 Bacteria 1814
364 Ga0496101_0235842 3300048904 Bacteria 1423
365 Ga0496104_0002375 3300048907 Bacteria 16226
366 Ga0496104_0348629 3300048907 Bacteria 1393
367 Ga0496105_0073659 3300048908 Bacteria 2821
368 Ga0496107_0244562 3300048910 Bacteria 1335
369 Ga0496110_0040533 3300048913 Bacteria 4058
370 Ga0496110_0057240 3300048913 Bacteria 3432
371 Ga0496114_0153913 3300048917 Bacteria 1996
372 Ga0496114_0208341 3300048917 Bacteria 1714
373 Ga0496115_0041760 3300048918 Bacteria 3651
374 Ga0496119_0011057 3300048922 Bacteria 7523
375 Ga0496120_0048986 3300048923 Bacteria 2428
376 Ga0496121_0237274 3300048924 Bacteria 1273
377 Ga0496126_0045311 3300048929 Bacteria 4044
378 Ga0501032_0021436 3300049569 Bacteria 4491
379 Ga0501033_0003246 3300049570 Bacteria 13458
380 Ga0501033_0058333 3300049570 Bacteria 2851
381 Ga0501034_0033479 3300049571 Bacteria 5213
382 Ga0501034_0215378 3300049571 Bacteria 1874
383 Ga0501037_0059988 3300049573 Bacteria 2774
384 Ga0501037_0170286 3300049573 Bacteria 1548
385 Ga0501038_0259603 3300049574 Bacteria 1374
386 Ga0501042_0340479 3300049578 Bacteria 1084
387 Ga0501043_0020583 3300049579 Bacteria 5175
388 Ga0501046_0000581 3300049580 Bacteria 36025
389 Ga0501046_0086315 3300049580 Bacteria 2419
390 Ga0501046_0126627 3300049580 Bacteria 1940
391 Ga0501048_0034061 3300049582 Bacteria 3677
392 Ga0501067_0003273 3300049583 Bacteria 8918
393 Ga0501068_0009073 3300049584 Bacteria 5551
394 Ga0501069_0021604 3300049585 Bacteria 3495
395 Ga0501070_0007777 3300049586 Bacteria 9087
396 Ga0501073_0008747 3300049589 Bacteria 7496
397 Ga0501073_0040900 3300049589 Bacteria 3277
398 Ga0501073_0207583 3300049589 Bacteria 1354
399 Ga0501074_0018172 3300049590 Bacteria 5107
400 Ga0501074_0058237 3300049590 Bacteria 2783
401 Ga0501080_0033376 3300049742 Bacteria 4803
402 Ga0501080_0364976 3300049742 Bacteria 1302
403 Ga0501083_0174101 3300049744 Bacteria 1406
404 Ga0501035_0009564 3300049822 Bacteria 9013
405 Ga0501035_0373474 3300049822 Bacteria 1190
406 Ga0501044_0008463 3300049823 Bacteria 11271
407 Ga0501044_0037958 3300049823 Bacteria 5033
408 Ga0495601_0025314 3300053077 Bacteria 3659
409 Ga0495601_0057777 3300053077 Bacteria 2458
410 Ga0495601_0076034 3300053077 Bacteria 2150
411 Ga0495612_0000308 3300053078 Bacteria 19880
412 Ga0495619_0001598 3300053085 Bacteria 14888
413 Ga0495619_0005030 3300053085 Bacteria 8397
414 Ga0500578_0054819 3300053086 Bacteria 2552
415 Ga0500651_0005202 3300053093 Bacteria 7406
416 Ga0500651_0105112 3300053093 Bacteria 1728
417 Ga0500648_151727 3300053097 Bacteria 1231
418 Ga0500555_001630 3300053103 Bacteria 6777
419 Ga0500577_0066419 3300053142 Bacteria 1403
420 Ga0500588_0004128 3300053146 Bacteria 3122
421 Ga0500636_0030355 3300053177 Bacteria 3196
422 Ga0500636_0090917 3300053177 Bacteria 1747
423 Ga0500609_003901 3300053731 Bacteria 2078
424 Ga0501084_0055484 3300054114 Bacteria 3315
425 Ga0501084_0076249 3300054114 Bacteria 2810

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044684 Ga0466966_0175204 Ga0466966_0175204_475_1293 244
2 3300049742 Ga0501080_0364976 Ga0501080_0364976_28_861 249
3 3300046459 Ga0495629_0034913 Ga0495629_0034913_2701_3537 250
4 3300039450 Ga0436363_0610729 Ga0436363_0610729_74_949 251
5 3300049822 Ga0501035_0373474 Ga0501035_0373474_14_856 252
6 3300049574 Ga0501038_0259603 Ga0501038_0259603_42_992 260
7 3300044712 Ga0453684_0008308 Ga0453684_0008308_8429_9385 262
8 3300049569 Ga0501032_0021436 Ga0501032_0021436_2090_3082 264
9 3300049570 Ga0501033_0003246 Ga0501033_0003246_12396_13388 264
10 3300049571 Ga0501034_0215378 Ga0501034_0215378_535_1527 264
11 3300049573 Ga0501037_0059988 Ga0501037_0059988_539_1531 264
12 3300049578 Ga0501042_0340479 Ga0501042_0340479_74_1066 264
13 3300049579 Ga0501043_0020583 Ga0501043_0020583_2668_3660 264
14 3300049580 Ga0501046_0000581 Ga0501046_0000581_32991_33983 264
15 3300049582 Ga0501048_0034061 Ga0501048_0034061_2123_3115 264
16 3300049583 Ga0501067_0003273 Ga0501067_0003273_6771_7763 264
17 3300049584 Ga0501068_0009073 Ga0501068_0009073_2341_3333 264
18 3300049585 Ga0501069_0021604 Ga0501069_0021604_2090_3082 264
19 3300049590 Ga0501074_0058237 Ga0501074_0058237_555_1547 264
20 3300049822 Ga0501035_0009564 Ga0501035_0009564_1271_2263 264
21 3300049823 Ga0501044_0008463 Ga0501044_0008463_9109_10101 264
22 3300054114 Ga0501084_0076249 Ga0501084_0076249_1102_2094 264
23 3300005458 Ga0070681_10024240 Ga0070681_100242403 265
24 3300035724 Ga0373933_0329172 Ga0373933_0329172_11_892 265
25 3300031712 Ga0265342_10000556 Ga0265342_1000055617 266
26 3300044712 Ga0453684_0014559 Ga0453684_0014559_4519_5463 266
27 3300009551 Ga0105238_10487172 Ga0105238_104871722 267
28 3300048904 Ga0496101_0235842 Ga0496101_0235842_496_1389 267
29 3300048918 Ga0496115_0041760 Ga0496115_0041760_1344_2237 267
30 3300021441 Ga0213871_10013565 Ga0213871_100135652 268
31 3300037466 Ga0395898_0115689 Ga0395898_0115689_1044_1973 268
32 3300039438 Ga0436360_0330144 Ga0436360_0330144_542_1492 268
33 3300044712 Ga0453684_0001169 Ga0453684_0001169_25597_26547 268
34 3300044712 Ga0453684_0157352 Ga0453684_0157352_1631_2581 268
35 3300009551 Ga0105238_10469108 Ga0105238_104691082 269
36 3300021377 Ga0213874_10039063 Ga0213874_100390632 269
37 3300025924 Ga0207694_10019893 Ga0207694_100198932 269
38 3300035725 Ga0373947_0366481 Ga0373947_0366481_49_942 269
39 3300039450 Ga0436363_1071055 Ga0436363_1071055_287_1270 269
40 3300031456 Ga0307513_10156405 Ga0307513_101564052 270
41 3300044765 Ga0466970_0143260 Ga0466970_0143260_103_1104 271
42 3300005334 Ga0068869_100084703 Ga0068869_1000847032 272
43 3300044656 Ga0466969_0074307 Ga0466969_0074307_221_1225 272
44 3300009093 Ga0105240_10282423 Ga0105240_102824232 273
45 3300048913 Ga0496110_0040533 Ga0496110_0040533_2981_3976 273
46 3300049580 Ga0501046_0126627 Ga0501046_0126627_941_1900 273
47 3300044712 Ga0453684_0031126 Ga0453684_0031126_5122_6120 274
48 3300044712 Ga0453684_0078766 Ga0453684_0078766_3085_4035 274
49 3300005435 Ga0070714_100032775 Ga0070714_1000327754 275
50 3300006028 Ga0070717_10063610 Ga0070717_100636102 275
51 3300025929 Ga0207664_10030769 Ga0207664_100307692 275
52 3300039438 Ga0436360_0077961 Ga0436360_0077961_1685_2689 275
53 3300039453 Ga0436362_1160644 Ga0436362_1160644_189_1193 275
54 3300005327 Ga0070658_10024438 Ga0070658_100244383 277
55 3300005436 Ga0070713_100011673 Ga0070713_1000116737 277
56 3300005530 Ga0070679_100046473 Ga0070679_1000464732 277
57 3300005563 Ga0068855_100008775 Ga0068855_1000087758 277
58 3300006028 Ga0070717_10031106 Ga0070717_100311063 277
59 3300006942 Ga0099824_1006466 Ga0099824_10064663 277
60 3300006943 Ga0099822_1036254 Ga0099822_10362543 277
61 3300009093 Ga0105240_10065667 Ga0105240_100656674 277
62 3300025912 Ga0207707_10092405 Ga0207707_100924052 277
63 3300025917 Ga0207660_10033570 Ga0207660_100335703 277
64 3300025921 Ga0207652_10064296 Ga0207652_100642962 277
65 3300027357 Ga0209589_1000001 Ga0209589_1000001352 277
66 3300027361 Ga0209489_100001 Ga0209489_100001352 277
67 3300027363 Ga0209700_100001 Ga0209700_100001352 277
68 3300053177 Ga0500636_0030355 Ga0500636_0030355_1812_2804 277
69 3300005338 Ga0068868_100061471 Ga0068868_1000614712 278
70 3300005563 Ga0068855_100080132 Ga0068855_1000801324 278
71 3300005577 Ga0068857_100352921 Ga0068857_1003529212 278
72 3300026023 Ga0207677_10011532 Ga0207677_100115323 278
73 3300048922 Ga0496119_0011057 Ga0496119_0011057_6076_6996 278
74 3300048923 Ga0496120_0048986 Ga0496120_0048986_1288_2208 278
75 3300028577 Ga0265318_10012149 Ga0265318_100121492 280
76 3300037312 Ga0395899_0004450 Ga0395899_0004450_644_1570 280
77 3300037418 Ga0395900_0046154 Ga0395900_0046154_2163_3089 280
78 3300037466 Ga0395898_0037067 Ga0395898_0037067_2391_3317 280
79 3300044684 Ga0466966_0087700 Ga0466966_0087700_113_1039 280
80 3300048917 Ga0496114_0153913 Ga0496114_0153913_879_1829 280
81 3300031691 Ga0316579_10005374 Ga0316579_100053743 281
82 iso_pu_bacteria 2513237141 2513889823 282
83 iso_pu_bacteria 2881927736 2881929524 282
84 iso_pu_bacteria 2887375801 2887379930 282
85 3300009093 Ga0105240_10038910 Ga0105240_100389102 283
86 3300025912 Ga0207707_10312716 Ga0207707_103127162 283
87 3300025920 Ga0207649_10228991 Ga0207649_102289912 283
88 3300048910 Ga0496107_0244562 Ga0496107_0244562_203_1153 283
89 iso_pu_bacteria 2512047030 2512353094 283
90 iso_pu_bacteria 2721755763 2723876517 283
91 3300005336 Ga0070680_100022519 Ga0070680_1000225192 284
92 3300005337 Ga0070682_100073744 Ga0070682_1000737443 284
93 3300005366 Ga0070659_100046995 Ga0070659_1000469953 284
94 3300005436 Ga0070713_100040585 Ga0070713_1000405851 284
95 3300005439 Ga0070711_100022598 Ga0070711_1000225982 284
96 3300005439 Ga0070711_100110988 Ga0070711_1001109882 284
97 3300005458 Ga0070681_10034696 Ga0070681_100346962 284
98 3300005530 Ga0070679_100018803 Ga0070679_1000188036 284
99 3300005530 Ga0070679_100041264 Ga0070679_1000412644 284
100 3300005530 Ga0070679_100184093 Ga0070679_1001840932 284
101 3300005563 Ga0068855_100063258 Ga0068855_1000632582 284
102 3300005577 Ga0068857_100046469 Ga0068857_1000464693 284
103 3300006028 Ga0070717_10007694 Ga0070717_100076948 284
104 3300006358 Ga0068871_100238582 Ga0068871_1002385822 284
105 3300007265 Ga0099794_10003307 Ga0099794_100033073 284
106 3300009545 Ga0105237_10059407 Ga0105237_100594074 284
107 3300009545 Ga0105237_10065576 Ga0105237_100655762 284
108 3300009551 Ga0105238_10032270 Ga0105238_100322704 284
109 3300010375 Ga0105239_10005755 Ga0105239_100057553 284
110 3300013104 Ga0157370_10128295 Ga0157370_101282953 284
111 3300013105 Ga0157369_10037783 Ga0157369_100377834 284
112 3300025321 Ga0207656_10007472 Ga0207656_100074722 284
113 3300025905 Ga0207685_10086661 Ga0207685_100866612 284
114 3300025906 Ga0207699_10141143 Ga0207699_101411432 284
115 3300025909 Ga0207705_10072972 Ga0207705_100729722 284
116 3300025912 Ga0207707_10001007 Ga0207707_100010075 284
117 3300025914 Ga0207671_10048755 Ga0207671_100487553 284
118 3300025914 Ga0207671_10098129 Ga0207671_100981293 284
119 3300025914 Ga0207671_10183035 Ga0207671_101830352 284
120 3300025916 Ga0207663_10044538 Ga0207663_100445381 284
121 3300025917 Ga0207660_10005369 Ga0207660_100053696 284
122 3300025919 Ga0207657_10002081 Ga0207657_1000208111 284
123 3300025921 Ga0207652_10040665 Ga0207652_100406652 284
124 3300025924 Ga0207694_10045924 Ga0207694_100459243 284
125 3300025924 Ga0207694_10072788 Ga0207694_100727882 284
126 3300025928 Ga0207700_10004617 Ga0207700_100046173 284
127 3300025928 Ga0207700_10152195 Ga0207700_101521953 284
128 3300025949 Ga0207667_10033421 Ga0207667_100334214 284
129 3300026116 Ga0207674_10058502 Ga0207674_100585022 284
130 3300027671 Ga0209588_1001433 Ga0209588_10014334 284
131 3300030521 Ga0307511_10081197 Ga0307511_100811972 284
132 3300031235 Ga0265330_10018351 Ga0265330_100183514 284
133 3300031241 Ga0265325_10016648 Ga0265325_100166484 284
134 3300031616 Ga0307508_10000058 Ga0307508_10000058107 284
135 3300031711 Ga0265314_10006463 Ga0265314_1000646310 284
136 3300031711 Ga0265314_10007271 Ga0265314_1000727111 284
137 3300035692 Ga0373935_0094927 Ga0373935_0094927_391_1344 284
138 3300035695 Ga0373927_0003722 Ga0373927_0003722_8289_9242 284
139 3300035724 Ga0373933_0000095 Ga0373933_0000095_349_1302 284
140 3300046455 Ga0495603_0062329 Ga0495603_0062329_1015_1968 284
141 3300046689 Ga0495613_0076099 Ga0495613_0076099_660_1613 284
142 3300047315 Ga0495581_0037593 Ga0495581_0037593_57_1010 284
143 3300048924 Ga0496121_0237274 Ga0496121_0237274_295_1248 284
144 3300049580 Ga0501046_0086315 Ga0501046_0086315_1406_2359 284
145 3300049586 Ga0501070_0007777 Ga0501070_0007777_2549_3502 284
146 3300049590 Ga0501074_0018172 Ga0501074_0018172_754_1707 284
147 3300049742 Ga0501080_0033376 Ga0501080_0033376_3719_4672 284
148 3300049823 Ga0501044_0037958 Ga0501044_0037958_1122_2075 284
149 3300053077 Ga0495601_0057777 Ga0495601_0057777_1213_2166 284
150 3300053097 Ga0500648_151727 Ga0500648_151727_212_1165 284
151 3300053146 Ga0500588_0004128 Ga0500588_0004128_2127_3092 284
152 3300053177 Ga0500636_0090917 Ga0500636_0090917_735_1688 284
153 iso_pu_bacteria 2883291878 2883296359 284
154 3300003322 rootL2_10028868 rootL2_100288682 285
155 3300005327 Ga0070658_10248520 Ga0070658_102485202 285
156 3300005329 Ga0070683_100006919 Ga0070683_1000069195 285
157 3300005336 Ga0070680_100075955 Ga0070680_1000759553 285
158 3300005336 Ga0070680_100165355 Ga0070680_1001653552 285
159 3300005344 Ga0070661_100113420 Ga0070661_1001134202 285
160 3300005366 Ga0070659_100073907 Ga0070659_1000739072 285
161 3300005366 Ga0070659_100350764 Ga0070659_1003507641 285
162 3300005435 Ga0070714_100033817 Ga0070714_1000338175 285
163 3300005455 Ga0070663_100089424 Ga0070663_1000894243 285
164 3300005458 Ga0070681_10013774 Ga0070681_100137746 285
165 3300005530 Ga0070679_100025761 Ga0070679_1000257614 285
166 3300005535 Ga0070684_100021426 Ga0070684_1000214265 285
167 3300005564 Ga0070664_100000225 Ga0070664_10000022534 285
168 3300005577 Ga0068857_100009780 Ga0068857_1000097805 285
169 3300005578 Ga0068854_100006320 Ga0068854_1000063205 285
170 3300005614 Ga0068856_100010154 Ga0068856_1000101542 285
171 3300005616 Ga0068852_100005433 Ga0068852_1000054336 285
172 3300006175 Ga0070712_100157890 Ga0070712_1001578902 285
173 3300009093 Ga0105240_10085037 Ga0105240_100850374 285
174 3300009093 Ga0105240_10106323 Ga0105240_101063232 285
175 3300009093 Ga0105240_10224511 Ga0105240_102245113 285
176 3300009174 Ga0105241_10067415 Ga0105241_100674154 285
177 3300009545 Ga0105237_10050694 Ga0105237_100506944 285
178 3300009545 Ga0105237_10084221 Ga0105237_100842213 285
179 3300009551 Ga0105238_10000931 Ga0105238_1000093115 285
180 3300010375 Ga0105239_10662470 Ga0105239_106624702 285
181 3300013100 Ga0157373_10130577 Ga0157373_101305772 285
182 3300013102 Ga0157371_10118444 Ga0157371_101184442 285
183 3300013104 Ga0157370_10011477 Ga0157370_100114779 285
184 3300013105 Ga0157369_10003589 Ga0157369_100035895 285
185 3300013307 Ga0157372_10032166 Ga0157372_100321662 285
186 3300021388 Ga0213875_10129955 Ga0213875_101299552 285
187 3300025321 Ga0207656_10012991 Ga0207656_100129912 285
188 3300025906 Ga0207699_10186013 Ga0207699_101860132 285
189 3300025911 Ga0207654_10034458 Ga0207654_100344583 285
190 3300025913 Ga0207695_10219508 Ga0207695_102195081 285
191 3300025913 Ga0207695_10433690 Ga0207695_104336902 285
192 3300025914 Ga0207671_10325426 Ga0207671_103254262 285
193 3300025915 Ga0207693_10290529 Ga0207693_102905292 285
194 3300025916 Ga0207663_10030594 Ga0207663_100305944 285
195 3300025917 Ga0207660_10046374 Ga0207660_100463742 285
196 3300025917 Ga0207660_10182810 Ga0207660_101828102 285
197 3300025920 Ga0207649_10009420 Ga0207649_100094204 285
198 3300025924 Ga0207694_10007792 Ga0207694_100077925 285
199 3300025929 Ga0207664_10026808 Ga0207664_100268082 285
200 3300025932 Ga0207690_10224090 Ga0207690_102240902 285
201 3300025944 Ga0207661_10090528 Ga0207661_100905281 285
202 3300025945 Ga0207679_10291308 Ga0207679_102913082 285
203 3300025949 Ga0207667_10008779 Ga0207667_1000877910 285
204 3300025981 Ga0207640_10003281 Ga0207640_100032815 285
205 3300026041 Ga0207639_10062709 Ga0207639_100627093 285
206 3300026067 Ga0207678_10111567 Ga0207678_101115672 285
207 3300026116 Ga0207674_10000380 Ga0207674_100003805 285
208 3300028800 Ga0265338_10088751 Ga0265338_100887513 285
209 3300031249 Ga0265339_10112507 Ga0265339_101125072 285
210 3300031711 Ga0265314_10095539 Ga0265314_100955392 285
211 3300037068 Ga0373925_0274171 Ga0373925_0274171_11_982 285
212 3300037418 Ga0395900_0146541 Ga0395900_0146541_1326_2273 285
213 3300037853 Ga0436364_0059334 Ga0436364_0059334_5207_6163 285
214 3300037853 Ga0436364_1209993 Ga0436364_1209993_1141_2097 285
215 3300039437 Ga0436365_1756344 Ga0436365_1756344_313_1269 285
216 3300042876 Ga0451577_0098924 Ga0451577_0098924_651_1646 285
217 3300044673 Ga0453683_0048322 Ga0453683_0048322_867_1862 285
218 3300044712 Ga0453684_0001321 Ga0453684_0001321_25590_26540 285
219 3300048088 Ga0495602_0152559 Ga0495602_0152559_720_1676 285
220 3300053085 Ga0495619_0005030 Ga0495619_0005030_5690_6646 285
221 3300053731 Ga0500609_003901 Ga0500609_003901_66_1016 285
222 3300005439 Ga0070711_100291443 Ga0070711_1002914432 286
223 3300006175 Ga0070712_100068125 Ga0070712_1000681253 286
224 3300039453 Ga0436362_1038557 Ga0436362_1038557_159_1142 286
225 3300053077 Ga0495601_0076034 Ga0495601_0076034_544_1494 286
226 3300005336 Ga0070680_100124434 Ga0070680_1001244343 287
227 3300005458 Ga0070681_10005544 Ga0070681_1000554412 287
228 3300005530 Ga0070679_100217273 Ga0070679_1002172732 287
229 3300005843 Ga0068860_100106994 Ga0068860_1001069943 287
230 3300014968 Ga0157379_10119417 Ga0157379_101194173 287
231 3300025912 Ga0207707_10038849 Ga0207707_100388494 287
232 3300025921 Ga0207652_10154214 Ga0207652_101542142 287
233 3300028381 Ga0268264_10085746 Ga0268264_100857462 287
234 3300032133 Ga0316583_10014901 Ga0316583_100149012 287
235 3300037312 Ga0395899_0052681 Ga0395899_0052681_1523_2470 287
236 3300037418 Ga0395900_0608594 Ga0395900_0608594_14_961 287
237 3300038443 Ga0395901_0002550 Ga0395901_0002550_12453_13409 287
238 3300044842 Ga0466957_0084605 Ga0466957_0084605_208_1155 287
239 3300046475 Ga0495639_0140703 Ga0495639_0140703_107_1105 287
240 3300049589 Ga0501073_0207583 Ga0501073_0207583_58_1008 287
241 3300053086 Ga0500578_0054819 Ga0500578_0054819_1520_2470 287
242 3300053093 Ga0500651_0105112 Ga0500651_0105112_765_1715 287
243 iso_pu_bacteria 2935959822 2935964775 287
244 3300003215 JGI25153J46596_10000014 JGI25153J46596_1000001465 288
245 3300005327 Ga0070658_10004122 Ga0070658_100041227 288
246 3300005327 Ga0070658_10108264 Ga0070658_101082643 288
247 3300005327 Ga0070658_10110406 Ga0070658_101104062 288
248 3300005329 Ga0070683_100152906 Ga0070683_1001529061 288
249 3300005329 Ga0070683_100343189 Ga0070683_1003431892 288
250 3300005336 Ga0070680_100051933 Ga0070680_1000519332 288
251 3300005339 Ga0070660_100014752 Ga0070660_1000147524 288
252 3300005344 Ga0070661_100110316 Ga0070661_1001103162 288
253 3300005435 Ga0070714_100026112 Ga0070714_1000261125 288
254 3300005435 Ga0070714_100089425 Ga0070714_1000894252 288
255 3300005458 Ga0070681_10002561 Ga0070681_1000256113 288
256 3300005471 Ga0070698_100090408 Ga0070698_1000904083 288
257 3300005530 Ga0070679_100196842 Ga0070679_1001968422 288
258 3300005530 Ga0070679_100257607 Ga0070679_1002576072 288
259 3300005530 Ga0070679_100429774 Ga0070679_1004297742 288
260 3300005535 Ga0070684_100375094 Ga0070684_1003750942 288
261 3300005563 Ga0068855_100006840 Ga0068855_10000684011 288
262 3300005563 Ga0068855_100010307 Ga0068855_1000103073 288
263 3300005563 Ga0068855_100058618 Ga0068855_1000586184 288
264 3300005577 Ga0068857_100156843 Ga0068857_1001568432 288
265 3300005614 Ga0068856_100009377 Ga0068856_1000093777 288
266 3300005614 Ga0068856_100019568 Ga0068856_1000195684 288
267 3300005616 Ga0068852_100001480 Ga0068852_1000014803 288
268 3300005616 Ga0068852_100002821 Ga0068852_1000028218 288
269 3300005616 Ga0068852_100114321 Ga0068852_1001143213 288
270 3300005616 Ga0068852_100130717 Ga0068852_1001307173 288
271 3300005618 Ga0068864_100037137 Ga0068864_1000371374 288
272 3300005834 Ga0068851_10003897 Ga0068851_100038973 288
273 3300006175 Ga0070712_100152305 Ga0070712_1001523051 288
274 3300006237 Ga0097621_100047901 Ga0097621_1000479012 288
275 3300009093 Ga0105240_10018908 Ga0105240_100189083 288
276 3300009093 Ga0105240_10065644 Ga0105240_100656442 288
277 3300009093 Ga0105240_10100934 Ga0105240_101009343 288
278 3300009093 Ga0105240_10165313 Ga0105240_101653132 288
279 3300009174 Ga0105241_10042593 Ga0105241_100425933 288
280 3300009177 Ga0105248_10033127 Ga0105248_100331275 288
281 3300009551 Ga0105238_10005309 Ga0105238_100053097 288
282 3300009551 Ga0105238_10038849 Ga0105238_100388492 288
283 3300009551 Ga0105238_10116390 Ga0105238_101163902 288
284 3300010375 Ga0105239_10625014 Ga0105239_106250142 288
285 3300013104 Ga0157370_10008171 Ga0157370_100081712 288
286 3300013105 Ga0157369_10010449 Ga0157369_100104492 288
287 3300013105 Ga0157369_10089053 Ga0157369_100890532 288
288 3300013105 Ga0157369_10267835 Ga0157369_102678352 288
289 3300013307 Ga0157372_10032526 Ga0157372_100325262 288
290 3300013308 Ga0157375_10019529 Ga0157375_100195294 288
291 3300021388 Ga0213875_10073503 Ga0213875_100735032 288
292 3300025254 Ga0209148_1000366 Ga0209148_100036653 288
293 3300025272 Ga0209455_1001439 Ga0209455_10014396 288
294 3300025297 Ga0209758_1000005 Ga0209758_10000051001 288
295 3300025321 Ga0207656_10001962 Ga0207656_100019623 288
296 3300025898 Ga0207692_10005671 Ga0207692_100056712 288
297 3300025898 Ga0207692_10024525 Ga0207692_100245254 288
298 3300025909 Ga0207705_10071926 Ga0207705_100719262 288
299 3300025909 Ga0207705_10262123 Ga0207705_102621232 288
300 3300025912 Ga0207707_10005081 Ga0207707_1000508112 288
301 3300025912 Ga0207707_10199220 Ga0207707_101992202 288
302 3300025913 Ga0207695_10086963 Ga0207695_100869632 288
303 3300025913 Ga0207695_10093743 Ga0207695_100937433 288
304 3300025913 Ga0207695_10171027 Ga0207695_101710272 288
305 3300025913 Ga0207695_10302569 Ga0207695_103025692 288
306 3300025915 Ga0207693_10058846 Ga0207693_100588462 288
307 3300025919 Ga0207657_10024922 Ga0207657_100249224 288
308 3300025920 Ga0207649_10143915 Ga0207649_101439152 288
309 3300025921 Ga0207652_10109029 Ga0207652_101090293 288
310 3300025921 Ga0207652_10344191 Ga0207652_103441912 288
311 3300025924 Ga0207694_10019635 Ga0207694_100196352 288
312 3300025924 Ga0207694_10027123 Ga0207694_100271232 288
313 3300025924 Ga0207694_10029705 Ga0207694_100297054 288
314 3300025928 Ga0207700_10075312 Ga0207700_100753123 288
315 3300025928 Ga0207700_10166642 Ga0207700_101666421 288
316 3300025929 Ga0207664_10019014 Ga0207664_100190144 288
317 3300025929 Ga0207664_10298880 Ga0207664_102988802 288
318 3300025944 Ga0207661_10278471 Ga0207661_102784712 288
319 3300025945 Ga0207679_10020713 Ga0207679_100207133 288
320 3300025949 Ga0207667_10007087 Ga0207667_100070873 288
321 3300025949 Ga0207667_10052698 Ga0207667_100526983 288
322 3300025960 Ga0207651_10075531 Ga0207651_100755313 288
323 3300026041 Ga0207639_10072063 Ga0207639_100720631 288
324 3300026078 Ga0207702_10009328 Ga0207702_100093284 288
325 3300026078 Ga0207702_10049710 Ga0207702_100497103 288
326 3300026116 Ga0207674_10198404 Ga0207674_101984042 288
327 3300026142 Ga0207698_10016732 Ga0207698_100167326 288
328 3300026142 Ga0207698_10094599 Ga0207698_100945992 288
329 3300026142 Ga0207698_10188145 Ga0207698_101881452 288
330 3300028800 Ga0265338_10019112 Ga0265338_100191124 288
331 3300030763 Ga0265763_1000130 Ga0265763_10001303 288
332 3300031090 Ga0265760_10003527 Ga0265760_100035272 288
333 3300031239 Ga0265328_10049580 Ga0265328_100495802 288
334 3300031241 Ga0265325_10003212 Ga0265325_100032124 288
335 3300031241 Ga0265325_10013664 Ga0265325_100136643 288
336 3300031241 Ga0265325_10024598 Ga0265325_100245982 288
337 3300031249 Ga0265339_10009667 Ga0265339_100096674 288
338 3300031251 Ga0265327_10088605 Ga0265327_100886052 288
339 3300031344 Ga0265316_10131757 Ga0265316_101317572 288
340 3300031344 Ga0265316_10307742 Ga0265316_103077422 288
341 3300031595 Ga0265313_10003868 Ga0265313_100038685 288
342 3300031595 Ga0265313_10011604 Ga0265313_100116044 288
343 3300031595 Ga0265313_10012272 Ga0265313_100122724 288
344 3300031595 Ga0265313_10067406 Ga0265313_100674062 288
345 3300031711 Ga0265314_10027257 Ga0265314_100272573 288
346 3300031712 Ga0265342_10033596 Ga0265342_100335963 288
347 3300035083 Ga0373926_0001584 Ga0373926_0001584_761_1744 288
348 3300035089 Ga0373944_0006083 Ga0373944_0006083_2134_3117 288
349 3300035113 Ga0373936_0019043 Ga0373936_0019043_66_1049 288
350 3300035116 Ga0373945_0010199 Ga0373945_0010199_1114_2097 288
351 3300035116 Ga0373945_0062276 Ga0373945_0062276_122_1105 288
352 3300035120 Ga0373957_0037132 Ga0373957_0037132_841_1791 288
353 3300035170 Ga0373943_0000567 Ga0373943_0000567_12280_13263 288
354 3300035170 Ga0373943_0076182 Ga0373943_0076182_666_1649 288
355 3300035692 Ga0373935_0010070 Ga0373935_0010070_4501_5484 288
356 3300035695 Ga0373927_0002426 Ga0373927_0002426_8523_9506 288
357 3300035695 Ga0373927_0094897 Ga0373927_0094897_791_1774 288
358 3300035724 Ga0373933_0007585 Ga0373933_0007585_995_1945 288
359 3300035725 Ga0373947_0000239 Ga0373947_0000239_1173_2156 288
360 3300036401 Ga0373937_0015432 Ga0373937_0015432_1898_2848 288
361 3300037068 Ga0373925_0003922 Ga0373925_0003922_4223_5206 288
362 3300037418 Ga0395900_0016637 Ga0395900_0016637_1435_2385 288
363 3300037418 Ga0395900_0219332 Ga0395900_0219332_391_1377 288
364 3300037466 Ga0395898_0009907 Ga0395898_0009907_1517_2467 288
365 3300037466 Ga0395898_0023179 Ga0395898_0023179_4458_5408 288
366 3300037471 Ga0395905_0000959 Ga0395905_0000959_2419_3369 288
367 3300037471 Ga0395905_0031876 Ga0395905_0031876_138_1124 288
368 3300037471 Ga0395905_0423719 Ga0395905_0423719_234_1187 288
369 3300037471 Ga0395905_0433041 Ga0395905_0433041_23_973 288
370 3300037853 Ga0436364_0023207 Ga0436364_0023207_92_1075 288
371 3300038443 Ga0395901_0008727 Ga0395901_0008727_76_1026 288
372 3300038443 Ga0395901_0010245 Ga0395901_0010245_922_1872 288
373 3300038443 Ga0395901_0019507 Ga0395901_0019507_395_1381 288
374 3300038443 Ga0395901_0053886 Ga0395901_0053886_505_1455 288
375 3300039437 Ga0436365_0820808 Ga0436365_0820808_3538_4536 288
376 3300039437 Ga0436365_0879462 Ga0436365_0879462_1645_2595 288
377 3300039437 Ga0436365_1416688 Ga0436365_1416688_1547_2545 288
378 3300039447 Ga0436361_0119961 Ga0436361_0119961_2623_3573 288
379 3300039447 Ga0436361_0383944 Ga0436361_0383944_222_1172 288
380 3300039450 Ga0436363_1547701 Ga0436363_1547701_6930_7937 288
381 3300044656 Ga0466969_0004132 Ga0466969_0004132_2250_3200 288
382 3300044656 Ga0466969_0094736 Ga0466969_0094736_325_1275 288
383 3300044658 Ga0466972_0040047 Ga0466972_0040047_999_1949 288
384 3300044683 Ga0466965_0135475 Ga0466965_0135475_161_1111 288
385 3300044693 Ga0466961_0146582 Ga0466961_0146582_412_1362 288
386 3300044694 Ga0466963_0253548 Ga0466963_0253548_189_1208 288
387 3300044735 Ga0466968_0017684 Ga0466968_0017684_1214_2164 288
388 3300045049 Ga0466959_0012090 Ga0466959_0012090_4410_5360 288
389 3300045976 Ga0466967_0205382 Ga0466967_0205382_190_1206 288
390 3300045976 Ga0466967_0592079 Ga0466967_0592079_48_998 288
391 3300046459 Ga0495629_0081455 Ga0495629_0081455_1101_2084 288
392 3300046472 Ga0495580_0099745 Ga0495580_0099745_509_1492 288
393 3300046475 Ga0495639_0094443 Ga0495639_0094443_138_1121 288
394 3300046476 Ga0495662_0000280 Ga0495662_0000280_12913_13896 288
395 3300046477 Ga0495664_0000112 Ga0495664_0000112_24989_25972 288
396 3300046514 Ga0495618_0001016 Ga0495618_0001016_12352_13335 288
397 3300046517 Ga0495630_0009608 Ga0495630_0009608_770_1753 288
398 3300046529 Ga0495652_0038922 Ga0495652_0038922_2966_3949 288
399 3300046531 Ga0495665_0039801 Ga0495665_0039801_618_1601 288
400 3300046533 Ga0495640_0000871 Ga0495640_0000871_17307_18290 288
401 3300046533 Ga0495640_0056152 Ga0495640_0056152_1305_2285 288
402 3300046543 Ga0495645_0013723 Ga0495645_0013723_751_1734 288
403 3300046642 Ga0495634_0003493 Ga0495634_0003493_6374_7357 288
404 3300046663 Ga0495635_0002093 Ga0495635_0002093_7203_8186 288
405 3300046663 Ga0495635_0099800 Ga0495635_0099800_247_1230 288
406 3300046809 Ga0495600_0086592 Ga0495600_0086592_311_1294 288
407 3300047315 Ga0495581_0107168 Ga0495581_0107168_33_1016 288
408 3300047319 Ga0495674_0001513 Ga0495674_0001513_5515_6498 288
409 3300047321 Ga0495676_0094685 Ga0495676_0094685_407_1390 288
410 3300047471 Ga0495684_0000264 Ga0495684_0000264_35150_36133 288
411 3300047471 Ga0495684_0001309 Ga0495684_0001309_5574_6557 288
412 3300047673 Ga0495593_0046702 Ga0495593_0046702_368_1351 288
413 3300048088 Ga0495602_0057307 Ga0495602_0057307_1982_2962 288
414 3300048907 Ga0496104_0002375 Ga0496104_0002375_8910_9911 288
415 3300048907 Ga0496104_0348629 Ga0496104_0348629_372_1352 288
416 3300048908 Ga0496105_0073659 Ga0496105_0073659_968_1918 288
417 3300048913 Ga0496110_0057240 Ga0496110_0057240_1727_2728 288
418 3300048917 Ga0496114_0208341 Ga0496114_0208341_204_1154 288
419 3300048929 Ga0496126_0045311 Ga0496126_0045311_2171_3148 288
420 3300049570 Ga0501033_0058333 Ga0501033_0058333_1226_2218 288
421 3300049571 Ga0501034_0033479 Ga0501034_0033479_1101_2051 288
422 3300049573 Ga0501037_0170286 Ga0501037_0170286_326_1279 288
423 3300049589 Ga0501073_0008747 Ga0501073_0008747_6043_6993 288
424 3300049589 Ga0501073_0040900 Ga0501073_0040900_411_1364 288
425 3300049744 Ga0501083_0174101 Ga0501083_0174101_372_1325 288
426 3300053077 Ga0495601_0025314 Ga0495601_0025314_1925_2908 288
427 3300053078 Ga0495612_0000308 Ga0495612_0000308_16321_17304 288
428 3300053085 Ga0495619_0001598 Ga0495619_0001598_4659_5642 288
429 3300053093 Ga0500651_0005202 Ga0500651_0005202_2756_3709 288
430 3300053103 Ga0500555_001630 Ga0500555_001630_549_1502 288
431 3300053142 Ga0500577_0066419 Ga0500577_0066419_160_1113 288
432 3300054114 Ga0501084_0055484 Ga0501084_0055484_1997_2950 288
433 iso_pu_bacteria 2728368998 2728753089 288
434 iso_pu_bacteria 2844315083 2844319514 288
435 iso_pu_bacteria 2883354860 2883356742 288
436 iso_pu_bacteria 2903727486 2903734450 288
437 iso_pu_bacteria 2906602504 2906609246 288
438 iso_pu_bacteria 2906610324 2906618526 288
439 iso_pu_bacteria 2908739725 2908742805 288
440 iso_pu_bacteria 3005718088 3005722730 288

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

48

318

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2nq2-assembly1.cif.gz_B an inward-facing conformation of a putative metal-chelate type abc transporter. 0.478 31 274
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.4669 31 274
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4551 31 286
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.4465 31 274
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4299 31 286
ID Description Score Start End Superfamily
af_Q58666_4_320_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7212 33 273 1.10.3470.10
af_P0AFS1_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7163 32 271 1.10.3470.10
af_P77672_36_301_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6987 31 270 1.10.3470.10
af_P23200_41_325_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6895 32 271 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.6875 31 270 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A5E4UUL1-F1-model_v4 Inner-membrane translocator 0.9383 1 288 GO:0005886
GO:0015658
AF-A0A5E4UUL1-F1-model_v4 Inner-membrane translocator 0.9351 1 288 GO:0005886
GO:0015658
AF-A0A2Z3J2B3-F1-model_v4 Branched-chain amino acid transport system permease protein LivM 0.935 2 288 GO:0005886
GO:0015658
AF-A0A522TNS8-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9306 11 286 GO:0005886
GO:0015658
AF-A0A2Z3J2B3-F1-model_v4 Branched-chain amino acid transport system permease protein LivM 0.9286 2 288 GO:0005886
GO:0015658

Feature Viewer

pLDDT pTM Quality
81.39 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map