F444305

General Info

Members Datasets Scaffolds Average Seq Length
439 257 876 110

Family's Representative Sequence

Representative Sequence 3300049742|Ga0501080_1602112|Ga0501080_1602112_147_515
Length 122
Sequence LNLEPTQEKAMKKIEAVIRHFKLEEVKDALHNKGVQGMTVTEVRGFGRQKGHTETYRGAEYAVDFLPKVKIEVVVGDKDSAGIIETIINAARTGQVGDGKIFVSTLDEVVRIRTGETAQAAV

Samples

Sample ID Description Type Environment
1 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
66 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
74 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
82 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
83 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
84 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
85 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
87 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
94 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
151 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
157 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
161 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
162 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
163 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
170 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
171 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
174 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
175 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
176 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
177 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
178 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
179 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
180 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
181 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
185 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
190 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
191 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
194 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
195 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
202 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
207 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
215 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
234 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
235 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
236 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
237 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
238 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
246 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
251 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
252 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
253 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
254 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.68
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.74
Nodule 0
Rhizoplane 4.33
Rhizosphere 86.79
Stem 0
Stem Tuber 0
Unclassified 2.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501080_1602112 3300049742 Bacteria 551
2 JGI24749J21850_1007958 3300002076 Bacteria 1475
3 rootH2_10004831 3300003320 Bacteria 51386
4 rootL2_10125431 3300003322 Bacteria 4764
5 Ga0065704_10004441 3300005289 Bacteria 5056
6 Ga0065707_10780159 3300005295 Bacteria 607
7 Ga0070676_10173753 3300005328 Bacteria 1396
8 Ga0070676_11321346 3300005328 Bacteria 551
9 Ga0070690_100014961 3300005330 Bacteria 4615
10 Ga0070690_100603249 3300005330 Bacteria 833
11 Ga0070677_10025028 3300005333 Bacteria 2225
12 Ga0068869_100015922 3300005334 Bacteria 5059
13 Ga0068869_101030378 3300005334 Bacteria 718
14 Ga0070666_10089137 3300005335 Bacteria 2117
15 Ga0070666_10276999 3300005335 Bacteria 1192
16 Ga0070666_10294178 3300005335 Bacteria 1156
17 Ga0070680_100459340 3300005336 Bacteria 1088
18 Ga0070682_100216673 3300005337 Bacteria 1360
19 Ga0070682_100567010 3300005337 Bacteria 891
20 Ga0068868_100251132 3300005338 Bacteria 1489
21 Ga0068868_100805897 3300005338 Bacteria 848
22 Ga0068868_101934940 3300005338 Bacteria 559
23 Ga0070660_100679254 3300005339 Bacteria 863
24 Ga0070689_100129161 3300005340 Bacteria 2025
25 Ga0070687_100016930 3300005343 Bacteria 3340
26 Ga0070692_10704985 3300005345 Bacteria 680
27 Ga0070668_100045255 3300005347 Bacteria 3377
28 Ga0070668_100675675 3300005347 Bacteria 909
29 Ga0070669_100056822 3300005353 Bacteria 2870
30 Ga0070675_100049254 3300005354 Bacteria 3457
31 Ga0070671_100821682 3300005355 Bacteria 810
32 Ga0070671_100948224 3300005355 Bacteria 753
33 Ga0070673_100140193 3300005364 Bacteria 2038
34 Ga0070688_100015049 3300005365 Bacteria 4392
35 Ga0070659_100174628 3300005366 Bacteria 1762
36 Ga0070667_100032857 3300005367 Bacteria 4330
37 Ga0070701_10008937 3300005438 Bacteria 4363
38 Ga0070711_100826268 3300005439 Bacteria 787
39 Ga0070705_100038500 3300005440 Unclassified 2706
40 Ga0070705_100183962 3300005440 Bacteria 1418
41 Ga0070705_100275463 3300005440 Unclassified 1194
42 Ga0070705_100576210 3300005440 Bacteria 867
43 Ga0070700_100741715 3300005441 Bacteria 785
44 Ga0070700_101336495 3300005441 Bacteria 603
45 Ga0070694_100032865 3300005444 Bacteria 3409
46 Ga0070694_100322756 3300005444 Bacteria 1189
47 Ga0070708_100295028 3300005445 Bacteria 1526
48 Ga0070663_100008178 3300005455 Bacteria 6418
49 Ga0070678_100077333 3300005456 Bacteria 2510
50 Ga0070678_100295844 3300005456 Bacteria 1374
51 Ga0070678_101127785 3300005456 Bacteria 725
52 Ga0070662_100329131 3300005457 Bacteria 1248
53 Ga0070681_10563541 3300005458 Bacteria 1053
54 Ga0068867_100009449 3300005459 Bacteria 6875
55 Ga0070685_10044539 3300005466 Bacteria 2540
56 Ga0070706_100093705 3300005467 Bacteria 2787
57 Ga0070707_100252932 3300005468 Bacteria 1715
58 Ga0070707_101374494 3300005468 Unclassified 673
59 Ga0070698_100010752 3300005471 Bacteria 9739
60 Ga0070699_100067717 3300005518 Bacteria 3101
61 Ga0070699_100168746 3300005518 Bacteria 1939
62 Ga0070699_101002597 3300005518 Bacteria 766
63 Ga0070699_101968240 3300005518 Bacteria 534
64 Ga0070697_100316676 3300005536 Bacteria 1343
65 Ga0070697_100985100 3300005536 Bacteria 749
66 Ga0068853_100011715 3300005539 Bacteria 7126
67 Ga0068853_100536572 3300005539 Bacteria 1107
68 Ga0070672_100276560 3300005543 Bacteria 1418
69 Ga0070686_100046204 3300005544 Bacteria 2746
70 Ga0070686_100364179 3300005544 Bacteria 1090
71 Ga0070695_100247824 3300005545 Bacteria 1295
72 Ga0070695_101512979 3300005545 Bacteria 559
73 Ga0070696_100174667 3300005546 Bacteria 1590
74 Ga0070696_100259995 3300005546 Bacteria 1316
75 Ga0070696_101420069 3300005546 Bacteria 592
76 Ga0070693_100082950 3300005547 Bacteria 1915
77 Ga0070665_100001425 3300005548 Bacteria 28047
78 Ga0070665_100440546 3300005548 Bacteria 1312
79 Ga0070665_100559284 3300005548 Bacteria 1156
80 Ga0070704_100978823 3300005549 Unclassified 764
81 Ga0070664_101745695 3300005564 Bacteria 590
82 Ga0068857_100042597 3300005577 Bacteria 4028
83 Ga0068854_100566322 3300005578 Bacteria 966
84 Ga0070702_100149704 3300005615 Bacteria 1496
85 Ga0068852_101942146 3300005616 Bacteria 611
86 Ga0068859_100121799 3300005617 Bacteria 2675
87 Ga0068859_102006521 3300005617 Bacteria 639
88 Ga0068864_100632734 3300005618 Bacteria 1040
89 Ga0068864_100945423 3300005618 Bacteria 853
90 Ga0068866_10919283 3300005718 Bacteria 617
91 Ga0068861_100057066 3300005719 Bacteria 2982
92 Ga0068861_100167004 3300005719 Bacteria 1820
93 Ga0068861_100896353 3300005719 Bacteria 839
94 Ga0068870_10014332 3300005840 Bacteria 3744
95 Ga0068870_11137645 3300005840 Bacteria 563
96 Ga0068863_101358944 3300005841 Bacteria 718
97 Ga0068863_101540932 3300005841 Bacteria 673
98 Ga0068858_100181145 3300005842 Bacteria 1989
99 Ga0068858_100387367 3300005842 Bacteria 1342
100 Ga0068858_101869996 3300005842 Bacteria 593
101 Ga0068858_102290932 3300005842 Bacteria 534
102 Ga0068860_100082713 3300005843 Bacteria 3053
103 Ga0068860_100431562 3300005843 Bacteria 1307
104 Ga0068860_101244732 3300005843 Bacteria 765
105 Ga0068860_101248209 3300005843 Bacteria 764
106 Ga0068860_102029820 3300005843 Bacteria 596
107 Ga0068860_102068074 3300005843 Bacteria 591
108 Ga0081455_10036703 3300005937 Bacteria 4359
109 Ga0081455_11038194 3300005937 Bacteria 507
110 Ga0075365_10211047 3300006038 Bacteria 1361
111 Ga0075368_10281305 3300006042 Bacteria 715
112 Ga0075363_100048015 3300006048 Bacteria 2269
113 Ga0075364_10053057 3300006051 Bacteria 2650
114 Ga0075364_10366873 3300006051 Bacteria 982
115 Ga0070716_100146543 3300006173 Bacteria 1513
116 Ga0075362_10164837 3300006177 Bacteria 1068
117 Ga0075367_10007522 3300006178 Bacteria 5584
118 Ga0075367_10031024 3300006178 Bacteria 3068
119 Ga0075367_10084853 3300006178 Bacteria 1921
120 Ga0075366_10003246 3300006195 Bacteria 8545
121 Ga0075366_10107532 3300006195 Bacteria 1677
122 Ga0097621_100313874 3300006237 Bacteria 1387
123 Ga0097621_100489498 3300006237 Bacteria 1113
124 Ga0075370_10339207 3300006353 Bacteria 897
125 Ga0068871_100672455 3300006358 Bacteria 947
126 Ga0075428_100153059 3300006844 Bacteria 2505
127 Ga0075428_100203504 3300006844 Bacteria 2140
128 Ga0075428_101816491 3300006844 Bacteria 634
129 Ga0075428_102417104 3300006844 Bacteria 539
130 Ga0075430_100082580 3300006846 Bacteria 2693
131 Ga0075430_100240374 3300006846 Bacteria 1501
132 Ga0075431_100300287 3300006847 Bacteria 1622
133 Ga0075433_10032883 3300006852 Bacteria 4444
134 Ga0075433_10500357 3300006852 Bacteria 1070
135 Ga0075434_101358949 3300006871 Bacteria 721
136 Ga0075429_100190774 3300006880 Bacteria 1795
137 Ga0068865_100023789 3300006881 Bacteria 4015
138 Ga0068865_100310296 3300006881 Bacteria 1265
139 Ga0075436_101389053 3300006914 Unclassified 532
140 Ga0097620_100121798 3300006931 Bacteria 2675
141 Ga0097620_102006528 3300006931 Bacteria 639
142 Ga0075435_101795485 3300007076 Unclassified 538
143 Ga0099794_10006650 3300007265 Bacteria 4696
144 Ga0111539_10036516 3300009094 Bacteria 5940
145 Ga0111539_11482038 3300009094 Bacteria 787
146 Ga0111539_13281352 3300009094 Bacteria 521
147 Ga0105245_10044747 3300009098 Bacteria 3952
148 Ga0105245_12019279 3300009098 Bacteria 630
149 Ga0105247_10044886 3300009101 Bacteria 2711
150 Ga0105247_10539040 3300009101 Bacteria 856
151 Ga0105247_10564226 3300009101 Bacteria 839
152 Ga0105247_10730626 3300009101 Bacteria 748
153 Ga0114129_10104588 3300009147 Bacteria 3913
154 Ga0114129_12456882 3300009147 Bacteria 623
155 Ga0105243_10021572 3300009148 Bacteria 4890
156 Ga0105243_11092969 3300009148 Unclassified 805
157 Ga0105243_11803275 3300009148 Bacteria 643
158 Ga0105242_10070866 3300009176 Bacteria 2891
159 Ga0105242_10120179 3300009176 Bacteria 2253
160 Ga0105242_11238509 3300009176 Bacteria 767
161 Ga0105248_10067193 3300009177 Bacteria 4024
162 Ga0105248_12773469 3300009177 Bacteria 559
163 Ga0105238_10000061 3300009551 Bacteria 127766
164 Ga0105249_10118879 3300009553 Bacteria 2509
165 Ga0105249_10455154 3300009553 Bacteria 1319
166 Ga0105249_10867310 3300009553 Bacteria 969
167 Ga0105249_12203691 3300009553 Bacteria 624
168 Ga0099796_10059774 3300010159 Bacteria 1347
169 Ga0105239_10117333 3300010375 Bacteria 2954
170 Ga0105239_11155406 3300010375 Bacteria 892
171 Ga0105246_10055063 3300011119 Bacteria 2744
172 Ga0105246_10464503 3300011119 Bacteria 1067
173 Ga0157373_10594136 3300013100 Unclassified 805
174 Ga0157374_10701124 3300013296 Bacteria 1025
175 Ga0157374_12773450 3300013296 Bacteria 518
176 Ga0157378_10082241 3300013297 Bacteria 2912
177 Ga0157378_10317405 3300013297 Bacteria 1513
178 Ga0157378_10944041 3300013297 Bacteria 895
179 Ga0163162_10609847 3300013306 Bacteria 1217
180 Ga0163162_11836181 3300013306 Bacteria 693
181 Ga0157375_10027765 3300013308 Bacteria 5295
182 Ga0157375_11722643 3300013308 Bacteria 742
183 Ga0157375_12127084 3300013308 Bacteria 668
184 Ga0163163_10965740 3300014325 Bacteria 915
185 Ga0163163_11939491 3300014325 Bacteria 649
186 Ga0157380_10009377 3300014326 Bacteria 7009
187 Ga0157380_11444357 3300014326 Bacteria 739
188 Ga0157377_10010072 3300014745 Bacteria 4666
189 Ga0157379_10105351 3300014968 Bacteria 2531
190 Ga0157379_10429043 3300014968 Bacteria 1218
191 Ga0157379_10510617 3300014968 Bacteria 1115
192 Ga0157376_10239911 3300014969 Bacteria 1688
193 Ga0207642_10271976 3300025899 Bacteria 971
194 Ga0207642_10504389 3300025899 Bacteria 741
195 Ga0207710_10112524 3300025900 Bacteria 1293
196 Ga0207680_10432616 3300025903 Bacteria 933
197 Ga0207680_11002577 3300025903 Bacteria 598
198 Ga0207645_10205143 3300025907 Bacteria 1297
199 Ga0207643_10024025 3300025908 Bacteria 3363
200 Ga0207643_10268861 3300025908 Bacteria 1054
201 Ga0207684_10314989 3300025910 Bacteria 1349
202 Ga0207684_11467623 3300025910 Bacteria 556
203 Ga0207654_10610171 3300025911 Bacteria 779
204 Ga0207663_10541574 3300025916 Bacteria 909
205 Ga0207663_10939613 3300025916 Bacteria 692
206 Ga0207663_11313565 3300025916 Bacteria 582
207 Ga0207662_10004292 3300025918 Bacteria 7481
208 Ga0207646_10527667 3300025922 Bacteria 1063
209 Ga0207646_10594342 3300025922 Bacteria 994
210 Ga0207681_10455442 3300025923 Bacteria 1041
211 Ga0207659_10053457 3300025926 Bacteria 2881
212 Ga0207687_10065656 3300025927 Bacteria 2577
213 Ga0207687_11425490 3300025927 Bacteria 595
214 Ga0207644_10789067 3300025931 Bacteria 794
215 Ga0207690_10299283 3300025932 Bacteria 1258
216 Ga0207706_10047821 3300025933 Bacteria 3784
217 Ga0207686_10069444 3300025934 Bacteria 2260
218 Ga0207686_10204598 3300025934 Bacteria 1416
219 Ga0207686_11351160 3300025934 Unclassified 586
220 Ga0207709_10062630 3300025935 Bacteria 2329
221 Ga0207670_10282406 3300025936 Bacteria 1294
222 Ga0207669_10017001 3300025937 Bacteria 3717
223 Ga0207704_10081033 3300025938 Bacteria 2098
224 Ga0207691_10013783 3300025940 Bacteria 7724
225 Ga0207711_10037930 3300025941 Bacteria 4096
226 Ga0207711_10049134 3300025941 Bacteria 3611
227 Ga0207689_10013347 3300025942 Bacteria 7010
228 Ga0207689_10057133 3300025942 Bacteria 3210
229 Ga0207689_10066429 3300025942 Bacteria 2965
230 Ga0207689_10764484 3300025942 Bacteria 815
231 Ga0207651_10409226 3300025960 Bacteria 1155
232 Ga0207651_11008095 3300025960 Bacteria 744
233 Ga0207712_10216935 3300025961 Bacteria 1527
234 Ga0207712_12047936 3300025961 Bacteria 512
235 Ga0207668_10673029 3300025972 Bacteria 907
236 Ga0207658_10065872 3300025986 Bacteria 2723
237 Ga0207677_10858552 3300026023 Bacteria 816
238 Ga0207677_11287159 3300026023 Bacteria 671
239 Ga0207677_11545177 3300026023 Bacteria 614
240 Ga0207703_10032108 3300026035 Bacteria 4155
241 Ga0207703_10585581 3300026035 Bacteria 1054
242 Ga0207703_11536972 3300026035 Bacteria 640
243 Ga0207703_12228467 3300026035 Bacteria 524
244 Ga0207639_10022209 3300026041 Bacteria 4568
245 Ga0207639_11699727 3300026041 Bacteria 591
246 Ga0207678_10012478 3300026067 Bacteria 7462
247 Ga0207678_10791276 3300026067 Bacteria 837
248 Ga0207708_10016553 3300026075 Bacteria 5546
249 Ga0207708_10228822 3300026075 Bacteria 1492
250 Ga0207708_10563719 3300026075 Bacteria 962
251 Ga0207641_10028523 3300026088 Bacteria 4613
252 Ga0207648_10002547 3300026089 Bacteria 19539
253 Ga0207676_10410834 3300026095 Bacteria 1267
254 Ga0207674_10148782 3300026116 Unclassified 2299
255 Ga0207674_10150243 3300026116 Bacteria 2287
256 Ga0207675_100012880 3300026118 Bacteria 7813
257 Ga0207675_100228479 3300026118 Bacteria 1795
258 Ga0207675_101757024 3300026118 Bacteria 640
259 Ga0207683_10052142 3300026121 Bacteria 3584
260 Ga0207683_10291833 3300026121 Bacteria 1491
261 Ga0210000_1081480 3300027462 Bacteria 531
262 Ga0209813_10135181 3300027866 Bacteria 871
263 Ga0209813_10493620 3300027866 Bacteria 507
264 Ga0209974_10147889 3300027876 Bacteria 846
265 Ga0207428_10009418 3300027907 Bacteria 8753
266 Ga0207428_10529835 3300027907 Bacteria 853
267 Ga0268266_10001080 3300028379 Bacteria 34157
268 Ga0268266_10304334 3300028379 Bacteria 1488
269 Ga0268266_10827762 3300028379 Bacteria 894
270 Ga0268265_11229260 3300028380 Bacteria 747
271 Ga0268264_10036506 3300028381 Bacteria 4050
272 Ga0268264_10200045 3300028381 Bacteria 1827
273 Ga0268264_10293480 3300028381 Bacteria 1528
274 Ga0268264_11226414 3300028381 Bacteria 760
275 Ga0268264_11809093 3300028381 Bacteria 621
276 Ga0268264_12597877 3300028381 Bacteria 511
277 Ga0265337_1042501 3300028556 Bacteria 1303
278 Ga0265318_10041483 3300028577 Bacteria 1750
279 Ga0265338_10008796 3300028800 Bacteria 12190
280 Ga0265338_10056753 3300028800 Bacteria 3469
281 Ga0265338_10323852 3300028800 Bacteria 1115
282 Ga0265760_10003703 3300031090 Bacteria 4430
283 Ga0265330_10004915 3300031235 Bacteria 6730
284 Ga0265330_10046719 3300031235 Bacteria 1907
285 Ga0265330_10256710 3300031235 Bacteria 736
286 Ga0265332_10000389 3300031238 Bacteria 32067
287 Ga0265332_10112847 3300031238 Bacteria 1144
288 Ga0265328_10001578 3300031239 Bacteria 10504
289 Ga0265320_10176756 3300031240 Bacteria 958
290 Ga0265325_10007612 3300031241 Bacteria 6474
291 Ga0265339_10010260 3300031249 Bacteria 5828
292 Ga0265339_10102067 3300031249 Bacteria 1491
293 Ga0265331_10000104 3300031250 Bacteria 115035
294 Ga0265331_10000436 3300031250 Bacteria 41211
295 Ga0265331_10075982 3300031250 Bacteria 1566
296 Ga0265327_10006024 3300031251 Bacteria 9842
297 Ga0265327_10072847 3300031251 Bacteria 1715
298 Ga0265327_10137308 3300031251 Bacteria 1145
299 Ga0265327_10306205 3300031251 Unclassified 699
300 Ga0265316_10000047 3300031344 Bacteria 129137
301 Ga0265316_10319358 3300031344 Bacteria 1128
302 Ga0265316_10634850 3300031344 Bacteria 756
303 Ga0265316_11251840 3300031344 Bacteria 513
304 Ga0265313_10002303 3300031595 Bacteria 16728
305 Ga0316575_10109765 3300031665 Bacteria 1125
306 Ga0316579_10048233 3300031691 Bacteria 1989
307 Ga0316579_10359840 3300031691 Bacteria 704
308 Ga0265314_10000168 3300031711 Bacteria 98154
309 Ga0265314_10000890 3300031711 Bacteria 35600
310 Ga0265314_10115843 3300031711 Bacteria 1695
311 Ga0265342_10011969 3300031712 Bacteria 5896
312 Ga0265342_10012216 3300031712 Bacteria 5824
313 Ga0316576_10090099 3300031727 Bacteria 2284
314 Ga0316576_10751138 3300031727 Bacteria 704
315 Ga0316578_10002691 3300031728 Bacteria 7907
316 Ga0316578_10016808 3300031728 Bacteria 3969
317 Ga0316577_10004968 3300031733 Bacteria 6936
318 Ga0316577_10645715 3300031733 Bacteria 602
319 Ga0307415_100059981 3300032126 Bacteria 2627
320 Ga0316583_10135616 3300032133 Bacteria 858
321 Ga0316585_10034515 3300032137 Bacteria 1599
322 Ga0373929_0105781 3300035085 Bacteria 714
323 Ga0373934_0449649 3300035086 Bacteria 540
324 Ga0373939_0040102 3300035114 Bacteria 1405
325 Ga0373946_0127481 3300035171 Bacteria 1168
326 Ga0373942_0311236 3300035207 Bacteria 549
327 Ga0316574_0014308 3300035398 Bacteria 4582
328 Ga0316574_0199871 3300035398 Bacteria 1284
329 Ga0373931_0089425 3300035691 Bacteria 1713
330 Ga0373931_0091592 3300035691 Bacteria 1695
331 Ga0373935_1005449 3300035692 Bacteria 619
332 Ga0373933_0032615 3300035724 Bacteria 3028
333 Ga0316582_0001917 3300036647 Bacteria 9487
334 Ga0316582_0281313 3300036647 Bacteria 1142
335 Ga0316584_0007522 3300036712 Bacteria 7460
336 Ga0316584_0055067 3300036712 Bacteria 2978
337 Ga0316584_0655134 3300036712 Bacteria 723
338 Ga0436364_0886105 3300037853 Bacteria 857
339 Ga0436363_0520348 3300039450 Bacteria 560
340 Ga0451843_0422607 3300041509 Bacteria 506
341 Ga0451577_0000179 3300042876 Bacteria 137689
342 Ga0453683_0000324 3300044673 Bacteria 58910
343 Ga0453683_0146406 3300044673 Bacteria 1492
344 Ga0453684_0000033 3300044712 Bacteria 734012
345 Ga0453684_0370432 3300044712 Bacteria 1610
346 Ga0453684_1275751 3300044712 Bacteria 767
347 Ga0451576_0916053 3300045051 Bacteria 919
348 Ga0495638_0018225 3300046460 Bacteria 4665
349 Ga0495587_0248240 3300046536 Bacteria 1001
350 Ga0495621_0526937 3300046539 Bacteria 512
351 Ga0495669_0034865 3300046684 Bacteria 2219
352 Ga0495669_0634801 3300046684 Bacteria 519
353 Ga0495675_0635768 3300047444 Bacteria 602
354 Ga0495602_0498105 3300048088 Bacteria 852
355 Ga0496100_0941502 3300048903 Bacteria 679
356 Ga0496101_0129597 3300048904 Bacteria 1914
357 Ga0496101_0444983 3300048904 Bacteria 1022
358 Ga0496104_0043117 3300048907 Bacteria 4237
359 Ga0496104_0501080 3300048907 Bacteria 1125
360 Ga0496104_1172211 3300048907 Bacteria 672
361 Ga0496105_0409068 3300048908 Bacteria 1076
362 Ga0496106_0188182 3300048909 Bacteria 1640
363 Ga0496106_1265610 3300048909 Bacteria 574
364 Ga0496109_0242736 3300048912 Bacteria 1696
365 Ga0496109_0874222 3300048912 Bacteria 837
366 Ga0496110_0296219 3300048913 Bacteria 1474
367 Ga0496110_0442627 3300048913 Bacteria 1184
368 Ga0496111_0382628 3300048914 Bacteria 1041
369 Ga0496111_0430939 3300048914 Bacteria 974
370 Ga0496112_0823974 3300048915 Bacteria 852
371 Ga0496114_0023849 3300048917 Bacteria 4993
372 Ga0496114_1285183 3300048917 Bacteria 618
373 Ga0496115_0068492 3300048918 Bacteria 2873
374 Ga0501305_107593 3300049161 Bacteria 525
375 Ga0501034_0100082 3300049571 Bacteria 2893
376 Ga0501034_0295664 3300049571 Bacteria 1557
377 Ga0501034_0419830 3300049571 Bacteria 1259
378 Ga0501034_0677299 3300049571 Bacteria 931
379 Ga0501034_1327562 3300049571 Bacteria 595
380 Ga0501036_0314634 3300049572 Bacteria 1309
381 Ga0501038_0177133 3300049574 Bacteria 1723
382 Ga0501047_0071665 3300049581 Bacteria 3335
383 Ga0501068_0074056 3300049584 Bacteria 2081
384 Ga0501069_0032523 3300049585 Bacteria 2871
385 Ga0501070_0006898 3300049586 Bacteria 9664
386 Ga0501070_0101514 3300049586 Bacteria 2379
387 Ga0501070_1103669 3300049586 Bacteria 612
388 Ga0501071_0051748 3300049587 Bacteria 2961
389 Ga0501072_0016267 3300049588 Bacteria 5707
390 Ga0501073_0004588 3300049589 Bacteria 10383
391 Ga0501073_1252078 3300049589 Bacteria 509
392 Ga0501074_0046393 3300049590 Bacteria 3141
393 Ga0501076_1657731 3300049592 Bacteria 525
394 Ga0501079_0185841 3300049741 Bacteria 1622
395 Ga0501080_0108914 3300049742 Bacteria 2567
396 Ga0501080_0366038 3300049742 Bacteria 1300
397 Ga0501083_0912418 3300049744 Bacteria 572
398 Ga0501044_0072709 3300049823 Bacteria 3496
399 Ga0501044_0160500 3300049823 Bacteria 2225
400 Ga0501044_0525708 3300049823 Bacteria 1082
401 nmdc:mga03683_22391_c1 3300050489 Bacteria 2450
402 nmdc:mga03n38_208604_c1 3300050490 Bacteria 1014
403 nmdc:mga03n38_568027_c1 3300050490 Bacteria 643
404 nmdc:mga03n38_91221_c1 3300050490 Bacteria 1451
405 nmdc:mga00v17_1087219_c1 3300050491 Bacteria 501
406 nmdc:mga00v17_336001_c1 3300050491 Bacteria 982
407 nmdc:mga00v17_72507_c1 3300050491 Bacteria 2137
408 nmdc:mga0yw44_144093_c1 3300050492 Bacteria 1550
409 nmdc:mga0k408_570158_c1 3300050493 Bacteria 668
410 nmdc:mga0k408_698509_c1 3300050493 Bacteria 594
411 nmdc:mga0k408_963_c1 3300050493 Bacteria 15807
412 nmdc:mga06z11_288532_c1 3300050494 Bacteria 973
413 nmdc:mga06z11_45232_c1 3300050494 Bacteria 2225
414 nmdc:mga04h51_250531_c1 3300050495 Bacteria 709
415 nmdc:mga07m45_223155_c1 3300050496 Bacteria 1096
416 nmdc:mga05p37_17207_c1 3300050507 Bacteria 8722
417 nmdc:mga09592_22777_c1 3300050508 Bacteria 5169
418 nmdc:mga0qj67_139078_c1 3300050509 Bacteria 1968
419 nmdc:mga0qj67_23656_c1 3300050509 Bacteria 4727
420 nmdc:mga08y16_224710_c1 3300050511 Bacteria 1943
421 nmdc:mga08y16_99629_c1 3300050511 Bacteria 3026
422 nmdc:mga0n895_104039_c1 3300050512 Bacteria 2851
423 nmdc:mga0rr50_1665571_c1 3300050513 Unclassified 538
424 nmdc:mga0rr50_6124_c1 3300050513 Bacteria 7278
425 nmdc:mga08x19_82282_c1 3300050514 Bacteria 2115
426 nmdc:mga0a205_7282_c1 3300050515 Bacteria 10010
427 Ga0495601_0956268 3300053077 Bacteria 540
428 Ga0495595_0016584 3300053084 Bacteria 3155
429 Ga0495619_0215360 3300053085 Bacteria 1330
430 Ga0500651_0162908 3300053093 Bacteria 1333
431 Ga0500566_0171754 3300053094 Bacteria 1120
432 Ga0500595_022932 3300053119 Bacteria 2199
433 Ga0500652_000069 3300053131 Bacteria 45026
434 Ga0500636_0229874 3300053177 Bacteria 960
435 Ga0501084_0716657 3300054114 Bacteria 843
436 Ga0501084_1235626 3300054114 Bacteria 627
437 Ga0587111_0256754 3300060346 Bacteria 519
438 2846541464 2846540461 Bacteria 5471451
439 Ga0501080_1602112
440 JGI24749J21850_1007958
441 rootH2_10004831
442 rootL2_10125431
443 Ga0065704_10004441
444 Ga0065707_10780159
445 Ga0070676_10173753
446 Ga0070676_11321346
447 Ga0070690_100014961
448 Ga0070690_100603249
449 Ga0070677_10025028
450 Ga0068869_100015922
451 Ga0068869_101030378
452 Ga0070666_10089137
453 Ga0070666_10276999
454 Ga0070666_10294178
455 Ga0070680_100459340
456 Ga0070682_100216673
457 Ga0070682_100567010
458 Ga0068868_100251132
459 Ga0068868_100805897
460 Ga0068868_101934940
461 Ga0070660_100679254
462 Ga0070689_100129161
463 Ga0070687_100016930
464 Ga0070692_10704985
465 Ga0070668_100045255
466 Ga0070668_100675675
467 Ga0070669_100056822
468 Ga0070675_100049254
469 Ga0070671_100821682
470 Ga0070671_100948224
471 Ga0070673_100140193
472 Ga0070688_100015049
473 Ga0070659_100174628
474 Ga0070667_100032857
475 Ga0070701_10008937
476 Ga0070711_100826268
477 Ga0070705_100038500
478 Ga0070705_100183962
479 Ga0070705_100275463
480 Ga0070705_100576210
481 Ga0070700_100741715
482 Ga0070700_101336495
483 Ga0070694_100032865
484 Ga0070694_100322756
485 Ga0070708_100295028
486 Ga0070663_100008178
487 Ga0070678_100077333
488 Ga0070678_100295844
489 Ga0070678_101127785
490 Ga0070662_100329131
491 Ga0070681_10563541
492 Ga0068867_100009449
493 Ga0070685_10044539
494 Ga0070706_100093705
495 Ga0070707_100252932
496 Ga0070707_101374494
497 Ga0070698_100010752
498 Ga0070699_100067717
499 Ga0070699_100168746
500 Ga0070699_101002597
501 Ga0070699_101968240
502 Ga0070697_100316676
503 Ga0070697_100985100
504 Ga0068853_100011715
505 Ga0068853_100536572
506 Ga0070672_100276560
507 Ga0070686_100046204
508 Ga0070686_100364179
509 Ga0070695_100247824
510 Ga0070695_101512979
511 Ga0070696_100174667
512 Ga0070696_100259995
513 Ga0070696_101420069
514 Ga0070693_100082950
515 Ga0070665_100001425
516 Ga0070665_100440546
517 Ga0070665_100559284
518 Ga0070704_100978823
519 Ga0070664_101745695
520 Ga0068857_100042597
521 Ga0068854_100566322
522 Ga0070702_100149704
523 Ga0068852_101942146
524 Ga0068859_100121799
525 Ga0068859_102006521
526 Ga0068864_100632734
527 Ga0068864_100945423
528 Ga0068866_10919283
529 Ga0068861_100057066
530 Ga0068861_100167004
531 Ga0068861_100896353
532 Ga0068870_10014332
533 Ga0068870_11137645
534 Ga0068863_101358944
535 Ga0068863_101540932
536 Ga0068858_100181145
537 Ga0068858_100387367
538 Ga0068858_101869996
539 Ga0068858_102290932
540 Ga0068860_100082713
541 Ga0068860_100431562
542 Ga0068860_101244732
543 Ga0068860_101248209
544 Ga0068860_102029820
545 Ga0068860_102068074
546 Ga0081455_10036703
547 Ga0081455_11038194
548 Ga0075365_10211047
549 Ga0075368_10281305
550 Ga0075363_100048015
551 Ga0075364_10053057
552 Ga0075364_10366873
553 Ga0070716_100146543
554 Ga0075362_10164837
555 Ga0075367_10007522
556 Ga0075367_10031024
557 Ga0075367_10084853
558 Ga0075366_10003246
559 Ga0075366_10107532
560 Ga0097621_100313874
561 Ga0097621_100489498
562 Ga0075370_10339207
563 Ga0068871_100672455
564 Ga0075428_100153059
565 Ga0075428_100203504
566 Ga0075428_101816491
567 Ga0075428_102417104
568 Ga0075430_100082580
569 Ga0075430_100240374
570 Ga0075431_100300287
571 Ga0075433_10032883
572 Ga0075433_10500357
573 Ga0075434_101358949
574 Ga0075429_100190774
575 Ga0068865_100023789
576 Ga0068865_100310296
577 Ga0075436_101389053
578 Ga0097620_100121798
579 Ga0097620_102006528
580 Ga0075435_101795485
581 Ga0099794_10006650
582 Ga0111539_10036516
583 Ga0111539_11482038
584 Ga0111539_13281352
585 Ga0105245_10044747
586 Ga0105245_12019279
587 Ga0105247_10044886
588 Ga0105247_10539040
589 Ga0105247_10564226
590 Ga0105247_10730626
591 Ga0114129_10104588
592 Ga0114129_12456882
593 Ga0105243_10021572
594 Ga0105243_11092969
595 Ga0105243_11803275
596 Ga0105242_10070866
597 Ga0105242_10120179
598 Ga0105242_11238509
599 Ga0105248_10067193
600 Ga0105248_12773469
601 Ga0105238_10000061
602 Ga0105249_10118879
603 Ga0105249_10455154
604 Ga0105249_10867310
605 Ga0105249_12203691
606 Ga0099796_10059774
607 Ga0105239_10117333
608 Ga0105239_11155406
609 Ga0105246_10055063
610 Ga0105246_10464503
611 Ga0157373_10594136
612 Ga0157374_10701124
613 Ga0157374_12773450
614 Ga0157378_10082241
615 Ga0157378_10317405
616 Ga0157378_10944041
617 Ga0163162_10609847
618 Ga0163162_11836181
619 Ga0157375_10027765
620 Ga0157375_11722643
621 Ga0157375_12127084
622 Ga0163163_10965740
623 Ga0163163_11939491
624 Ga0157380_10009377
625 Ga0157380_11444357
626 Ga0157377_10010072
627 Ga0157379_10105351
628 Ga0157379_10429043
629 Ga0157379_10510617
630 Ga0157376_10239911
631 Ga0207642_10271976
632 Ga0207642_10504389
633 Ga0207710_10112524
634 Ga0207680_10432616
635 Ga0207680_11002577
636 Ga0207645_10205143
637 Ga0207643_10024025
638 Ga0207643_10268861
639 Ga0207684_10314989
640 Ga0207684_11467623
641 Ga0207654_10610171
642 Ga0207663_10541574
643 Ga0207663_10939613
644 Ga0207663_11313565
645 Ga0207662_10004292
646 Ga0207646_10527667
647 Ga0207646_10594342
648 Ga0207681_10455442
649 Ga0207659_10053457
650 Ga0207687_10065656
651 Ga0207687_11425490
652 Ga0207644_10789067
653 Ga0207690_10299283
654 Ga0207706_10047821
655 Ga0207686_10069444
656 Ga0207686_10204598
657 Ga0207686_11351160
658 Ga0207709_10062630
659 Ga0207670_10282406
660 Ga0207669_10017001
661 Ga0207704_10081033
662 Ga0207691_10013783
663 Ga0207711_10037930
664 Ga0207711_10049134
665 Ga0207689_10013347
666 Ga0207689_10057133
667 Ga0207689_10066429
668 Ga0207689_10764484
669 Ga0207651_10409226
670 Ga0207651_11008095
671 Ga0207712_10216935
672 Ga0207712_12047936
673 Ga0207668_10673029
674 Ga0207658_10065872
675 Ga0207677_10858552
676 Ga0207677_11287159
677 Ga0207677_11545177
678 Ga0207703_10032108
679 Ga0207703_10585581
680 Ga0207703_11536972
681 Ga0207703_12228467
682 Ga0207639_10022209
683 Ga0207639_11699727
684 Ga0207678_10012478
685 Ga0207678_10791276
686 Ga0207708_10016553
687 Ga0207708_10228822
688 Ga0207708_10563719
689 Ga0207641_10028523
690 Ga0207648_10002547
691 Ga0207676_10410834
692 Ga0207674_10148782
693 Ga0207674_10150243
694 Ga0207675_100012880
695 Ga0207675_100228479
696 Ga0207675_101757024
697 Ga0207683_10052142
698 Ga0207683_10291833
699 Ga0210000_1081480
700 Ga0209813_10135181
701 Ga0209813_10493620
702 Ga0209974_10147889
703 Ga0207428_10009418
704 Ga0207428_10529835
705 Ga0268266_10001080
706 Ga0268266_10304334
707 Ga0268266_10827762
708 Ga0268265_11229260
709 Ga0268264_10036506
710 Ga0268264_10200045
711 Ga0268264_10293480
712 Ga0268264_11226414
713 Ga0268264_11809093
714 Ga0268264_12597877
715 Ga0265337_1042501
716 Ga0265318_10041483
717 Ga0265338_10008796
718 Ga0265338_10056753
719 Ga0265338_10323852
720 Ga0265760_10003703
721 Ga0265330_10004915
722 Ga0265330_10046719
723 Ga0265330_10256710
724 Ga0265332_10000389
725 Ga0265332_10112847
726 Ga0265328_10001578
727 Ga0265320_10176756
728 Ga0265325_10007612
729 Ga0265339_10010260
730 Ga0265339_10102067
731 Ga0265331_10000104
732 Ga0265331_10000436
733 Ga0265331_10075982
734 Ga0265327_10006024
735 Ga0265327_10072847
736 Ga0265327_10137308
737 Ga0265327_10306205
738 Ga0265316_10000047
739 Ga0265316_10319358
740 Ga0265316_10634850
741 Ga0265316_11251840
742 Ga0265313_10002303
743 Ga0316575_10109765
744 Ga0316579_10048233
745 Ga0316579_10359840
746 Ga0265314_10000168
747 Ga0265314_10000890
748 Ga0265314_10115843
749 Ga0265342_10011969
750 Ga0265342_10012216
751 Ga0316576_10090099
752 Ga0316576_10751138
753 Ga0316578_10002691
754 Ga0316578_10016808
755 Ga0316577_10004968
756 Ga0316577_10645715
757 Ga0307415_100059981
758 Ga0316583_10135616
759 Ga0316585_10034515
760 Ga0373929_0105781
761 Ga0373934_0449649
762 Ga0373939_0040102
763 Ga0373946_0127481
764 Ga0373942_0311236
765 Ga0316574_0014308
766 Ga0316574_0199871
767 Ga0373931_0089425
768 Ga0373931_0091592
769 Ga0373935_1005449
770 Ga0373933_0032615
771 Ga0316582_0001917
772 Ga0316582_0281313
773 Ga0316584_0007522
774 Ga0316584_0055067
775 Ga0316584_0655134
776 Ga0436364_0886105
777 Ga0436363_0520348
778 Ga0451843_0422607
779 Ga0451577_0000179
780 Ga0453683_0000324
781 Ga0453683_0146406
782 Ga0453684_0000033
783 Ga0453684_0370432
784 Ga0453684_1275751
785 Ga0451576_0916053
786 Ga0495638_0018225
787 Ga0495587_0248240
788 Ga0495621_0526937
789 Ga0495669_0034865
790 Ga0495669_0634801
791 Ga0495675_0635768
792 Ga0495602_0498105
793 Ga0496100_0941502
794 Ga0496101_0129597
795 Ga0496101_0444983
796 Ga0496104_0043117
797 Ga0496104_0501080
798 Ga0496104_1172211
799 Ga0496105_0409068
800 Ga0496106_0188182
801 Ga0496106_1265610
802 Ga0496109_0242736
803 Ga0496109_0874222
804 Ga0496110_0296219
805 Ga0496110_0442627
806 Ga0496111_0382628
807 Ga0496111_0430939
808 Ga0496112_0823974
809 Ga0496114_0023849
810 Ga0496114_1285183
811 Ga0496115_0068492
812 Ga0501305_107593
813 Ga0501034_0100082
814 Ga0501034_0295664
815 Ga0501034_0419830
816 Ga0501034_0677299
817 Ga0501034_1327562
818 Ga0501036_0314634
819 Ga0501038_0177133
820 Ga0501047_0071665
821 Ga0501068_0074056
822 Ga0501069_0032523
823 Ga0501070_0006898
824 Ga0501070_0101514
825 Ga0501070_1103669
826 Ga0501071_0051748
827 Ga0501072_0016267
828 Ga0501073_0004588
829 Ga0501073_1252078
830 Ga0501074_0046393
831 Ga0501076_1657731
832 Ga0501079_0185841
833 Ga0501080_0108914
834 Ga0501080_0366038
835 Ga0501083_0912418
836 Ga0501044_0072709
837 Ga0501044_0160500
838 Ga0501044_0525708
839 nmdc:mga03683_22391_c1
840 nmdc:mga03n38_208604_c1
841 nmdc:mga03n38_568027_c1
842 nmdc:mga03n38_91221_c1
843 nmdc:mga00v17_1087219_c1
844 nmdc:mga00v17_336001_c1
845 nmdc:mga00v17_72507_c1
846 nmdc:mga0yw44_144093_c1
847 nmdc:mga0k408_570158_c1
848 nmdc:mga0k408_698509_c1
849 nmdc:mga0k408_963_c1
850 nmdc:mga06z11_288532_c1
851 nmdc:mga06z11_45232_c1
852 nmdc:mga04h51_250531_c1
853 nmdc:mga07m45_223155_c1
854 nmdc:mga05p37_17207_c1
855 nmdc:mga09592_22777_c1
856 nmdc:mga0qj67_139078_c1
857 nmdc:mga0qj67_23656_c1
858 nmdc:mga08y16_224710_c1
859 nmdc:mga08y16_99629_c1
860 nmdc:mga0n895_104039_c1
861 nmdc:mga0rr50_1665571_c1
862 nmdc:mga0rr50_6124_c1
863 nmdc:mga08x19_82282_c1
864 nmdc:mga0a205_7282_c1
865 Ga0495601_0956268
866 Ga0495595_0016584
867 Ga0495619_0215360
868 Ga0500651_0162908
869 Ga0500566_0171754
870 Ga0500595_022932
871 Ga0500652_000069
872 Ga0500636_0229874
873 Ga0501084_0716657
874 Ga0501084_1235626
875 Ga0587111_0256754
876 2846541464

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00543

P-II

Nitrogen regulatory protein P-II

11

116

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1hwu-assembly3.cif.gz_F-2 structure of pii protein from herbaspirillum seropedicae 0.9367 49 98
4usi-assembly1.cif.gz_A nitrogen regulatory protein pii from chlamydomonas reinhardtii in complex with mgatp and 2-oxoglutarate 0.9237 53 94
4rx6-assembly1.cif.gz_A structure of b. subtilis glnk-atp complex to 2.6 angstrom 0.9221 56 98
4ush-assembly1.cif.gz_C nitrogen regulatory protein pii from chlamydomonas reinhardtii in unliganded state 0.9185 53 94
1v3r-assembly1.cif.gz_B crystal structure of tt1020 from thermus thermophilus hb8 0.9178 49 94
ID Description Score Start End Superfamily
4usiC00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9146 53 94 3.30.70.120
4rx6D00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.9029 56 98 3.30.70.120
4c3kE00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8994 49 97 3.30.70.120
2o66C00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8847 54 97 3.30.70.120
4oznB00 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.8763 57 98 3.30.70.120
ID Description Score Start End GO Terms
AF-A0A534DAA6-F1-model_v4 deleted 0.9925 50 98
AF-A0A3D5DA62-F1-model_v4 P-II family nitrogen regulator 0.9844 50 98 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A257SLF2-F1-model_v4 deleted 0.9792 49 98
AF-A0A061NX13-F1-model_v4 Nitrogen regulatory protein P-II 0.9761 49 97 GO:0005524
GO:0005829
GO:0006808
GO:0030234
AF-A0A435W0K6-F1-model_v4 deleted 0.974 50 98

Map