F444262

General Info

Members Datasets Scaffolds Average Seq Length
439 281 878 144

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0057298|Ga0466965_0057298_655_1170
Length 171
Sequence MSPVVAFLSMVQTGPTSKGNDEMSETATTTESTGFSAEERAAMKARAAELRAEGKKGAQKADGLQAVLDAIAKMTPEDRAVAERVHVTVTVTAPDLSPKTWYGMPAYANADGKVVLSLKNSGKFGQRYSTLEFQDSAHLDDGDMWPVSFALNTWTPEVEKRVAELVNAATS

Samples

Sample ID Description Type Environment
1 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
28 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
46 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
47 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
48 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
49 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
50 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
58 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
63 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
64 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
74 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
80 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
121 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
125 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
126 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
127 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
130 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
133 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
134 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
135 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
138 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
139 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
142 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
143 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
144 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
145 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
155 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
156 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
157 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
158 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
159 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
160 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
161 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
162 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
163 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
164 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
165 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
166 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
167 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
168 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
171 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
172 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
175 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
176 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
177 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
178 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
181 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
193 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
194 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
195 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
196 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
197 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
198 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
199 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
200 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
201 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
202 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
203 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
204 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
205 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
206 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
207 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
210 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
211 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
243 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
244 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
245 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
246 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
247 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
248 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
249 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
250 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
251 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
253 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
254 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
255 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
256 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
257 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
258 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
259 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
260 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
273 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
274 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
275 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
276 2858848962 Micromonospora saelicesensis GAR06 Isolate Unclassified
277 2858882152 Micromonospora noduli MED15 Isolate Nodule
278 2858888857 Micromonospora saelicesensis Lupac 06 Isolate Unclassified
279 2858895516 Micromonospora saelicesensis PSN13 Isolate Unclassified
280 2869048445 Micromonospora saelicesensis PSN01 Isolate Unclassified
281 8054727385 Micromonospora alfalfae MED01 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.44
Metatranscriptomes 2.73
Isolates 1.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.28
Nodule 0.68
Rhizoplane 10.48
Rhizosphere 82.46
Stem 0
Stem Tuber 0
Unclassified 2.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466965_0057298 3300044683 Bacteria 1942
2 JGI25406J46586_10060392 3300003203 Bacteria 1227
3 Ga0007417J51691_1074463 3300003544 Bacteria 819
4 JGI25404J52841_10042126 3300003659 Unclassified 966
5 JGI25404J52841_10054929 3300003659 Bacteria 836
6 Ga0065715_10093739 3300005293 Bacteria 4580
7 Ga0070683_100081104 3300005329 Bacteria 3037
8 Ga0070683_100313615 3300005329 Bacteria 1492
9 Ga0070680_100041368 3300005336 Bacteria 3737
10 Ga0070680_100174255 3300005336 Bacteria 1811
11 Ga0070682_100132180 3300005337 Bacteria 1691
12 Ga0068868_100104937 3300005338 Bacteria 2291
13 Ga0068868_100268220 3300005338 Bacteria 1441
14 Ga0070692_10384288 3300005345 Bacteria 882
15 Ga0070675_100854350 3300005354 Bacteria 833
16 Ga0070671_100126746 3300005355 Bacteria 2149
17 Ga0070671_101033621 3300005355 Bacteria 721
18 Ga0070688_101277669 3300005365 Bacteria 592
19 Ga0070688_101313976 3300005365 Bacteria 584
20 Ga0070659_101408207 3300005366 Bacteria 620
21 Ga0070709_10518880 3300005434 Bacteria 908
22 Ga0070714_100009754 3300005435 Bacteria 7565
23 Ga0070714_100018104 3300005435 Bacteria 5715
24 Ga0070714_100035574 3300005435 Bacteria 4175
25 Ga0070714_100856475 3300005435 Bacteria 881
26 Ga0070713_100027759 3300005436 Bacteria 4461
27 Ga0070713_100053833 3300005436 Bacteria 3336
28 Ga0070713_100073475 3300005436 Bacteria 2894
29 Ga0070710_10129366 3300005437 Bacteria 1537
30 Ga0070710_10328889 3300005437 Bacteria 1006
31 Ga0070711_100053357 3300005439 Bacteria 2786
32 Ga0070711_100631095 3300005439 Bacteria 896
33 Ga0070711_100849633 3300005439 Bacteria 776
34 Ga0070694_100407957 3300005444 Bacteria 1065
35 Ga0070663_100874736 3300005455 Bacteria 775
36 Ga0070662_100045029 3300005457 Bacteria 3164
37 Ga0070681_10123408 3300005458 Bacteria 2523
38 Ga0070706_100557248 3300005467 Bacteria 1066
39 Ga0070707_100086985 3300005468 Bacteria 3022
40 Ga0070698_101065060 3300005471 Bacteria 757
41 Ga0070699_100676009 3300005518 Bacteria 943
42 Ga0070679_100183437 3300005530 Bacteria 2065
43 Ga0070679_100360444 3300005530 Bacteria 1401
44 Ga0070684_100194760 3300005535 Bacteria 1845
45 Ga0070684_100812032 3300005535 Bacteria 875
46 Ga0068853_100574978 3300005539 Bacteria 1069
47 Ga0070672_101206853 3300005543 Bacteria 674
48 Ga0070672_101345933 3300005543 Bacteria 638
49 Ga0070686_100009858 3300005544 Bacteria 5369
50 Ga0070693_100019185 3300005547 Bacteria 3581
51 Ga0070665_101173540 3300005548 Bacteria 779
52 Ga0068855_100106788 3300005563 Bacteria 3217
53 Ga0068855_100756036 3300005563 Unclassified 1036
54 Ga0070664_100523338 3300005564 Bacteria 1095
55 Ga0068854_101228211 3300005578 Unclassified 672
56 Ga0070702_100020034 3300005615 Bacteria 3498
57 Ga0068852_100060829 3300005616 Bacteria 3280
58 Ga0068852_100614745 3300005616 Bacteria 1092
59 Ga0068859_102254270 3300005617 Bacteria 601
60 Ga0068861_100465497 3300005719 Bacteria 1136
61 Ga0068858_100729683 3300005842 Bacteria 965
62 Ga0068860_100263997 3300005843 Bacteria 1679
63 Ga0068860_100654062 3300005843 Bacteria 1059
64 Ga0081455_10038800 3300005937 Bacteria 4215
65 Ga0081540_1001104 3300005983 Bacteria 23917
66 Ga0081540_1001617 3300005983 Bacteria 19187
67 Ga0081540_1022578 3300005983 Bacteria 3714
68 Ga0081539_10001289 3300005985 Bacteria 44042
69 Ga0081539_10004053 3300005985 Bacteria 16773
70 Ga0081539_10112250 3300005985 Bacteria 1369
71 Ga0070717_10056637 3300006028 Bacteria 3239
72 Ga0070717_10099398 3300006028 Bacteria 2468
73 Ga0070717_10561012 3300006028 Bacteria 1034
74 Ga0070717_10955217 3300006028 Bacteria 780
75 Ga0070717_11131858 3300006028 Bacteria 713
76 Ga0075368_10061440 3300006042 Bacteria 1505
77 Ga0075363_100070505 3300006048 Bacteria 1898
78 Ga0075364_10032629 3300006051 Bacteria 3348
79 Ga0075364_10044140 3300006051 Bacteria 2898
80 Ga0070712_100028841 3300006175 Bacteria 3716
81 Ga0070712_100112697 3300006175 Bacteria 2032
82 Ga0070712_100284622 3300006175 Bacteria 1333
83 Ga0075370_10017203 3300006353 Bacteria 3903
84 Ga0075433_10015988 3300006852 Bacteria 6172
85 Ga0075434_100013751 3300006871 Bacteria 7717
86 Ga0075434_100086470 3300006871 Bacteria 3135
87 Ga0068865_101158065 3300006881 Bacteria 683
88 Ga0097620_102254455 3300006931 Bacteria 601
89 Ga0099795_10380920 3300007788 Bacteria 637
90 Ga0105250_10124679 3300009092 Bacteria 1060
91 Ga0105245_10006696 3300009098 Bacteria 10109
92 Ga0105245_10979037 3300009098 Bacteria 890
93 Ga0105243_10689668 3300009148 Bacteria 994
94 Ga0105241_10608943 3300009174 Bacteria 988
95 Ga0105248_11155737 3300009177 Bacteria 875
96 Ga0105237_10960640 3300009545 Bacteria 861
97 Ga0105238_10203834 3300009551 Bacteria 1954
98 Ga0105238_10693755 3300009551 Bacteria 1030
99 Ga0105239_10204179 3300010375 Bacteria 2214
100 Ga0157369_10021425 3300013105 Bacteria 7230
101 Ga0157369_11017353 3300013105 Bacteria 848
102 Ga0157374_10731754 3300013296 Bacteria 1003
103 Ga0157378_10334772 3300013297 Bacteria 1474
104 Ga0163162_10985005 3300013306 Bacteria 953
105 Ga0157372_10041522 3300013307 Bacteria 5087
106 Ga0157372_10327941 3300013307 Bacteria 1782
107 Ga0157372_10344846 3300013307 Bacteria 1735
108 Ga0157372_11107941 3300013307 Bacteria 916
109 Ga0157372_11111706 3300013307 Bacteria 914
110 Ga0157372_11490371 3300013307 Bacteria 779
111 Ga0157375_10870770 3300013308 Bacteria 1046
112 Ga0157375_10932759 3300013308 Bacteria 1011
113 Ga0163163_10421488 3300014325 Bacteria 1394
114 Ga0157380_12616920 3300014326 Bacteria 571
115 Ga0182008_10015105 3300014497 Bacteria 4036
116 Ga0182008_10437940 3300014497 Bacteria 708
117 Ga0157379_10459989 3300014968 Bacteria 1176
118 Ga0182007_10145469 3300015262 Bacteria 803
119 Ga0163161_10477696 3300017792 Bacteria 1011
120 Ga0206356_10077358 3300020070 Bacteria 576
121 Ga0206353_10491106 3300020082 Bacteria 529
122 Ga0206353_11259314 3300020082 Bacteria 541
123 Ga0207692_10158486 3300025898 Bacteria 1303
124 Ga0207692_10650027 3300025898 Bacteria 681
125 Ga0207688_10519741 3300025901 Bacteria 747
126 Ga0207647_10652234 3300025904 Bacteria 577
127 Ga0207684_10216313 3300025910 Bacteria 1653
128 Ga0207654_10079140 3300025911 Bacteria 1974
129 Ga0207671_10879269 3300025914 Bacteria 709
130 Ga0207693_10029471 3300025915 Bacteria 4335
131 Ga0207693_10484109 3300025915 Bacteria 966
132 Ga0207693_10796956 3300025915 Bacteria 728
133 Ga0207663_10041612 3300025916 Bacteria 2802
134 Ga0207663_11028171 3300025916 Bacteria 661
135 Ga0207660_10286680 3300025917 Bacteria 1308
136 Ga0207660_10696016 3300025917 Bacteria 829
137 Ga0207657_10468999 3300025919 Bacteria 987
138 Ga0207649_10872009 3300025920 Bacteria 705
139 Ga0207652_11349599 3300025921 Bacteria 616
140 Ga0207646_10173542 3300025922 Bacteria 1947
141 Ga0207659_10662519 3300025926 Bacteria 892
142 Ga0207687_10012397 3300025927 Bacteria 5571
143 Ga0207700_10046398 3300025928 Bacteria 3213
144 Ga0207700_10125685 3300025928 Bacteria 2086
145 Ga0207700_10237940 3300025928 Bacteria 1551
146 Ga0207664_10009638 3300025929 Bacteria 6786
147 Ga0207664_10017054 3300025929 Bacteria 5312
148 Ga0207664_10302961 3300025929 Bacteria 1406
149 Ga0207664_10757577 3300025929 Bacteria 873
150 Ga0207690_11347016 3300025932 Bacteria 597
151 Ga0207706_10524815 3300025933 Bacteria 1021
152 Ga0207706_11222077 3300025933 Bacteria 624
153 Ga0207686_11180285 3300025934 Bacteria 626
154 Ga0207709_10482038 3300025935 Bacteria 964
155 Ga0207709_10835452 3300025935 Bacteria 745
156 Ga0207665_10888424 3300025939 Bacteria 706
157 Ga0207661_10312156 3300025944 Bacteria 1412
158 Ga0207661_10421058 3300025944 Bacteria 1213
159 Ga0207679_10959754 3300025945 Bacteria 783
160 Ga0207667_10092086 3300025949 Bacteria 3131
161 Ga0207651_10644304 3300025960 Bacteria 930
162 Ga0207712_10669573 3300025961 Bacteria 903
163 Ga0207640_10052646 3300025981 Bacteria 2653
164 Ga0207658_10167116 3300025986 Bacteria 1808
165 Ga0207677_10053014 3300026023 Bacteria 2759
166 Ga0207702_10026258 3300026078 Bacteria 4833
167 Ga0207702_11540021 3300026078 Bacteria 658
168 Ga0207641_11029154 3300026088 Bacteria 821
169 Ga0207674_11242976 3300026116 Bacteria 714
170 Ga0207683_11113828 3300026121 Bacteria 732
171 Ga0268266_10584771 3300028379 Bacteria 1072
172 Ga0268264_10000387 3300028381 Bacteria 63349
173 Ga0265337_1075037 3300028556 Bacteria 927
174 Ga0265325_10138155 3300031241 Bacteria 1161
175 Ga0265340_10119462 3300031247 Bacteria 1213
176 Ga0265339_10142444 3300031249 Bacteria 1218
177 Ga0307408_100011192 3300031548 Bacteria 5926
178 Ga0265313_10101275 3300031595 Bacteria 1278
179 Ga0265314_10031727 3300031711 Bacteria 3896
180 Ga0307405_10014089 3300031731 Bacteria 4289
181 Ga0307410_10073691 3300031852 Bacteria 2375
182 Ga0307410_10139428 3300031852 Bacteria 1792
183 Ga0307410_11907670 3300031852 Bacteria 529
184 Ga0307406_10396101 3300031901 Bacteria 1093
185 Ga0307407_10074270 3300031903 Bacteria 2034
186 Ga0307409_100035454 3300031995 Bacteria 3656
187 Ga0307409_100292390 3300031995 Bacteria 1511
188 Ga0307409_100602989 3300031995 Bacteria 1085
189 Ga0307409_101597909 3300031995 Bacteria 680
190 Ga0307416_100272306 3300032002 Bacteria 1663
191 Ga0307416_101398776 3300032002 Bacteria 805
192 Ga0307416_101488384 3300032002 Bacteria 783
193 Ga0307415_101042393 3300032126 Bacteria 763
194 Ga0307415_101693938 3300032126 Bacteria 609
195 Ga0316593_10198800 3300032168 Unclassified 740
196 Ga0373926_0119016 3300035083 Bacteria 995
197 Ga0373928_0080341 3300035084 Bacteria 821
198 Ga0373940_0015982 3300035088 Bacteria 1854
199 Ga0373949_0177485 3300035090 Unclassified 629
200 Ga0373952_0142421 3300035092 Bacteria 667
201 Ga0373923_0054365 3300035111 Bacteria 1685
202 Ga0373932_0093988 3300035112 Bacteria 967
203 Ga0373936_0142484 3300035113 Bacteria 1035
204 Ga0373941_0001417 3300035115 Bacteria 5060
205 Ga0373954_0105183 3300035118 Bacteria 1363
206 Ga0373957_0064781 3300035120 Bacteria 1421
207 Ga0373960_0012118 3300035121 Bacteria 2137
208 Ga0373955_0027839 3300035172 Bacteria 2926
209 Ga0373942_0101902 3300035207 Bacteria 878
210 Ga0373924_0059782 3300035410 Bacteria 1592
211 Ga0373931_0580537 3300035691 Bacteria 731
212 Ga0373927_0928273 3300035695 Bacteria 574
213 Ga0395900_0065478 3300037418 Bacteria 3734
214 Ga0395900_0358247 3300037418 Bacteria 1431
215 Ga0395900_0461916 3300037418 Bacteria 1224
216 Ga0395900_0484405 3300037418 Bacteria 1189
217 Ga0395900_0779967 3300037418 Bacteria 885
218 Ga0395898_0206743 3300037466 Bacteria 1873
219 Ga0436364_0144903 3300037853 Bacteria 1009
220 Ga0436364_0369104 3300037853 Bacteria 2262
221 Ga0436364_0474008 3300037853 Bacteria 3467
222 Ga0395901_0050030 3300038443 Bacteria 4343
223 Ga0395901_0177423 3300038443 Bacteria 2234
224 Ga0395901_0549829 3300038443 Bacteria 1170
225 Ga0395901_1033470 3300038443 Bacteria 796
226 Ga0242420_002760 3300038996 Bacteria 2539
227 Ga0436362_0023616 3300039453 Bacteria 1144
228 Ga0439465_0195308 3300041413 Bacteria 736
229 Ga0451789_0187631 3300041443 Bacteria 1312
230 Ga0451791_0927529 3300041451 Bacteria 802
231 Ga0451793_1762147 3300041452 Bacteria 996
232 Ga0451800_0635988 3300041459 Bacteria 2169
233 Ga0451804_0880290 3300041463 Unclassified 2378
234 Ga0451833_0048087 3300041491 Bacteria 1758
235 Ga0451837_0000152 3300041494 Unclassified 1445
236 Ga0451839_0020478 3300041496 Bacteria 4939
237 Ga0451845_0178113 3300041501 Bacteria 1704
238 Ga0451847_0385009 3300041503 Bacteria 628
239 Ga0451843_1171998 3300041509 Unclassified 1868
240 Ga0451855_0513294 3300041511 Bacteria 2526
241 Ga0451853_2593795 3300041512 Bacteria 637
242 Ga0451853_3783954 3300041512 Bacteria 687
243 Ga0439458_0022870 3300042157 Bacteria 1455
244 Ga0466969_0284982 3300044656 Bacteria 748
245 Ga0466969_0380977 3300044656 Bacteria 640
246 Ga0466972_0061202 3300044658 Bacteria 1806
247 Ga0466972_0321832 3300044658 Bacteria 723
248 Ga0466965_0420748 3300044683 Bacteria 741
249 Ga0466965_0445870 3300044683 Bacteria 720
250 Ga0466966_0734694 3300044684 Bacteria 595
251 Ga0466966_0780505 3300044684 Bacteria 576
252 Ga0466961_0282271 3300044693 Bacteria 1016
253 Ga0466961_0750675 3300044693 Bacteria 583
254 Ga0466963_0002058 3300044694 Bacteria 11093
255 Ga0466963_0038227 3300044694 Bacteria 3137
256 Ga0466963_0121913 3300044694 Bacteria 1795
257 Ga0466963_0135152 3300044694 Bacteria 1706
258 Ga0466963_0195948 3300044694 Bacteria 1412
259 Ga0466963_0255709 3300044694 Bacteria 1229
260 Ga0466963_0782489 3300044694 Bacteria 673
261 Ga0466963_0817000 3300044694 Bacteria 657
262 Ga0466964_0114564 3300044706 Bacteria 1207
263 Ga0466964_0259798 3300044706 Bacteria 860
264 Ga0466968_0234026 3300044735 Bacteria 868
265 Ga0466968_0371960 3300044735 Bacteria 697
266 Ga0466970_0143605 3300044765 Bacteria 1316
267 Ga0466957_0023517 3300044842 Bacteria 3643
268 Ga0466957_0713524 3300044842 Bacteria 708
269 Ga0466960_0193275 3300044901 Bacteria 1108
270 Ga0466960_0222808 3300044901 Bacteria 1038
271 Ga0466960_0271223 3300044901 Bacteria 948
272 Ga0466960_0279482 3300044901 Bacteria 935
273 Ga0466960_0374843 3300044901 Bacteria 816
274 Ga0466960_0427928 3300044901 Bacteria 766
275 Ga0466960_0535679 3300044901 Bacteria 689
276 Ga0466960_0655768 3300044901 Bacteria 627
277 Ga0466959_0164014 3300045049 Bacteria 1561
278 Ga0466959_0687382 3300045049 Bacteria 686
279 Ga0466959_0909502 3300045049 Bacteria 587
280 Ga0466958_0022256 3300045836 Bacteria 3711
281 Ga0466958_0175046 3300045836 Bacteria 1360
282 Ga0466958_0196808 3300045836 Bacteria 1282
283 Ga0466958_0693487 3300045836 Bacteria 663
284 Ga0466967_0005231 3300045976 Bacteria 8941
285 Ga0466967_0010028 3300045976 Bacteria 7076
286 Ga0466967_0060280 3300045976 Bacteria 3362
287 Ga0466967_0115158 3300045976 Bacteria 2475
288 Ga0466967_0225019 3300045976 Bacteria 1784
289 Ga0466967_0348395 3300045976 Bacteria 1433
290 Ga0466967_0647080 3300045976 Bacteria 1045
291 Ga0466967_0820816 3300045976 Bacteria 924
292 Ga0466967_1537655 3300045976 Bacteria 663
293 Ga0466967_1651657 3300045976 Bacteria 638
294 Ga0495592_0007497 3300046454 Bacteria 8170
295 Ga0495629_0082925 3300046459 Bacteria 2238
296 Ga0495651_0004650 3300046462 Bacteria 10499
297 Ga0495639_0149268 3300046475 Bacteria 1127
298 Ga0495662_0063500 3300046476 Bacteria 1784
299 Ga0495664_0169519 3300046477 Bacteria 1324
300 Ga0495608_0026749 3300046511 Bacteria 3931
301 Ga0495608_0360957 3300046511 Bacteria 893
302 Ga0495618_0218037 3300046514 Bacteria 1204
303 Ga0495628_0012175 3300046516 Bacteria 7249
304 Ga0495652_0030980 3300046529 Bacteria 4687
305 Ga0495665_0080370 3300046531 Bacteria 1715
306 Ga0495640_0017969 3300046533 Bacteria 5257
307 Ga0495640_0377359 3300046533 Bacteria 873
308 Ga0495586_0011272 3300046535 Bacteria 4753
309 Ga0495586_0270125 3300046535 Bacteria 972
310 Ga0495587_0009804 3300046536 Bacteria 6120
311 Ga0495587_0626185 3300046536 Bacteria 592
312 Ga0495645_0030761 3300046543 Bacteria 3911
313 Ga0495667_0034874 3300046559 Bacteria 3364
314 Ga0495634_0175925 3300046642 Bacteria 1343
315 Ga0495635_0773376 3300046663 Bacteria 620
316 Ga0495657_0033758 3300046675 Bacteria 3559
317 Ga0495599_0002930 3300046678 Bacteria 9925
318 Ga0495623_0031674 3300046679 Bacteria 3399
319 Ga0495646_0006580 3300046680 Bacteria 7373
320 Ga0495613_0022490 3300046689 Bacteria 4697
321 Ga0495624_0237447 3300046690 Bacteria 1103
322 Ga0495624_0433613 3300046690 Bacteria 788
323 Ga0495600_0002577 3300046809 Bacteria 10448
324 Ga0495604_0016470 3300047317 Bacteria 5910
325 Ga0495680_0052503 3300047322 Bacteria 3177
326 Ga0495675_0016339 3300047444 Bacteria 4695
327 Ga0495684_0002577 3300047471 Bacteria 14415
328 Ga0495602_0859559 3300048088 Bacteria 606
329 Ga0496100_0119160 3300048903 Bacteria 1844
330 Ga0496100_0306436 3300048903 Bacteria 1190
331 Ga0496100_0410739 3300048903 Bacteria 1032
332 Ga0496101_0037950 3300048904 Bacteria 3419
333 Ga0496101_0045815 3300048904 Bacteria 3134
334 Ga0496102_0083077 3300048905 Bacteria 2955
335 Ga0496102_0311885 3300048905 Bacteria 1482
336 Ga0496102_0448657 3300048905 Bacteria 1210
337 Ga0496103_0194347 3300048906 Bacteria 1305
338 Ga0496104_0009629 3300048907 Bacteria 8603
339 Ga0496105_0046804 3300048908 Bacteria 3570
340 Ga0496106_0024122 3300048909 Bacteria 4522
341 Ga0496106_0056950 3300048909 Bacteria 2955
342 Ga0496106_0776180 3300048909 Bacteria 761
343 Ga0496107_0028424 3300048910 Bacteria 3974
344 Ga0496107_0073353 3300048910 Bacteria 2489
345 Ga0496107_0311839 3300048910 Bacteria 1171
346 Ga0496107_0930318 3300048910 Bacteria 633
347 Ga0496108_0000584 3300048911 Bacteria 28503
348 Ga0496108_0005446 3300048911 Bacteria 10281
349 Ga0496108_0051152 3300048911 Bacteria 3461
350 Ga0496109_0123605 3300048912 Bacteria 2412
351 Ga0496109_0280138 3300048912 Bacteria 1571
352 Ga0496109_2066736 3300048912 Bacteria 501
353 Ga0496110_0003168 3300048913 Bacteria 12519
354 Ga0496110_0254022 3300048913 Bacteria 1600
355 Ga0496110_0747924 3300048913 Bacteria 881
356 Ga0496110_1122096 3300048913 Bacteria 695
357 Ga0496111_0022793 3300048914 Bacteria 4387
358 Ga0496111_0588810 3300048914 Bacteria 815
359 Ga0496112_0002450 3300048915 Bacteria 14966
360 Ga0496112_0038964 3300048915 Bacteria 4642
361 Ga0496112_0361679 3300048915 Bacteria 1393
362 Ga0496113_0015745 3300048916 Bacteria 5207
363 Ga0496113_0041659 3300048916 Bacteria 3390
364 Ga0496114_0145108 3300048917 Bacteria 2057
365 Ga0496114_0208282 3300048917 Bacteria 1714
366 Ga0496114_0939797 3300048917 Bacteria 747
367 Ga0496114_1003572 3300048917 Bacteria 718
368 Ga0496115_0007547 3300048918 Bacteria 8009
369 Ga0496115_0280451 3300048918 Bacteria 1368
370 Ga0496126_0007823 3300048929 Bacteria 11653
371 Ga0501032_0000079 3300049569 Bacteria 83317
372 Ga0501033_0001010 3300049570 Bacteria 25561
373 Ga0501034_0014623 3300049571 Bacteria 8081
374 Ga0501036_0000165 3300049572 Bacteria 43560
375 Ga0501037_0053476 3300049573 Bacteria 2953
376 Ga0501038_0000203 3300049574 Bacteria 50917
377 Ga0501039_0000083 3300049575 Bacteria 71645
378 Ga0501040_0285998 3300049576 Bacteria 1178
379 Ga0501040_0320953 3300049576 Bacteria 1108
380 Ga0501043_0000269 3300049579 Bacteria 47026
381 Ga0501046_0000282 3300049580 Bacteria 51627
382 Ga0501047_0003765 3300049581 Bacteria 14280
383 Ga0501048_0000254 3300049582 Bacteria 35632
384 Ga0501067_0003031 3300049583 Bacteria 9280
385 Ga0501067_0047674 3300049583 Bacteria 2377
386 Ga0501068_0001636 3300049584 Bacteria 11963
387 Ga0501068_0026766 3300049584 Bacteria 3401
388 Ga0501069_0000144 3300049585 Bacteria 31627
389 Ga0501069_0023147 3300049585 Unclassified 3385
390 Ga0501069_0276077 3300049585 Bacteria 983
391 Ga0501070_0000634 3300049586 Bacteria 32369
392 Ga0501070_0473579 3300049586 Bacteria 1008
393 Ga0501072_0285530 3300049588 Bacteria 1312
394 Ga0501077_0044093 3300049593 Bacteria 2834
395 Ga0501077_0613591 3300049593 Bacteria 699
396 Ga0501079_0262938 3300049741 Bacteria 1349
397 Ga0501080_0000257 3300049742 Bacteria 40116
398 Ga0501081_0260654 3300049743 Bacteria 1267
399 Ga0501081_0637862 3300049743 Bacteria 798
400 Ga0501081_0806735 3300049743 Bacteria 706
401 Ga0501083_0030628 3300049744 Bacteria 3695
402 Ga0501083_0597298 3300049744 Bacteria 718
403 Ga0501035_0040017 3300049822 Bacteria 4238
404 Ga0501044_0037615 3300049823 Bacteria 5057
405 Ga0501044_0281838 3300049823 Bacteria 1595
406 nmdc:mga03n38_197301_c1 3300050490 Bacteria 1040
407 nmdc:mga03n38_35955_c1 3300050490 Bacteria 2126
408 nmdc:mga00v17_49149_c1 3300050491 Bacteria 2558
409 nmdc:mga06z11_39974_c1 3300050494 Bacteria 2337
410 nmdc:mga04h51_62398_c1 3300050495 Bacteria 1280
411 nmdc:mga0n895_21025_c1 3300050512 Bacteria 6098
412 nmdc:mga0rr50_1346967_c1 3300050513 Unclassified 605
413 nmdc:mga08x19_32_c1 3300050514 Bacteria 203770
414 nmdc:mga0a205_15392_c1 3300050515 Bacteria 2289
415 Ga0495601_0252536 3300053077 Bacteria 1151
416 Ga0495612_0094923 3300053078 Bacteria 1266
417 Ga0495595_0028381 3300053084 Bacteria 2499
418 Ga0501084_0006501 3300054114 Bacteria 9606
419 Ga0587066_039388 3300059490 Bacteria 884
420 Ga0587080_055908 3300059503 Bacteria 757
421 Ga0587091_041327 3300059511 Bacteria 910
422 Ga0587128_038817 3300059630 Bacteria 824
423 Ga0587075_025631 3300059644 Bacteria 907
424 Ga0587076_081731 3300059645 Bacteria 690
425 Ga0587079_108270 3300059647 Bacteria 672
426 Ga0466962_0046552 3300061719 Bacteria 2072
427 Ga0466962_0137915 3300061719 Bacteria 1181
428 Ga0466962_0604050 3300061719 Bacteria 559
429 Ga0530510_0160622 3300061734 Bacteria 1662
430 Ga0530510_0324792 3300061734 Bacteria 1154
431 Ga0530510_0608514 3300061734 Bacteria 831
432 2855672007 2855670206 Bacteria 7120389
433 2855678126 2855676851 Bacteria 7063653
434 2858849694 2858848962 Bacteria 6963058
435 2858886142 2858882152 Bacteria 7230291
436 2858889450 2858888857 Bacteria 7060307
437 2858898098 2858895516 Bacteria 7378898
438 2869052227 2869048445 Bacteria 6875584
439 8054728376 8054727385 Bacteria 7558670
440 Ga0466965_0057298
441 JGI25406J46586_10060392
442 Ga0007417J51691_1074463
443 JGI25404J52841_10042126
444 JGI25404J52841_10054929
445 Ga0065715_10093739
446 Ga0070683_100081104
447 Ga0070683_100313615
448 Ga0070680_100041368
449 Ga0070680_100174255
450 Ga0070682_100132180
451 Ga0068868_100104937
452 Ga0068868_100268220
453 Ga0070692_10384288
454 Ga0070675_100854350
455 Ga0070671_100126746
456 Ga0070671_101033621
457 Ga0070688_101277669
458 Ga0070688_101313976
459 Ga0070659_101408207
460 Ga0070709_10518880
461 Ga0070714_100009754
462 Ga0070714_100018104
463 Ga0070714_100035574
464 Ga0070714_100856475
465 Ga0070713_100027759
466 Ga0070713_100053833
467 Ga0070713_100073475
468 Ga0070710_10129366
469 Ga0070710_10328889
470 Ga0070711_100053357
471 Ga0070711_100631095
472 Ga0070711_100849633
473 Ga0070694_100407957
474 Ga0070663_100874736
475 Ga0070662_100045029
476 Ga0070681_10123408
477 Ga0070706_100557248
478 Ga0070707_100086985
479 Ga0070698_101065060
480 Ga0070699_100676009
481 Ga0070679_100183437
482 Ga0070679_100360444
483 Ga0070684_100194760
484 Ga0070684_100812032
485 Ga0068853_100574978
486 Ga0070672_101206853
487 Ga0070672_101345933
488 Ga0070686_100009858
489 Ga0070693_100019185
490 Ga0070665_101173540
491 Ga0068855_100106788
492 Ga0068855_100756036
493 Ga0070664_100523338
494 Ga0068854_101228211
495 Ga0070702_100020034
496 Ga0068852_100060829
497 Ga0068852_100614745
498 Ga0068859_102254270
499 Ga0068861_100465497
500 Ga0068858_100729683
501 Ga0068860_100263997
502 Ga0068860_100654062
503 Ga0081455_10038800
504 Ga0081540_1001104
505 Ga0081540_1001617
506 Ga0081540_1022578
507 Ga0081539_10001289
508 Ga0081539_10004053
509 Ga0081539_10112250
510 Ga0070717_10056637
511 Ga0070717_10099398
512 Ga0070717_10561012
513 Ga0070717_10955217
514 Ga0070717_11131858
515 Ga0075368_10061440
516 Ga0075363_100070505
517 Ga0075364_10032629
518 Ga0075364_10044140
519 Ga0070712_100028841
520 Ga0070712_100112697
521 Ga0070712_100284622
522 Ga0075370_10017203
523 Ga0075433_10015988
524 Ga0075434_100013751
525 Ga0075434_100086470
526 Ga0068865_101158065
527 Ga0097620_102254455
528 Ga0099795_10380920
529 Ga0105250_10124679
530 Ga0105245_10006696
531 Ga0105245_10979037
532 Ga0105243_10689668
533 Ga0105241_10608943
534 Ga0105248_11155737
535 Ga0105237_10960640
536 Ga0105238_10203834
537 Ga0105238_10693755
538 Ga0105239_10204179
539 Ga0157369_10021425
540 Ga0157369_11017353
541 Ga0157374_10731754
542 Ga0157378_10334772
543 Ga0163162_10985005
544 Ga0157372_10041522
545 Ga0157372_10327941
546 Ga0157372_10344846
547 Ga0157372_11107941
548 Ga0157372_11111706
549 Ga0157372_11490371
550 Ga0157375_10870770
551 Ga0157375_10932759
552 Ga0163163_10421488
553 Ga0157380_12616920
554 Ga0182008_10015105
555 Ga0182008_10437940
556 Ga0157379_10459989
557 Ga0182007_10145469
558 Ga0163161_10477696
559 Ga0206356_10077358
560 Ga0206353_10491106
561 Ga0206353_11259314
562 Ga0207692_10158486
563 Ga0207692_10650027
564 Ga0207688_10519741
565 Ga0207647_10652234
566 Ga0207684_10216313
567 Ga0207654_10079140
568 Ga0207671_10879269
569 Ga0207693_10029471
570 Ga0207693_10484109
571 Ga0207693_10796956
572 Ga0207663_10041612
573 Ga0207663_11028171
574 Ga0207660_10286680
575 Ga0207660_10696016
576 Ga0207657_10468999
577 Ga0207649_10872009
578 Ga0207652_11349599
579 Ga0207646_10173542
580 Ga0207659_10662519
581 Ga0207687_10012397
582 Ga0207700_10046398
583 Ga0207700_10125685
584 Ga0207700_10237940
585 Ga0207664_10009638
586 Ga0207664_10017054
587 Ga0207664_10302961
588 Ga0207664_10757577
589 Ga0207690_11347016
590 Ga0207706_10524815
591 Ga0207706_11222077
592 Ga0207686_11180285
593 Ga0207709_10482038
594 Ga0207709_10835452
595 Ga0207665_10888424
596 Ga0207661_10312156
597 Ga0207661_10421058
598 Ga0207679_10959754
599 Ga0207667_10092086
600 Ga0207651_10644304
601 Ga0207712_10669573
602 Ga0207640_10052646
603 Ga0207658_10167116
604 Ga0207677_10053014
605 Ga0207702_10026258
606 Ga0207702_11540021
607 Ga0207641_11029154
608 Ga0207674_11242976
609 Ga0207683_11113828
610 Ga0268266_10584771
611 Ga0268264_10000387
612 Ga0265337_1075037
613 Ga0265325_10138155
614 Ga0265340_10119462
615 Ga0265339_10142444
616 Ga0307408_100011192
617 Ga0265313_10101275
618 Ga0265314_10031727
619 Ga0307405_10014089
620 Ga0307410_10073691
621 Ga0307410_10139428
622 Ga0307410_11907670
623 Ga0307406_10396101
624 Ga0307407_10074270
625 Ga0307409_100035454
626 Ga0307409_100292390
627 Ga0307409_100602989
628 Ga0307409_101597909
629 Ga0307416_100272306
630 Ga0307416_101398776
631 Ga0307416_101488384
632 Ga0307415_101042393
633 Ga0307415_101693938
634 Ga0316593_10198800
635 Ga0373926_0119016
636 Ga0373928_0080341
637 Ga0373940_0015982
638 Ga0373949_0177485
639 Ga0373952_0142421
640 Ga0373923_0054365
641 Ga0373932_0093988
642 Ga0373936_0142484
643 Ga0373941_0001417
644 Ga0373954_0105183
645 Ga0373957_0064781
646 Ga0373960_0012118
647 Ga0373955_0027839
648 Ga0373942_0101902
649 Ga0373924_0059782
650 Ga0373931_0580537
651 Ga0373927_0928273
652 Ga0395900_0065478
653 Ga0395900_0358247
654 Ga0395900_0461916
655 Ga0395900_0484405
656 Ga0395900_0779967
657 Ga0395898_0206743
658 Ga0436364_0144903
659 Ga0436364_0369104
660 Ga0436364_0474008
661 Ga0395901_0050030
662 Ga0395901_0177423
663 Ga0395901_0549829
664 Ga0395901_1033470
665 Ga0242420_002760
666 Ga0436362_0023616
667 Ga0439465_0195308
668 Ga0451789_0187631
669 Ga0451791_0927529
670 Ga0451793_1762147
671 Ga0451800_0635988
672 Ga0451804_0880290
673 Ga0451833_0048087
674 Ga0451837_0000152
675 Ga0451839_0020478
676 Ga0451845_0178113
677 Ga0451847_0385009
678 Ga0451843_1171998
679 Ga0451855_0513294
680 Ga0451853_2593795
681 Ga0451853_3783954
682 Ga0439458_0022870
683 Ga0466969_0284982
684 Ga0466969_0380977
685 Ga0466972_0061202
686 Ga0466972_0321832
687 Ga0466965_0420748
688 Ga0466965_0445870
689 Ga0466966_0734694
690 Ga0466966_0780505
691 Ga0466961_0282271
692 Ga0466961_0750675
693 Ga0466963_0002058
694 Ga0466963_0038227
695 Ga0466963_0121913
696 Ga0466963_0135152
697 Ga0466963_0195948
698 Ga0466963_0255709
699 Ga0466963_0782489
700 Ga0466963_0817000
701 Ga0466964_0114564
702 Ga0466964_0259798
703 Ga0466968_0234026
704 Ga0466968_0371960
705 Ga0466970_0143605
706 Ga0466957_0023517
707 Ga0466957_0713524
708 Ga0466960_0193275
709 Ga0466960_0222808
710 Ga0466960_0271223
711 Ga0466960_0279482
712 Ga0466960_0374843
713 Ga0466960_0427928
714 Ga0466960_0535679
715 Ga0466960_0655768
716 Ga0466959_0164014
717 Ga0466959_0687382
718 Ga0466959_0909502
719 Ga0466958_0022256
720 Ga0466958_0175046
721 Ga0466958_0196808
722 Ga0466958_0693487
723 Ga0466967_0005231
724 Ga0466967_0010028
725 Ga0466967_0060280
726 Ga0466967_0115158
727 Ga0466967_0225019
728 Ga0466967_0348395
729 Ga0466967_0647080
730 Ga0466967_0820816
731 Ga0466967_1537655
732 Ga0466967_1651657
733 Ga0495592_0007497
734 Ga0495629_0082925
735 Ga0495651_0004650
736 Ga0495639_0149268
737 Ga0495662_0063500
738 Ga0495664_0169519
739 Ga0495608_0026749
740 Ga0495608_0360957
741 Ga0495618_0218037
742 Ga0495628_0012175
743 Ga0495652_0030980
744 Ga0495665_0080370
745 Ga0495640_0017969
746 Ga0495640_0377359
747 Ga0495586_0011272
748 Ga0495586_0270125
749 Ga0495587_0009804
750 Ga0495587_0626185
751 Ga0495645_0030761
752 Ga0495667_0034874
753 Ga0495634_0175925
754 Ga0495635_0773376
755 Ga0495657_0033758
756 Ga0495599_0002930
757 Ga0495623_0031674
758 Ga0495646_0006580
759 Ga0495613_0022490
760 Ga0495624_0237447
761 Ga0495624_0433613
762 Ga0495600_0002577
763 Ga0495604_0016470
764 Ga0495680_0052503
765 Ga0495675_0016339
766 Ga0495684_0002577
767 Ga0495602_0859559
768 Ga0496100_0119160
769 Ga0496100_0306436
770 Ga0496100_0410739
771 Ga0496101_0037950
772 Ga0496101_0045815
773 Ga0496102_0083077
774 Ga0496102_0311885
775 Ga0496102_0448657
776 Ga0496103_0194347
777 Ga0496104_0009629
778 Ga0496105_0046804
779 Ga0496106_0024122
780 Ga0496106_0056950
781 Ga0496106_0776180
782 Ga0496107_0028424
783 Ga0496107_0073353
784 Ga0496107_0311839
785 Ga0496107_0930318
786 Ga0496108_0000584
787 Ga0496108_0005446
788 Ga0496108_0051152
789 Ga0496109_0123605
790 Ga0496109_0280138
791 Ga0496109_2066736
792 Ga0496110_0003168
793 Ga0496110_0254022
794 Ga0496110_0747924
795 Ga0496110_1122096
796 Ga0496111_0022793
797 Ga0496111_0588810
798 Ga0496112_0002450
799 Ga0496112_0038964
800 Ga0496112_0361679
801 Ga0496113_0015745
802 Ga0496113_0041659
803 Ga0496114_0145108
804 Ga0496114_0208282
805 Ga0496114_0939797
806 Ga0496114_1003572
807 Ga0496115_0007547
808 Ga0496115_0280451
809 Ga0496126_0007823
810 Ga0501032_0000079
811 Ga0501033_0001010
812 Ga0501034_0014623
813 Ga0501036_0000165
814 Ga0501037_0053476
815 Ga0501038_0000203
816 Ga0501039_0000083
817 Ga0501040_0285998
818 Ga0501040_0320953
819 Ga0501043_0000269
820 Ga0501046_0000282
821 Ga0501047_0003765
822 Ga0501048_0000254
823 Ga0501067_0003031
824 Ga0501067_0047674
825 Ga0501068_0001636
826 Ga0501068_0026766
827 Ga0501069_0000144
828 Ga0501069_0023147
829 Ga0501069_0276077
830 Ga0501070_0000634
831 Ga0501070_0473579
832 Ga0501072_0285530
833 Ga0501077_0044093
834 Ga0501077_0613591
835 Ga0501079_0262938
836 Ga0501080_0000257
837 Ga0501081_0260654
838 Ga0501081_0637862
839 Ga0501081_0806735
840 Ga0501083_0030628
841 Ga0501083_0597298
842 Ga0501035_0040017
843 Ga0501044_0037615
844 Ga0501044_0281838
845 nmdc:mga03n38_197301_c1
846 nmdc:mga03n38_35955_c1
847 nmdc:mga00v17_49149_c1
848 nmdc:mga06z11_39974_c1
849 nmdc:mga04h51_62398_c1
850 nmdc:mga0n895_21025_c1
851 nmdc:mga0rr50_1346967_c1
852 nmdc:mga08x19_32_c1
853 nmdc:mga0a205_15392_c1
854 Ga0495601_0252536
855 Ga0495612_0094923
856 Ga0495595_0028381
857 Ga0501084_0006501
858 Ga0587066_039388
859 Ga0587080_055908
860 Ga0587091_041327
861 Ga0587128_038817
862 Ga0587075_025631
863 Ga0587076_081731
864 Ga0587079_108270
865 Ga0466962_0046552
866 Ga0466962_0137915
867 Ga0466962_0604050
868 Ga0530510_0160622
869 Ga0530510_0324792
870 Ga0530510_0608514
871 2855672007
872 2855678126
873 2858849694
874 2858886142
875 2858889450
876 2858898098
877 2869052227
878 8054728376

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2oc6-assembly2.cif.gz_B crystal structure of a protein from the duf1801 family (ydhg, bsu05750) from bacillus subtilis at 1.75 a resolution 0.8002 39 107
3tto-assembly4.cif.gz_D crystal structure of leuconostoc mesenteroides nrrl b-1299 n-terminally truncated dextransucrase dsr-e in triclinic form 0.6228 68 88
7ubz-assembly1.cif.gz_B chymotrypsin digested toxin/immunity complex for a t6ss lipase effector from e. cloacae 0.5747 35 65
2i8d-assembly1.cif.gz_B crystal structure of an uncharacterized conserved protein of cog5646 (zp_00384875.1) from lactobacillus casei atcc 334 at 1.69 a resolution 0.5358 44 138
4jos-assembly1.cif.gz_A crystal structure of a putative 5'-methylthioadenosine/s-adenosylhomocysteine nucleosidase from francisella philomiragia atcc 25017 (target nysgrc-029335) 0.5016 56 89
ID Description Score Start End Superfamily
2i8dB01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7801 44 107 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7791 38 143 3.90.1150.200
af_Q2FVG5_6_119_3.90.1150.200 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.7229 38 143 3.90.1150.200
af_A0A0R0FP77_74_114_3.30.160.60 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Classic Zinc Finger 0.6518 64 88 3.30.160.60
2oc6B01 Alpha Beta;Alpha-Beta Complex;Aspartate Aminotransferase, domain 1; 0.6402 39 136 3.90.1150.200
ID Description Score Start End GO Terms
AF-A0A2U1D629-F1-model_v4 Uncharacterized protein DUF1801 0.9876 39 142
AF-A0A522DF02-F1-model_v4 Uncharacterized protein 0.9842 41 143
AF-F0T5S3-F1-model_v4 Uncharacterized protein 0.9836 36 143
AF-A0A7W1IU15-F1-model_v4 DUF1801 domain-containing protein 0.9792 33 143
AF-A0A1V4ZD30-F1-model_v4 Uncharacterized protein 0.9791 36 143

Map