F444229

General Info

Members Datasets Scaffolds Average Seq Length
439 255 437 230

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10416559|Ga0307513_104165592
Length 268
Sequence MPMSSSQRVRCHTSQALGRPAAGCYEGCMADATSSPTAERRAVVLLSGGLDSTTALAIAREQGFTCHALTVAYGQLHRCEVDAAARVAAALGAAEHRVLEIDLAPLARSALTSPSVAVPKNRSLEEIGAPDDVPATYVPARNTVLLSLALAWAETLGAFDLFIGVNVLDASGYPDCRREFVRAFEQLARVATRAGSGGRFRIQAPLISLRKAEIIQRGMELGVDYAMTHSCYDPAPDGGACRECDACLLRAKGFAEAGVPDPTRYRAG

Samples

Sample ID Description Type Environment
1 2671180195 Frankia sp. CcI49 Isolate Nodule
2 2773857922 Frankia sp. CcI49 Isolate Nodule
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
132 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
133 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
134 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
135 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
136 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
139 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
140 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
141 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
142 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
148 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
149 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
153 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
156 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
163 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
164 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
167 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
171 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
174 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
180 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
181 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
182 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
186 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
187 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
188 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
189 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
190 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
196 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
201 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
204 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
205 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
206 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
207 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
210 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
211 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
212 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
213 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
214 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
228 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
233 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
234 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
243 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
244 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
245 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
246 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
247 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
248 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
249 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
250 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
251 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
254 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.09
Metatranscriptomes 0.46
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.37
Nodule 0.46
Rhizoplane 3.19
Rhizosphere 92.26
Stem 0
Stem Tuber 0
Unclassified 2.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10099225 3300005293 Bacteria 3440
2 Ga0070658_10101174 3300005327 Bacteria 2383
3 Ga0070683_100059431 3300005329 Bacteria 3551
4 Ga0070690_100022173 3300005330 Bacteria 3884
5 Ga0070690_100051927 3300005330 Bacteria 2619
6 Ga0070677_10001319 3300005333 Bacteria 7931
7 Ga0070677_10004544 3300005333 Bacteria 4531
8 Ga0068869_100007727 3300005334 Bacteria 6892
9 Ga0068869_100050199 3300005334 Bacteria 3023
10 Ga0068869_100331417 3300005334 Bacteria 1237
11 Ga0070666_10066878 3300005335 Bacteria 2440
12 Ga0070682_100059067 3300005337 Bacteria 2420
13 Ga0068868_100287824 3300005338 Bacteria 1392
14 Ga0068868_100470385 3300005338 Bacteria 1096
15 Ga0070689_100018205 3300005340 Bacteria 5171
16 Ga0070687_100021702 3300005343 Bacteria 3024
17 Ga0070687_100400228 3300005343 Bacteria 900
18 Ga0070661_100075943 3300005344 Bacteria 2476
19 Ga0070692_10389589 3300005345 Bacteria 876
20 Ga0070669_100021551 3300005353 Bacteria 4605
21 Ga0070669_100046564 3300005353 Bacteria 3163
22 Ga0070675_100009442 3300005354 Bacteria 7591
23 Ga0070675_100062721 3300005354 Bacteria 3071
24 Ga0070675_100489225 3300005354 Bacteria 1107
25 Ga0070674_100007220 3300005356 Bacteria 6541
26 Ga0070674_100051823 3300005356 Bacteria 2829
27 Ga0070674_100302032 3300005356 Bacteria 1276
28 Ga0070673_100008461 3300005364 Bacteria 6842
29 Ga0070673_100166449 3300005364 Bacteria 1879
30 Ga0070688_100665875 3300005365 Bacteria 803
31 Ga0070659_100110198 3300005366 Bacteria 2222
32 Ga0070701_10002981 3300005438 Bacteria 6618
33 Ga0070705_100096890 3300005440 Bacteria 1853
34 Ga0070700_100224296 3300005441 Bacteria 1334
35 Ga0070694_100002329 3300005444 Bacteria 11228
36 Ga0070694_100158449 3300005444 Bacteria 1659
37 Ga0070708_100049765 3300005445 Bacteria 3708
38 Ga0070708_100192501 3300005445 Bacteria 1908
39 Ga0070663_100236138 3300005455 Bacteria 1441
40 Ga0070678_100007578 3300005456 Bacteria 6447
41 Ga0070678_100089750 3300005456 Bacteria 2353
42 Ga0068867_100067025 3300005459 Bacteria 2675
43 Ga0068867_100116186 3300005459 Bacteria 2061
44 Ga0070685_10073212 3300005466 Bacteria 2036
45 Ga0070706_100013908 3300005467 Bacteria 7436
46 Ga0070706_100043034 3300005467 Bacteria 4172
47 Ga0070706_100100973 3300005467 Bacteria 2681
48 Ga0070706_100106940 3300005467 Bacteria 2602
49 Ga0070706_100179822 3300005467 Bacteria 1975
50 Ga0070707_100216046 3300005468 Bacteria 1868
51 Ga0070707_100258950 3300005468 Bacteria 1693
52 Ga0070707_100280456 3300005468 Bacteria 1619
53 Ga0070707_100331265 3300005468 Bacteria 1479
54 Ga0070707_100333667 3300005468 Bacteria 1473
55 Ga0070707_100356554 3300005468 Bacteria 1421
56 Ga0070698_100016943 3300005471 Bacteria 7681
57 Ga0070699_100131572 3300005518 Bacteria 2205
58 Ga0070684_100675240 3300005535 Bacteria 962
59 Ga0070697_100258748 3300005536 Bacteria 1490
60 Ga0070697_100616770 3300005536 Bacteria 954
61 Ga0068853_100456041 3300005539 Bacteria 1203
62 Ga0070672_100025997 3300005543 Bacteria 4349
63 Ga0070672_100052881 3300005543 Bacteria 3173
64 Ga0070672_100126613 3300005543 Bacteria 2096
65 Ga0070672_100764580 3300005543 Bacteria 848
66 Ga0070695_100075575 3300005545 Bacteria 2217
67 Ga0070695_100355315 3300005545 Bacteria 1099
68 Ga0070696_100052996 3300005546 Bacteria 2823
69 Ga0070696_100209137 3300005546 Bacteria 1460
70 Ga0070665_100255113 3300005548 Bacteria 1755
71 Ga0070665_100485976 3300005548 Bacteria 1246
72 Ga0070704_100177338 3300005549 Bacteria 1701
73 Ga0070704_100285681 3300005549 Bacteria 1369
74 Ga0070704_100557704 3300005549 Bacteria 1002
75 Ga0070704_100695784 3300005549 Bacteria 901
76 Ga0070664_100568654 3300005564 Bacteria 1049
77 Ga0070702_100003205 3300005615 Bacteria 7269
78 Ga0070702_100153070 3300005615 Bacteria 1483
79 Ga0068852_100454697 3300005616 Bacteria 1268
80 Ga0068859_100008795 3300005617 Bacteria 10193
81 Ga0068864_100011563 3300005618 Bacteria 7289
82 Ga0068864_100307860 3300005618 Bacteria 1485
83 Ga0068864_101117245 3300005618 Bacteria 785
84 Ga0068861_100053970 3300005719 Bacteria 3060
85 Ga0068861_100097604 3300005719 Bacteria 2331
86 Ga0068861_100113146 3300005719 Bacteria 2177
87 Ga0068870_10023706 3300005840 Bacteria 3030
88 Ga0068863_100152971 3300005841 Bacteria 2208
89 Ga0068863_100509616 3300005841 Bacteria 1185
90 Ga0068858_100140628 3300005842 Bacteria 2266
91 Ga0068860_100020867 3300005843 Bacteria 6346
92 Ga0068860_100058078 3300005843 Bacteria 3678
93 Ga0068862_100044508 3300005844 Bacteria 3786
94 Ga0068862_100585392 3300005844 Bacteria 1069
95 Ga0081455_10010977 3300005937 Bacteria 9130
96 Ga0070717_10018303 3300006028 Bacteria 5465
97 Ga0075368_10089551 3300006042 Bacteria 1258
98 Ga0070715_10022974 3300006163 Bacteria 2438
99 Ga0070712_100010717 3300006175 Bacteria 5791
100 Ga0097621_100054944 3300006237 Bacteria 3250
101 Ga0097621_100203100 3300006237 Bacteria 1721
102 Ga0097621_100750233 3300006237 Bacteria 901
103 Ga0068871_100476991 3300006358 Bacteria 1121
104 Ga0075428_100012015 3300006844 Bacteria 9634
105 Ga0075428_100065095 3300006844 Bacteria 3992
106 Ga0075430_100017257 3300006846 Bacteria 6149
107 Ga0075431_100102563 3300006847 Bacteria 2953
108 Ga0075433_10005371 3300006852 Bacteria 10064
109 Ga0075433_10195759 3300006852 Bacteria 1798
110 Ga0075433_10528177 3300006852 Bacteria 1038
111 Ga0075434_100000940 3300006871 Bacteria 23428
112 Ga0075429_100183886 3300006880 Bacteria 1831
113 Ga0068865_100220525 3300006881 Bacteria 1482
114 Ga0068865_100336039 3300006881 Bacteria 1219
115 Ga0075436_100000001 3300006914 Bacteria 622380
116 Ga0075436_100016972 3300006914 Bacteria 4982
117 Ga0075436_100049837 3300006914 Bacteria 2890
118 Ga0097620_100008795 3300006931 Bacteria 10193
119 Ga0075435_100001652 3300007076 Bacteria 14463
120 Ga0075435_100011216 3300007076 Bacteria 6579
121 Ga0105240_10419900 3300009093 Bacteria 1503
122 Ga0111539_10000033 3300009094 Bacteria 154510
123 Ga0111539_10157813 3300009094 Bacteria 2654
124 Ga0105245_10081989 3300009098 Bacteria 2950
125 Ga0105245_10181355 3300009098 Bacteria 2012
126 Ga0105245_10241346 3300009098 Bacteria 1751
127 Ga0105245_10358333 3300009098 Bacteria 1447
128 Ga0105247_10410338 3300009101 Unclassified 967
129 Ga0114129_10000942 3300009147 Bacteria 38014
130 Ga0114129_10013292 3300009147 Bacteria 11731
131 Ga0114129_10044622 3300009147 Bacteria 6236
132 Ga0105241_10867933 3300009174 Bacteria 836
133 Ga0105242_10033229 3300009176 Bacteria 4130
134 Ga0105248_10379140 3300009177 Bacteria 1592
135 Ga0105248_10769064 3300009177 Bacteria 1087
136 Ga0105238_10672611 3300009551 Bacteria 1046
137 Ga0105249_10005443 3300009553 Bacteria 10993
138 Ga0105246_10685645 3300011119 Bacteria 896
139 Ga0157374_10359104 3300013296 Bacteria 1448
140 Ga0157378_10087831 3300013297 Bacteria 2821
141 Ga0157378_10089176 3300013297 Bacteria 2800
142 Ga0163162_10034010 3300013306 Bacteria 5069
143 Ga0163162_10281064 3300013306 Bacteria 1796
144 Ga0163163_10418670 3300014325 Bacteria 1398
145 Ga0163163_11276575 3300014325 Bacteria 797
146 Ga0157380_10008213 3300014326 Bacteria 7438
147 Ga0157380_10086348 3300014326 Bacteria 2578
148 Ga0157380_10116690 3300014326 Bacteria 2254
149 Ga0157380_10366821 3300014326 Bacteria 1353
150 Ga0157380_10614690 3300014326 Bacteria 1078
151 Ga0157379_10172038 3300014968 Bacteria 1955
152 Ga0157376_10041472 3300014969 Bacteria 3768
153 Ga0157376_10144692 3300014969 Bacteria 2137
154 Ga0157376_10936300 3300014969 Bacteria 886
155 Ga0163161_10001610 3300017792 Bacteria 16621
156 Ga0163161_10479208 3300017792 Bacteria 1010
157 Ga0207682_10001261 3300025893 Bacteria 11698
158 Ga0207682_10004744 3300025893 Bacteria 5639
159 Ga0207682_10114053 3300025893 Bacteria 1192
160 Ga0207682_10135173 3300025893 Bacteria 1103
161 Ga0207642_10129719 3300025899 Bacteria 1314
162 Ga0207645_10075873 3300025907 Bacteria 2152
163 Ga0207643_10005444 3300025908 Bacteria 6808
164 Ga0207643_10198951 3300025908 Bacteria 1219
165 Ga0207705_10253728 3300025909 Bacteria 1342
166 Ga0207684_10001071 3300025910 Bacteria 30734
167 Ga0207684_10022843 3300025910 Bacteria 5341
168 Ga0207684_10062719 3300025910 Bacteria 3156
169 Ga0207684_10516205 3300025910 Bacteria 1024
170 Ga0207693_10014592 3300025915 Bacteria 6313
171 Ga0207662_10021878 3300025918 Bacteria 3660
172 Ga0207662_10042204 3300025918 Bacteria 2688
173 Ga0207649_10033555 3300025920 Bacteria 3068
174 Ga0207646_10006027 3300025922 Bacteria 12628
175 Ga0207646_10070571 3300025922 Bacteria 3120
176 Ga0207646_10131990 3300025922 Bacteria 2248
177 Ga0207646_10149788 3300025922 Bacteria 2104
178 Ga0207646_10293341 3300025922 Bacteria 1469
179 Ga0207681_10291360 3300025923 Bacteria 1288
180 Ga0207681_10412771 3300025923 Bacteria 1092
181 Ga0207694_10633681 3300025924 Bacteria 900
182 Ga0207650_10121841 3300025925 Bacteria 2031
183 Ga0207659_10081808 3300025926 Bacteria 2389
184 Ga0207659_10197558 3300025926 Bacteria 1604
185 Ga0207687_10188822 3300025927 Bacteria 1602
186 Ga0207687_10399097 3300025927 Bacteria 1131
187 Ga0207670_10009212 3300025936 Bacteria 5617
188 Ga0207669_10077445 3300025937 Bacteria 2115
189 Ga0207669_10102972 3300025937 Bacteria 1892
190 Ga0207669_10104998 3300025937 Bacteria 1878
191 Ga0207669_10464052 3300025937 Bacteria 1006
192 Ga0207691_10003742 3300025940 Bacteria 14754
193 Ga0207691_10006277 3300025940 Bacteria 11473
194 Ga0207691_10124944 3300025940 Bacteria 2277
195 Ga0207691_10136276 3300025940 Bacteria 2165
196 Ga0207711_10217465 3300025941 Bacteria 1746
197 Ga0207711_10278675 3300025941 Bacteria 1540
198 Ga0207689_10009008 3300025942 Bacteria 8643
199 Ga0207689_10029027 3300025942 Bacteria 4624
200 Ga0207661_10071253 3300025944 Bacteria 2840
201 Ga0207651_10047770 3300025960 Bacteria 2888
202 Ga0207712_10021683 3300025961 Bacteria 4220
203 Ga0207677_10253674 3300026023 Bacteria 1430
204 Ga0207677_10306299 3300026023 Bacteria 1314
205 Ga0207703_10524545 3300026035 Bacteria 1114
206 Ga0207678_10019966 3300026067 Bacteria 5890
207 Ga0207678_10303532 3300026067 Bacteria 1372
208 Ga0207678_10474999 3300026067 Bacteria 1088
209 Ga0207708_10202897 3300026075 Bacteria 1582
210 Ga0207648_10015435 3300026089 Bacteria 7025
211 Ga0207648_10051336 3300026089 Bacteria 3604
212 Ga0207676_10010098 3300026095 Bacteria 6718
213 Ga0207676_10302786 3300026095 Bacteria 1460
214 Ga0207674_10137809 3300026116 Bacteria 2401
215 Ga0207674_10771927 3300026116 Bacteria 928
216 Ga0207675_100012288 3300026118 Bacteria 8000
217 Ga0207675_100412380 3300026118 Bacteria 1333
218 Ga0207683_10009804 3300026121 Bacteria 8169
219 Ga0207683_10046533 3300026121 Bacteria 3797
220 Ga0207683_10202077 3300026121 Bacteria 1807
221 Ga0207698_10047978 3300026142 Bacteria 3239
222 Ga0207428_10000001 3300027907 Bacteria 1034622
223 Ga0207428_10102172 3300027907 Bacteria 2214
224 Ga0207428_10392299 3300027907 Bacteria 1017
225 Ga0268266_10767059 3300028379 Bacteria 931
226 Ga0268265_10005864 3300028380 Bacteria 8373
227 Ga0268265_10008123 3300028380 Bacteria 7091
228 Ga0268264_10612027 3300028381 Bacteria 1074
229 Ga0265326_10001755 3300028558 Bacteria 7500
230 Ga0265319_1000169 3300028563 Bacteria 49406
231 Ga0265334_10000030 3300028573 Bacteria 112102
232 Ga0265334_10002532 3300028573 Bacteria 8544
233 Ga0265318_10003825 3300028577 Bacteria 7459
234 Ga0265318_10063061 3300028577 Bacteria 1379
235 Ga0265318_10124791 3300028577 Bacteria 947
236 Ga0265323_10000377 3300028653 Bacteria 25812
237 Ga0265323_10002119 3300028653 Bacteria 9252
238 Ga0265323_10018760 3300028653 Bacteria 2674
239 Ga0265323_10139822 3300028653 Bacteria 780
240 Ga0265322_10000248 3300028654 Bacteria 23437
241 Ga0307515_10357283 3300028794 Bacteria 1104
242 Ga0265338_10003344 3300028800 Bacteria 22669
243 Ga0265338_10007677 3300028800 Bacteria 13294
244 Ga0265338_10017342 3300028800 Bacteria 7769
245 Ga0265338_10021908 3300028800 Bacteria 6640
246 Ga0265338_10035683 3300028800 Bacteria 4772
247 Ga0265338_10043269 3300028800 Bacteria 4180
248 Ga0265338_10148164 3300028800 Bacteria 1828
249 Ga0265324_10000265 3300029957 Bacteria 38646
250 Ga0265330_10001279 3300031235 Bacteria 14727
251 Ga0265330_10016380 3300031235 Bacteria 3421
252 Ga0265332_10000693 3300031238 Bacteria 21552
253 Ga0265328_10010697 3300031239 Bacteria 3686
254 Ga0265320_10001579 3300031240 Bacteria 16365
255 Ga0265320_10017481 3300031240 Bacteria 3979
256 Ga0265325_10020524 3300031241 Bacteria 3641
257 Ga0265325_10078389 3300031241 Bacteria 1646
258 Ga0265329_10000073 3300031242 Bacteria 44995
259 Ga0265340_10004735 3300031247 Bacteria 7564
260 Ga0265340_10080951 3300031247 Bacteria 1529
261 Ga0265339_10000297 3300031249 Bacteria 40447
262 Ga0265339_10017327 3300031249 Bacteria 4270
263 Ga0265331_10002323 3300031250 Bacteria 12964
264 Ga0265316_10000247 3300031344 Bacteria 62442
265 Ga0265316_10006498 3300031344 Bacteria 11159
266 Ga0265316_10031779 3300031344 Bacteria 4313
267 Ga0307513_10009830 3300031456 Bacteria 12078
268 Ga0307513_10019971 3300031456 Bacteria 7957
269 Ga0307513_10416559 3300031456 Bacteria 1074
270 Ga0265313_10021567 3300031595 Bacteria 3520
271 Ga0265313_10077700 3300031595 Bacteria 1515
272 Ga0316575_10044549 3300031665 Bacteria 1760
273 Ga0316575_10084024 3300031665 Bacteria 1286
274 Ga0316579_10001291 3300031691 Bacteria 9032
275 Ga0265314_10000285 3300031711 Bacteria 73539
276 Ga0265314_10018968 3300031711 Bacteria 5337
277 Ga0265342_10000992 3300031712 Bacteria 27981
278 Ga0265342_10022716 3300031712 Bacteria 3984
279 Ga0316576_10010881 3300031727 Bacteria 5933
280 Ga0316576_10023846 3300031727 Bacteria 4267
281 Ga0316576_10026533 3300031727 Bacteria 4066
282 Ga0316578_10004230 3300031728 Bacteria 6739
283 Ga0307516_10051895 3300031730 Bacteria 4017
284 Ga0316577_10012378 3300031733 Bacteria 4648
285 Ga0316577_10387144 3300031733 Bacteria 794
286 Ga0307410_10295051 3300031852 Bacteria 1277
287 Ga0307406_10475677 3300031901 Bacteria 1008
288 Ga0307407_10219331 3300031903 Bacteria 1285
289 Ga0307409_100685191 3300031995 Bacteria 1023
290 Ga0307416_100171379 3300032002 Bacteria 2021
291 Ga0307415_100485010 3300032126 Bacteria 1077
292 Ga0307415_100697138 3300032126 Bacteria 916
293 Ga0316585_10000579 3300032137 Bacteria 8941
294 Ga0316580_10000011 3300032139 Bacteria 29061
295 Ga0316593_10000541 3300032168 Bacteria 7042
296 Ga0316596_1017334 3300033541 Bacteria 1811
297 Ga0373948_0047127 3300034817 Bacteria 917
298 Ga0373952_0001356 3300035092 Bacteria 4478
299 Ga0373936_0000031 3300035113 Bacteria 114679
300 Ga0373960_0042881 3300035121 Bacteria 1315
301 Ga0373955_0043703 3300035172 Bacteria 2411
302 Ga0316574_0056927 3300035398 Bacteria 2446
303 Ga0316574_0203281 3300035398 Bacteria 1272
304 Ga0316574_0401555 3300035398 Bacteria 863
305 Ga0373933_0407681 3300035724 Bacteria 887
306 Ga0316582_0000918 3300036647 Bacteria 12111
307 Ga0316582_0007994 3300036647 Bacteria 5660
308 Ga0316582_0089282 3300036647 Bacteria 2026
309 Ga0316584_0046394 3300036712 Bacteria 3246
310 Ga0395899_0084227 3300037312 Bacteria 2311
311 Ga0395900_0000335 3300037418 Bacteria 69270
312 Ga0395901_0287080 3300038443 Bacteria 1708
313 Ga0436363_0146733 3300039450 Bacteria 2124
314 Ga0436363_0168053 3300039450 Bacteria 873
315 Ga0451800_0965370 3300041459 Bacteria 1299
316 Ga0451577_0000209 3300042876 Bacteria 122695
317 Ga0451577_0002531 3300042876 Bacteria 21619
318 Ga0451577_0010905 3300042876 Bacteria 8635
319 Ga0451577_0112587 3300042876 Bacteria 2435
320 Ga0451577_0182448 3300042876 Bacteria 1892
321 Ga0451577_0257307 3300042876 Bacteria 1580
322 Ga0451577_0676735 3300042876 Bacteria 935
323 Ga0453683_0000173 3300044673 Bacteria 89468
324 Ga0453683_0029072 3300044673 Bacteria 3497
325 Ga0453683_0038340 3300044673 Bacteria 3012
326 Ga0453683_0045389 3300044673 Bacteria 2755
327 Ga0453683_0055411 3300044673 Bacteria 2481
328 Ga0453683_0090439 3300044673 Bacteria 1919
329 Ga0466963_0102734 3300044694 Bacteria 1958
330 Ga0453684_0000200 3300044712 Bacteria 263210
331 Ga0453684_0000362 3300044712 Bacteria 187378
332 Ga0453684_0004085 3300044712 Bacteria 31696
333 Ga0453684_0019701 3300044712 Bacteria 10242
334 Ga0453684_0046307 3300044712 Bacteria 5786
335 Ga0453684_0076714 3300044712 Bacteria 4194
336 Ga0453684_0230317 3300044712 Bacteria 2139
337 Ga0451576_0035655 3300045051 Bacteria 5276
338 Ga0451576_0753027 3300045051 Bacteria 1023
339 Ga0466967_0040848 3300045976 Bacteria 3996
340 Ga0495590_0140499 3300046457 Bacteria 871
341 Ga0495638_0012719 3300046460 Bacteria 5755
342 Ga0495638_0168075 3300046460 Bacteria 1260
343 Ga0495616_0001352 3300046513 Bacteria 17110
344 Ga0495632_0122557 3300046519 Bacteria 1214
345 Ga0495666_0179704 3300046526 Bacteria 977
346 Ga0495587_0111782 3300046536 Unclassified 1568
347 Ga0495656_0020853 3300046615 Bacteria 2546
348 Ga0495634_0187051 3300046642 Bacteria 1294
349 Ga0495625_0084392 3300046660 Bacteria 2206
350 Ga0495649_0010638 3300046694 Bacteria 5419
351 Ga0495649_0057552 3300046694 Bacteria 2096
352 Ga0495686_0252450 3300047472 Bacteria 991
353 Ga0495602_0096623 3300048088 Bacteria 2436
354 Ga0496100_0495365 3300048903 Bacteria 941
355 Ga0496102_0000085 3300048905 Bacteria 132501
356 Ga0496102_0038993 3300048905 Bacteria 4290
357 Ga0496103_0000094 3300048906 Bacteria 99474
358 Ga0496105_0280814 3300048908 Bacteria 1343
359 Ga0496106_0009444 3300048909 Bacteria 7209
360 Ga0496108_0269516 3300048911 Bacteria 1482
361 Ga0496109_0220380 3300048912 Bacteria 1784
362 Ga0496110_0030610 3300048913 Bacteria 4640
363 Ga0496110_0140875 3300048913 Bacteria 2180
364 Ga0496111_0401066 3300048914 Bacteria 1013
365 Ga0496112_0360371 3300048915 Bacteria 1396
366 Ga0496114_0004702 3300048917 Bacteria 10620
367 Ga0496116_0000271 3300048919 Bacteria 90342
368 Ga0496117_0000250 3300048920 Bacteria 101458
369 Ga0496118_0000577 3300048921 Bacteria 60617
370 Ga0496125_0011841 3300048928 Bacteria 8690
371 Ga0496126_0001316 3300048929 Bacteria 39504
372 Ga0501031_0136204 3300049568 Bacteria 1604
373 Ga0501031_0203599 3300049568 Bacteria 1291
374 Ga0501032_0011589 3300049569 Bacteria 6322
375 Ga0501032_0651911 3300049569 Bacteria 668
376 Ga0501033_0008210 3300049570 Bacteria 8087
377 Ga0501034_0399726 3300049571 Unclassified 1297
378 Ga0501036_0000430 3300049572 Bacteria 29851
379 Ga0501036_0014481 3300049572 Bacteria 6569
380 Ga0501036_0053406 3300049572 Bacteria 3422
381 Ga0501036_0622492 3300049572 Bacteria 894
382 Ga0501037_0301237 3300049573 Bacteria 1113
383 Ga0501038_0010578 3300049574 Bacteria 8434
384 Ga0501038_0533327 3300049574 Bacteria 894
385 Ga0501039_0002391 3300049575 Bacteria 13961
386 Ga0501040_0146873 3300049576 Bacteria 1662
387 Ga0501042_0025374 3300049578 Bacteria 4163
388 Ga0501046_0307096 3300049580 Bacteria 1157
389 Ga0501046_0354466 3300049580 Bacteria 1065
390 Ga0501047_0029125 3300049581 Bacteria 5326
391 Ga0501048_0128579 3300049582 Bacteria 1791
392 Ga0501068_0430444 3300049584 Bacteria 852
393 Ga0501069_0051669 3300049585 Bacteria 2288
394 Ga0501072_0070414 3300049588 Bacteria 2762
395 Ga0501073_0005110 3300049589 Bacteria 9842
396 Ga0501074_0074091 3300049590 Bacteria 2445
397 Ga0501075_0011252 3300049591 Bacteria 6331
398 Ga0501076_0025398 3300049592 Bacteria 4584
399 Ga0501076_0816396 3300049592 Bacteria 769
400 Ga0501077_0273738 3300049593 Bacteria 1074
401 Ga0501079_0031978 3300049741 Bacteria 4044
402 Ga0501080_0057149 3300049742 Bacteria 3633
403 Ga0501035_0000532 3300049822 Bacteria 42519
404 Ga0501035_0692301 3300049822 Bacteria 823
405 Ga0501044_0050522 3300049823 Bacteria 4289
406 Ga0501044_0120873 3300049823 Bacteria 2620
407 Ga0501045_0182194 3300049824 Bacteria 1565
408 Ga0501045_0208684 3300049824 Bacteria 1455
409 nmdc:mga05p37_114756_c1 3300050507 Bacteria 3311
410 nmdc:mga05p37_196169_c1 3300050507 Bacteria 2448
411 nmdc:mga05p37_3982_c1 3300050507 Bacteria 17278
412 nmdc:mga05p37_461351_c1 3300050507 Bacteria 1468
413 nmdc:mga05p37_4850_c1 3300050507 Bacteria 15740
414 nmdc:mga09592_143596_c1 3300050508 Bacteria 2058
415 nmdc:mga09592_5334_c1 3300050508 Bacteria 10445
416 nmdc:mga0qj67_72040_c1 3300050509 Bacteria 2758
417 nmdc:mga06r32_266677_c1 3300050510 Bacteria 1700
418 nmdc:mga08y16_177743_c1 3300050511 Bacteria 2210
419 nmdc:mga08y16_1_c1 3300050511 Bacteria 1034622
420 nmdc:mga0n895_13460_c1 3300050512 Bacteria 7381
421 nmdc:mga0rr50_13178_c1 3300050513 Bacteria 5373
422 nmdc:mga0rr50_280_c1 3300050513 Bacteria 27644
423 nmdc:mga08x19_105360_c1 3300050514 Bacteria 1875
424 nmdc:mga08x19_1_c1 3300050514 Bacteria 2010344
425 nmdc:mga08x19_97387_c1 3300050514 Bacteria 1948
426 nmdc:mga0a205_17327_c1 3300050515 Bacteria 6750
427 nmdc:mga0a205_41978_c1 3300050515 Bacteria 4407
428 nmdc:mga0a205_42958_c2 3300050515 Bacteria 2176
429 Ga0500566_0002114 3300053094 Bacteria 11704
430 Ga0500594_0068647 3300053118 Bacteria 1038
431 Ga0500603_002004 3300053150 Bacteria 4522
432 Ga0500616_0000047 3300053153 Bacteria 322354
433 Ga0500611_022436 3300053727 Bacteria 1217
434 Ga0501084_0195383 3300054114 Bacteria 1707
435 Ga0501084_0436302 3300054114 Bacteria 1107
436 Ga0501084_0528364 3300054114 Bacteria 997
437 Ga0501082_0114602 3300060353 Bacteria 2334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025893 Ga0207682_10135173 Ga0207682_101351732 174
2 3300035724 Ga0373933_0407681 Ga0373933_0407681_170_871 192
3 3300037418 Ga0395900_0000335 Ga0395900_0000335_46003_46674 198
4 3300028653 Ga0265323_10139822 Ga0265323_101398221 201
5 3300028653 Ga0265323_10018760 Ga0265323_100187604 202
6 3300049592 Ga0501076_0816396 Ga0501076_0816396_32_643 202
7 3300009098 Ga0105245_10241346 Ga0105245_102413462 203
8 3300031344 Ga0265316_10006498 Ga0265316_1000649810 204
9 3300046526 Ga0495666_0179704 Ga0495666_0179704_224_946 204
10 3300046536 Ga0495587_0111782 Ga0495587_0111782_907_1533 204
11 3300014326 Ga0157380_10086348 Ga0157380_100863482 206
12 3300049569 Ga0501032_0651911 Ga0501032_0651911_12_644 210
13 3300049572 Ga0501036_0622492 Ga0501036_0622492_25_657 210
14 3300049574 Ga0501038_0533327 Ga0501038_0533327_25_657 210
15 3300049584 Ga0501068_0430444 Ga0501068_0430444_25_657 210
16 3300035113 Ga0373936_0000031 Ga0373936_0000031_65084_65737 211
17 3300048088 Ga0495602_0096623 Ga0495602_0096623_528_1193 211
18 3300039450 Ga0436363_0146733 Ga0436363_0146733_1361_2029 212
19 3300053094 Ga0500566_0002114 Ga0500566_0002114_3623_4279 212
20 3300053150 Ga0500603_002004 Ga0500603_002004_2947_3603 212
21 3300005356 Ga0070674_100007220 Ga0070674_1000072204 213
22 3300017792 Ga0163161_10001610 Ga0163161_100016106 213
23 3300025937 Ga0207669_10102972 Ga0207669_101029722 213
24 3300028800 Ga0265338_10003344 Ga0265338_100033447 213
25 3300031730 Ga0307516_10051895 Ga0307516_100518952 213
26 3300037312 Ga0395899_0084227 Ga0395899_0084227_612_1283 213
27 3300038443 Ga0395901_0287080 Ga0395901_0287080_1006_1677 213
28 3300045976 Ga0466967_0040848 Ga0466967_0040848_3184_3834 213
29 3300005327 Ga0070658_10101174 Ga0070658_101011742 214
30 3300006028 Ga0070717_10018303 Ga0070717_100183033 214
31 3300025909 Ga0207705_10253728 Ga0207705_102537282 214
32 3300028800 Ga0265338_10148164 Ga0265338_101481643 214
33 3300044673 Ga0453683_0090439 Ga0453683_0090439_656_1327 214
34 3300048905 Ga0496102_0000085 Ga0496102_0000085_72064_72804 214
35 3300048906 Ga0496103_0000094 Ga0496103_0000094_17557_18297 214
36 3300048917 Ga0496114_0004702 Ga0496114_0004702_4728_5468 214
37 3300048919 Ga0496116_0000271 Ga0496116_0000271_8415_9155 214
38 3300048920 Ga0496117_0000250 Ga0496117_0000250_24935_25675 214
39 3300048921 Ga0496118_0000577 Ga0496118_0000577_42194_42934 214
40 3300048928 Ga0496125_0011841 Ga0496125_0011841_2614_3354 214
41 3300048929 Ga0496126_0001316 Ga0496126_0001316_33469_34209 214
42 iso_pu_bacteria 2671180195 2671837223 214
43 iso_pu_bacteria 2773857922 2774855379 214
44 3300009094 Ga0111539_10157813 Ga0111539_101578133 215
45 3300028653 Ga0265323_10002119 Ga0265323_100021198 215
46 3300028800 Ga0265338_10043269 Ga0265338_100432695 215
47 3300050511 nmdc:mga08y16_177743_c1 nmdc:mga08y16_177743_c1_857_1534 215
48 3300006852 Ga0075433_10005371 Ga0075433_100053716 216
49 3300006871 Ga0075434_100000940 Ga0075434_10000094019 216
50 3300007076 Ga0075435_100001652 Ga0075435_1000016526 216
51 3300009147 Ga0114129_10000942 Ga0114129_1000094231 216
52 3300028800 Ga0265338_10035683 Ga0265338_100356836 216
53 3300048915 Ga0496112_0360371 Ga0496112_0360371_666_1340 216
54 3300049580 Ga0501046_0354466 Ga0501046_0354466_286_939 216
55 3300050507 nmdc:mga05p37_4850_c1 nmdc:mga05p37_4850_c1_2215_2889 216
56 3300050512 nmdc:mga0n895_13460_c1 nmdc:mga0n895_13460_c1_1229_1903 216
57 3300050513 nmdc:mga0rr50_280_c1 nmdc:mga0rr50_280_c1_19583_20257 216
58 3300050514 nmdc:mga08x19_105360_c1 nmdc:mga08x19_105360_c1_445_1119 216
59 3300050515 nmdc:mga0a205_17327_c1 nmdc:mga0a205_17327_c1_985_1659 216
60 3300053153 Ga0500616_0000047 Ga0500616_0000047_57949_58611 216
61 3300005334 Ga0068869_100007727 Ga0068869_1000077272 217
62 3300005345 Ga0070692_10389589 Ga0070692_103895891 217
63 3300005353 Ga0070669_100021551 Ga0070669_1000215513 217
64 3300005444 Ga0070694_100002329 Ga0070694_1000023299 217
65 3300005455 Ga0070663_100236138 Ga0070663_1002361382 217
66 3300005543 Ga0070672_100126613 Ga0070672_1001266132 217
67 3300005545 Ga0070695_100075575 Ga0070695_1000755752 217
68 3300005549 Ga0070704_100695784 Ga0070704_1006957841 217
69 3300005719 Ga0068861_100097604 Ga0068861_1000976042 217
70 3300005841 Ga0068863_100152971 Ga0068863_1001529713 217
71 3300005843 Ga0068860_100020867 Ga0068860_1000208672 217
72 3300005844 Ga0068862_100585392 Ga0068862_1005853922 217
73 3300005937 Ga0081455_10010977 Ga0081455_100109773 217
74 3300006844 Ga0075428_100065095 Ga0075428_1000650954 217
75 3300006880 Ga0075429_100183886 Ga0075429_1001838862 217
76 3300009093 Ga0105240_10419900 Ga0105240_104199002 217
77 3300009098 Ga0105245_10358333 Ga0105245_103583332 217
78 3300009553 Ga0105249_10005443 Ga0105249_100054438 217
79 3300011119 Ga0105246_10685645 Ga0105246_106856451 217
80 3300013306 Ga0163162_10281064 Ga0163162_102810641 217
81 3300014325 Ga0163163_10418670 Ga0163163_104186702 217
82 3300014326 Ga0157380_10116690 Ga0157380_101166902 217
83 3300014968 Ga0157379_10172038 Ga0157379_101720382 217
84 3300025923 Ga0207681_10291360 Ga0207681_102913602 217
85 3300025927 Ga0207687_10399097 Ga0207687_103990971 217
86 3300025940 Ga0207691_10136276 Ga0207691_101362762 217
87 3300025942 Ga0207689_10009008 Ga0207689_100090089 217
88 3300025961 Ga0207712_10021683 Ga0207712_100216833 217
89 3300026067 Ga0207678_10019966 Ga0207678_100199662 217
90 3300028380 Ga0268265_10008123 Ga0268265_100081234 217
91 3300028573 Ga0265334_10002532 Ga0265334_100025323 217
92 3300028577 Ga0265318_10003825 Ga0265318_100038255 217
93 3300028800 Ga0265338_10017342 Ga0265338_100173425 217
94 3300031235 Ga0265330_10016380 Ga0265330_100163803 217
95 3300031239 Ga0265328_10010697 Ga0265328_100106975 217
96 3300031240 Ga0265320_10017481 Ga0265320_100174815 217
97 3300031241 Ga0265325_10020524 Ga0265325_100205242 217
98 3300031247 Ga0265340_10080951 Ga0265340_100809512 217
99 3300031249 Ga0265339_10017327 Ga0265339_100173275 217
100 3300031344 Ga0265316_10031779 Ga0265316_100317793 217
101 3300031456 Ga0307513_10009830 Ga0307513_100098305 217
102 3300031595 Ga0265313_10021567 Ga0265313_100215673 217
103 3300031711 Ga0265314_10018968 Ga0265314_100189685 217
104 3300031712 Ga0265342_10022716 Ga0265342_100227163 217
105 3300031727 Ga0316576_10010881 Ga0316576_100108812 217
106 3300031727 Ga0316576_10026533 Ga0316576_100265335 217
107 3300031733 Ga0316577_10387144 Ga0316577_103871441 217
108 3300032168 Ga0316593_10000541 Ga0316593_100005413 217
109 3300033541 Ga0316596_1017334 Ga0316596_10173343 217
110 3300036647 Ga0316582_0000918 Ga0316582_0000918_6483_7163 217
111 3300036647 Ga0316582_0089282 Ga0316582_0089282_1072_1755 217
112 3300036712 Ga0316584_0046394 Ga0316584_0046394_164_847 217
113 3300041459 Ga0451800_0965370 Ga0451800_0965370_82_753 217
114 3300045051 Ga0451576_0753027 Ga0451576_0753027_265_966 217
115 3300048905 Ga0496102_0038993 Ga0496102_0038993_2985_3659 217
116 3300048909 Ga0496106_0009444 Ga0496106_0009444_2575_3249 217
117 3300048913 Ga0496110_0140875 Ga0496110_0140875_92_793 217
118 3300049585 Ga0501069_0051669 Ga0501069_0051669_1419_2087 217
119 3300049822 Ga0501035_0692301 Ga0501035_0692301_106_774 217
120 3300050508 nmdc:mga09592_143596_c1 nmdc:mga09592_143596_c1_449_1156 217
121 3300054114 Ga0501084_0528364 Ga0501084_0528364_225_893 217
122 3300006163 Ga0070715_10022974 Ga0070715_100229743 218
123 3300006175 Ga0070712_100010717 Ga0070712_1000107172 218
124 3300006852 Ga0075433_10528177 Ga0075433_105281771 218
125 3300009098 Ga0105245_10181355 Ga0105245_101813552 218
126 3300009147 Ga0114129_10044622 Ga0114129_100446221 218
127 3300009551 Ga0105238_10672611 Ga0105238_106726112 218
128 3300025915 Ga0207693_10014592 Ga0207693_100145928 218
129 3300025924 Ga0207694_10633681 Ga0207694_106336812 218
130 3300026116 Ga0207674_10137809 Ga0207674_101378092 218
131 3300026118 Ga0207675_100412380 Ga0207675_1004123802 218
132 3300027907 Ga0207428_10392299 Ga0207428_103922992 218
133 3300028573 Ga0265334_10000030 Ga0265334_10000030102 218
134 3300028794 Ga0307515_10357283 Ga0307515_103572832 218
135 3300035398 Ga0316574_0203281 Ga0316574_0203281_484_1161 218
136 3300046457 Ga0495590_0140499 Ga0495590_0140499_36_725 218
137 3300046460 Ga0495638_0168075 Ga0495638_0168075_258_944 218
138 3300046513 Ga0495616_0001352 Ga0495616_0001352_15784_16470 218
139 3300046519 Ga0495632_0122557 Ga0495632_0122557_444_1133 218
140 3300046694 Ga0495649_0010638 Ga0495649_0010638_311_985 218
141 3300046694 Ga0495649_0057552 Ga0495649_0057552_1047_1736 218
142 3300047472 Ga0495686_0252450 Ga0495686_0252450_229_912 218
143 3300048903 Ga0496100_0495365 Ga0496100_0495365_184_858 218
144 3300049568 Ga0501031_0136204 Ga0501031_0136204_699_1361 218
145 3300049569 Ga0501032_0011589 Ga0501032_0011589_2907_3569 218
146 3300049570 Ga0501033_0008210 Ga0501033_0008210_566_1228 218
147 3300049571 Ga0501034_0399726 Ga0501034_0399726_522_1196 218
148 3300049572 Ga0501036_0014481 Ga0501036_0014481_3713_4375 218
149 3300049573 Ga0501037_0301237 Ga0501037_0301237_55_717 218
150 3300049574 Ga0501038_0010578 Ga0501038_0010578_5006_5668 218
151 3300049575 Ga0501039_0002391 Ga0501039_0002391_3781_4443 218
152 3300049580 Ga0501046_0307096 Ga0501046_0307096_403_1065 218
153 3300049822 Ga0501035_0000532 Ga0501035_0000532_11599_12261 218
154 3300049823 Ga0501044_0050522 Ga0501044_0050522_78_740 218
155 3300049823 Ga0501044_0120873 Ga0501044_0120873_144_806 218
156 3300049824 Ga0501045_0182194 Ga0501045_0182194_726_1388 218
157 3300050507 nmdc:mga05p37_196169_c1 nmdc:mga05p37_196169_c1_139_816 218
158 3300050515 nmdc:mga0a205_41978_c1 nmdc:mga0a205_41978_c1_3469_4146 218
159 3300053118 Ga0500594_0068647 Ga0500594_0068647_172_846 218
160 3300053727 Ga0500611_022436 Ga0500611_022436_230_916 218
161 3300005330 Ga0070690_100022173 Ga0070690_1000221735 219
162 3300005338 Ga0068868_100470385 Ga0068868_1004703852 219
163 3300005340 Ga0070689_100018205 Ga0070689_1000182053 219
164 3300005343 Ga0070687_100021702 Ga0070687_1000217025 219
165 3300005365 Ga0070688_100665875 Ga0070688_1006658751 219
166 3300005366 Ga0070659_100110198 Ga0070659_1001101982 219
167 3300005438 Ga0070701_10002981 Ga0070701_100029812 219
168 3300005440 Ga0070705_100096890 Ga0070705_1000968902 219
169 3300005445 Ga0070708_100192501 Ga0070708_1001925012 219
170 3300005467 Ga0070706_100100973 Ga0070706_1001009733 219
171 3300005468 Ga0070707_100258950 Ga0070707_1002589501 219
172 3300005471 Ga0070698_100016943 Ga0070698_1000169432 219
173 3300005518 Ga0070699_100131572 Ga0070699_1001315723 219
174 3300005546 Ga0070696_100209137 Ga0070696_1002091374 219
175 3300005615 Ga0070702_100003205 Ga0070702_10000320510 219
176 3300005616 Ga0068852_100454697 Ga0068852_1004546972 219
177 3300005617 Ga0068859_100008795 Ga0068859_1000087956 219
178 3300005618 Ga0068864_100011563 Ga0068864_1000115639 219
179 3300005719 Ga0068861_100053970 Ga0068861_1000539705 219
180 3300005842 Ga0068858_100140628 Ga0068858_1001406282 219
181 3300005843 Ga0068860_100058078 Ga0068860_1000580783 219
182 3300005844 Ga0068862_100044508 Ga0068862_1000445085 219
183 3300006931 Ga0097620_100008795 Ga0097620_1000087956 219
184 3300009098 Ga0105245_10081989 Ga0105245_100819892 219
185 3300009177 Ga0105248_10769064 Ga0105248_107690642 219
186 3300013297 Ga0157378_10089176 Ga0157378_100891765 219
187 3300025910 Ga0207684_10022843 Ga0207684_100228432 219
188 3300025918 Ga0207662_10021878 Ga0207662_100218783 219
189 3300025922 Ga0207646_10070571 Ga0207646_100705713 219
190 3300025927 Ga0207687_10188822 Ga0207687_101888222 219
191 3300025936 Ga0207670_10009212 Ga0207670_100092125 219
192 3300025941 Ga0207711_10278675 Ga0207711_102786752 219
193 3300026023 Ga0207677_10253674 Ga0207677_102536742 219
194 3300026035 Ga0207703_10524545 Ga0207703_105245452 219
195 3300026075 Ga0207708_10202897 Ga0207708_102028972 219
196 3300026095 Ga0207676_10010098 Ga0207676_100100988 219
197 3300026118 Ga0207675_100012288 Ga0207675_1000122887 219
198 3300028380 Ga0268265_10005864 Ga0268265_1000586410 219
199 3300031665 Ga0316575_10084024 Ga0316575_100840242 219
200 3300035398 Ga0316574_0401555 Ga0316574_0401555_164_853 219
201 3300005467 Ga0070706_100013908 Ga0070706_1000139082 220
202 3300005467 Ga0070706_100179822 Ga0070706_1001798222 220
203 3300005468 Ga0070707_100280456 Ga0070707_1002804562 220
204 3300005468 Ga0070707_100331265 Ga0070707_1003312652 220
205 3300005536 Ga0070697_100258748 Ga0070697_1002587482 220
206 3300005536 Ga0070697_100616770 Ga0070697_1006167701 220
207 3300005549 Ga0070704_100177338 Ga0070704_1001773382 220
208 3300005549 Ga0070704_100285681 Ga0070704_1002856812 220
209 3300006914 Ga0075436_100000001 Ga0075436_100000001374 220
210 3300009094 Ga0111539_10000033 Ga0111539_1000003373 220
211 3300025910 Ga0207684_10062719 Ga0207684_100627192 220
212 3300025922 Ga0207646_10131990 Ga0207646_101319902 220
213 3300026023 Ga0207677_10306299 Ga0207677_103062992 220
214 3300026067 Ga0207678_10474999 Ga0207678_104749992 220
215 3300027907 Ga0207428_10000001 Ga0207428_1000000178 220
216 3300028800 Ga0265338_10021908 Ga0265338_100219086 220
217 3300031456 Ga0307513_10416559 Ga0307513_104165592 220
218 3300031595 Ga0265313_10077700 Ga0265313_100777002 220
219 3300031852 Ga0307410_10295051 Ga0307410_102950512 220
220 3300031903 Ga0307407_10219331 Ga0307407_102193312 220
221 3300032126 Ga0307415_100485010 Ga0307415_1004850102 220
222 3300035172 Ga0373955_0043703 Ga0373955_0043703_128_823 220
223 3300042876 Ga0451577_0010905 Ga0451577_0010905_375_1070 220
224 3300044712 Ga0453684_0076714 Ga0453684_0076714_3199_3894 220
225 3300050511 nmdc:mga08y16_1_c1 nmdc:mga08y16_1_c1_952318_953010 220
226 3300050514 nmdc:mga08x19_1_c1 nmdc:mga08x19_1_c1_257188_257889 220
227 3300005329 Ga0070683_100059431 Ga0070683_1000594312 221
228 3300005333 Ga0070677_10001319 Ga0070677_100013194 221
229 3300005333 Ga0070677_10004544 Ga0070677_100045444 221
230 3300005334 Ga0068869_100050199 Ga0068869_1000501993 221
231 3300005335 Ga0070666_10066878 Ga0070666_100668782 221
232 3300005337 Ga0070682_100059067 Ga0070682_1000590673 221
233 3300005338 Ga0068868_100287824 Ga0068868_1002878242 221
234 3300005344 Ga0070661_100075943 Ga0070661_1000759431 221
235 3300005353 Ga0070669_100046564 Ga0070669_1000465642 221
236 3300005354 Ga0070675_100009442 Ga0070675_1000094425 221
237 3300005354 Ga0070675_100062721 Ga0070675_1000627212 221
238 3300005354 Ga0070675_100489225 Ga0070675_1004892251 221
239 3300005356 Ga0070674_100051823 Ga0070674_1000518233 221
240 3300005356 Ga0070674_100302032 Ga0070674_1003020322 221
241 3300005364 Ga0070673_100008461 Ga0070673_1000084613 221
242 3300005364 Ga0070673_100166449 Ga0070673_1001664493 221
243 3300005441 Ga0070700_100224296 Ga0070700_1002242963 221
244 3300005456 Ga0070678_100007578 Ga0070678_1000075785 221
245 3300005456 Ga0070678_100089750 Ga0070678_1000897503 221
246 3300005459 Ga0068867_100067025 Ga0068867_1000670253 221
247 3300005459 Ga0068867_100116186 Ga0068867_1001161862 221
248 3300005466 Ga0070685_10073212 Ga0070685_100732122 221
249 3300005467 Ga0070706_100043034 Ga0070706_1000430342 221
250 3300005468 Ga0070707_100333667 Ga0070707_1003336671 221
251 3300005535 Ga0070684_100675240 Ga0070684_1006752401 221
252 3300005539 Ga0068853_100456041 Ga0068853_1004560411 221
253 3300005543 Ga0070672_100025997 Ga0070672_1000259971 221
254 3300005543 Ga0070672_100052881 Ga0070672_1000528812 221
255 3300005543 Ga0070672_100764580 Ga0070672_1007645801 221
256 3300005548 Ga0070665_100255113 Ga0070665_1002551131 221
257 3300005548 Ga0070665_100485976 Ga0070665_1004859762 221
258 3300005564 Ga0070664_100568654 Ga0070664_1005686542 221
259 3300005615 Ga0070702_100153070 Ga0070702_1001530702 221
260 3300005618 Ga0068864_100307860 Ga0068864_1003078602 221
261 3300005618 Ga0068864_101117245 Ga0068864_1011172451 221
262 3300005719 Ga0068861_100113146 Ga0068861_1001131463 221
263 3300005840 Ga0068870_10023706 Ga0068870_100237064 221
264 3300005841 Ga0068863_100509616 Ga0068863_1005096162 221
265 3300006042 Ga0075368_10089551 Ga0075368_100895512 221
266 3300006237 Ga0097621_100054944 Ga0097621_1000549442 221
267 3300006237 Ga0097621_100203100 Ga0097621_1002031003 221
268 3300006237 Ga0097621_100750233 Ga0097621_1007502332 221
269 3300006358 Ga0068871_100476991 Ga0068871_1004769911 221
270 3300006852 Ga0075433_10195759 Ga0075433_101957592 221
271 3300006881 Ga0068865_100220525 Ga0068865_1002205252 221
272 3300006881 Ga0068865_100336039 Ga0068865_1003360391 221
273 3300006914 Ga0075436_100016972 Ga0075436_1000169727 221
274 3300006914 Ga0075436_100049837 Ga0075436_1000498371 221
275 3300007076 Ga0075435_100011216 Ga0075435_1000112163 221
276 3300009101 Ga0105247_10410338 Ga0105247_104103381 221
277 3300009147 Ga0114129_10013292 Ga0114129_100132923 221
278 3300009176 Ga0105242_10033229 Ga0105242_100332293 221
279 3300009177 Ga0105248_10379140 Ga0105248_103791402 221
280 3300013296 Ga0157374_10359104 Ga0157374_103591042 221
281 3300013297 Ga0157378_10087831 Ga0157378_100878313 221
282 3300013306 Ga0163162_10034010 Ga0163162_100340104 221
283 3300014325 Ga0163163_11276575 Ga0163163_112765751 221
284 3300014326 Ga0157380_10008213 Ga0157380_100082134 221
285 3300014326 Ga0157380_10366821 Ga0157380_103668212 221
286 3300014326 Ga0157380_10614690 Ga0157380_106146902 221
287 3300014969 Ga0157376_10041472 Ga0157376_100414724 221
288 3300014969 Ga0157376_10144692 Ga0157376_101446923 221
289 3300014969 Ga0157376_10936300 Ga0157376_109363001 221
290 3300017792 Ga0163161_10479208 Ga0163161_104792082 221
291 3300025893 Ga0207682_10001261 Ga0207682_100012616 221
292 3300025893 Ga0207682_10004744 Ga0207682_100047444 221
293 3300025893 Ga0207682_10114053 Ga0207682_101140532 221
294 3300025899 Ga0207642_10129719 Ga0207642_101297193 221
295 3300025907 Ga0207645_10075873 Ga0207645_100758733 221
296 3300025908 Ga0207643_10005444 Ga0207643_100054443 221
297 3300025908 Ga0207643_10198951 Ga0207643_101989512 221
298 3300025910 Ga0207684_10001071 Ga0207684_1000107126 221
299 3300025920 Ga0207649_10033555 Ga0207649_100335553 221
300 3300025922 Ga0207646_10006027 Ga0207646_1000602711 221
301 3300025922 Ga0207646_10149788 Ga0207646_101497882 221
302 3300025923 Ga0207681_10412771 Ga0207681_104127712 221
303 3300025925 Ga0207650_10121841 Ga0207650_101218412 221
304 3300025926 Ga0207659_10081808 Ga0207659_100818082 221
305 3300025926 Ga0207659_10197558 Ga0207659_101975583 221
306 3300025937 Ga0207669_10077445 Ga0207669_100774452 221
307 3300025937 Ga0207669_10104998 Ga0207669_101049982 221
308 3300025937 Ga0207669_10464052 Ga0207669_104640521 221
309 3300025940 Ga0207691_10003742 Ga0207691_100037427 221
310 3300025940 Ga0207691_10006277 Ga0207691_100062777 221
311 3300025940 Ga0207691_10124944 Ga0207691_101249442 221
312 3300025941 Ga0207711_10217465 Ga0207711_102174652 221
313 3300025942 Ga0207689_10029027 Ga0207689_100290273 221
314 3300025944 Ga0207661_10071253 Ga0207661_100712533 221
315 3300025960 Ga0207651_10047770 Ga0207651_100477702 221
316 3300026067 Ga0207678_10303532 Ga0207678_103035323 221
317 3300026089 Ga0207648_10015435 Ga0207648_100154354 221
318 3300026089 Ga0207648_10051336 Ga0207648_100513363 221
319 3300026095 Ga0207676_10302786 Ga0207676_103027862 221
320 3300026121 Ga0207683_10009804 Ga0207683_100098044 221
321 3300026121 Ga0207683_10046533 Ga0207683_100465334 221
322 3300026121 Ga0207683_10202077 Ga0207683_102020773 221
323 3300026142 Ga0207698_10047978 Ga0207698_100479782 221
324 3300027907 Ga0207428_10102172 Ga0207428_101021723 221
325 3300028379 Ga0268266_10767059 Ga0268266_107670592 221
326 3300031456 Ga0307513_10019971 Ga0307513_100199712 221
327 3300031665 Ga0316575_10044549 Ga0316575_100445493 221
328 3300031691 Ga0316579_10001291 Ga0316579_100012915 221
329 3300031727 Ga0316576_10023846 Ga0316576_100238462 221
330 3300031728 Ga0316578_10004230 Ga0316578_100042308 221
331 3300031733 Ga0316577_10012378 Ga0316577_100123785 221
332 3300031901 Ga0307406_10475677 Ga0307406_104756772 221
333 3300031995 Ga0307409_100685191 Ga0307409_1006851912 221
334 3300032002 Ga0307416_100171379 Ga0307416_1001713792 221
335 3300032126 Ga0307415_100697138 Ga0307415_1006971382 221
336 3300032137 Ga0316585_10000579 Ga0316585_100005798 221
337 3300032139 Ga0316580_10000011 Ga0316580_1000001125 221
338 3300034817 Ga0373948_0047127 Ga0373948_0047127_170_850 221
339 3300035092 Ga0373952_0001356 Ga0373952_0001356_25_705 221
340 3300035121 Ga0373960_0042881 Ga0373960_0042881_271_951 221
341 3300035398 Ga0316574_0056927 Ga0316574_0056927_1610_2308 221
342 3300036647 Ga0316582_0007994 Ga0316582_0007994_200_898 221
343 3300039450 Ga0436363_0168053 Ga0436363_0168053_37_741 221
344 3300042876 Ga0451577_0257307 Ga0451577_0257307_247_948 221
345 3300042876 Ga0451577_0676735 Ga0451577_0676735_202_903 221
346 3300044673 Ga0453683_0000173 Ga0453683_0000173_16454_17155 221
347 3300044673 Ga0453683_0038340 Ga0453683_0038340_1517_2218 221
348 3300044673 Ga0453683_0055411 Ga0453683_0055411_264_965 221
349 3300044694 Ga0466963_0102734 Ga0466963_0102734_651_1325 221
350 3300044712 Ga0453684_0004085 Ga0453684_0004085_14808_15509 221
351 3300044712 Ga0453684_0019701 Ga0453684_0019701_4441_5142 221
352 3300046460 Ga0495638_0012719 Ga0495638_0012719_4502_5221 221
353 3300046615 Ga0495656_0020853 Ga0495656_0020853_1024_1746 221
354 3300046660 Ga0495625_0084392 Ga0495625_0084392_406_1113 221
355 3300048908 Ga0496105_0280814 Ga0496105_0280814_427_1110 221
356 3300048911 Ga0496108_0269516 Ga0496108_0269516_589_1287 221
357 3300048912 Ga0496109_0220380 Ga0496109_0220380_880_1563 221
358 3300048913 Ga0496110_0030610 Ga0496110_0030610_1777_2460 221
359 3300048914 Ga0496111_0401066 Ga0496111_0401066_300_983 221
360 3300049568 Ga0501031_0203599 Ga0501031_0203599_571_1260 221
361 3300049572 Ga0501036_0000430 Ga0501036_0000430_4089_4775 221
362 3300049572 Ga0501036_0053406 Ga0501036_0053406_21_710 221
363 3300049576 Ga0501040_0146873 Ga0501040_0146873_908_1597 221
364 3300049578 Ga0501042_0025374 Ga0501042_0025374_677_1366 221
365 3300049581 Ga0501047_0029125 Ga0501047_0029125_2309_3001 221
366 3300049582 Ga0501048_0128579 Ga0501048_0128579_56_745 221
367 3300049588 Ga0501072_0070414 Ga0501072_0070414_659_1348 221
368 3300049590 Ga0501074_0074091 Ga0501074_0074091_1323_2000 221
369 3300049591 Ga0501075_0011252 Ga0501075_0011252_14_679 221
370 3300049592 Ga0501076_0025398 Ga0501076_0025398_819_1508 221
371 3300049593 Ga0501077_0273738 Ga0501077_0273738_60_749 221
372 3300049741 Ga0501079_0031978 Ga0501079_0031978_3356_4021 221
373 3300049824 Ga0501045_0208684 Ga0501045_0208684_71_760 221
374 3300050507 nmdc:mga05p37_3982_c1 nmdc:mga05p37_3982_c1_7054_7752 221
375 3300050513 nmdc:mga0rr50_13178_c1 nmdc:mga0rr50_13178_c1_57_755 221
376 3300050514 nmdc:mga08x19_97387_c1 nmdc:mga08x19_97387_c1_1220_1918 221
377 3300050515 nmdc:mga0a205_42958_c2 nmdc:mga0a205_42958_c2_534_1232 221
378 3300054114 Ga0501084_0195383 Ga0501084_0195383_1007_1696 221
379 3300060353 Ga0501082_0114602 Ga0501082_0114602_947_1636 221
380 3300005343 Ga0070687_100400228 Ga0070687_1004002281 222
381 3300005468 Ga0070707_100216046 Ga0070707_1002160461 222
382 3300005468 Ga0070707_100356554 Ga0070707_1003565542 222
383 3300005546 Ga0070696_100052996 Ga0070696_1000529961 222
384 3300005549 Ga0070704_100557704 Ga0070704_1005577041 222
385 3300009174 Ga0105241_10867933 Ga0105241_108679331 222
386 3300025910 Ga0207684_10516205 Ga0207684_105162051 222
387 3300025918 Ga0207662_10042204 Ga0207662_100422042 222
388 3300025922 Ga0207646_10293341 Ga0207646_102933412 222
389 3300028558 Ga0265326_10001755 Ga0265326_100017551 222
390 3300028563 Ga0265319_1000169 Ga0265319_10001693 222
391 3300028577 Ga0265318_10063061 Ga0265318_100630612 222
392 3300028577 Ga0265318_10124791 Ga0265318_101247911 222
393 3300028653 Ga0265323_10000377 Ga0265323_1000037719 222
394 3300028654 Ga0265322_10000248 Ga0265322_100002489 222
395 3300028800 Ga0265338_10007677 Ga0265338_100076773 222
396 3300029957 Ga0265324_10000265 Ga0265324_1000026517 222
397 3300031235 Ga0265330_10001279 Ga0265330_100012794 222
398 3300031238 Ga0265332_10000693 Ga0265332_1000069319 222
399 3300031240 Ga0265320_10001579 Ga0265320_1000157910 222
400 3300031241 Ga0265325_10078389 Ga0265325_100783891 222
401 3300031242 Ga0265329_10000073 Ga0265329_1000007336 222
402 3300031247 Ga0265340_10004735 Ga0265340_100047356 222
403 3300031249 Ga0265339_10000297 Ga0265339_1000029735 222
404 3300031250 Ga0265331_10002323 Ga0265331_100023239 222
405 3300031344 Ga0265316_10000247 Ga0265316_1000024750 222
406 3300031711 Ga0265314_10000285 Ga0265314_1000028513 222
407 3300031712 Ga0265342_10000992 Ga0265342_1000099211 222
408 3300042876 Ga0451577_0000209 Ga0451577_0000209_75040_75795 222
409 3300042876 Ga0451577_0002531 Ga0451577_0002531_8269_8982 222
410 3300042876 Ga0451577_0112587 Ga0451577_0112587_1141_1851 222
411 3300042876 Ga0451577_0182448 Ga0451577_0182448_495_1376 222
412 3300044673 Ga0453683_0029072 Ga0453683_0029072_1528_2283 222
413 3300044673 Ga0453683_0045389 Ga0453683_0045389_682_1563 222
414 3300044712 Ga0453684_0000200 Ga0453684_0000200_47306_48019 222
415 3300044712 Ga0453684_0000362 Ga0453684_0000362_51113_51868 222
416 3300044712 Ga0453684_0046307 Ga0453684_0046307_4044_4781 222
417 3300044712 Ga0453684_0230317 Ga0453684_0230317_574_1455 222
418 3300045051 Ga0451576_0035655 Ga0451576_0035655_2469_3350 222
419 3300050507 nmdc:mga05p37_461351_c1 nmdc:mga05p37_461351_c1_145_822 222
420 3300054114 Ga0501084_0436302 Ga0501084_0436302_145_825 222
421 3300005293 Ga0065715_10099225 Ga0065715_100992253 223
422 3300005330 Ga0070690_100051927 Ga0070690_1000519274 223
423 3300005334 Ga0068869_100331417 Ga0068869_1003314172 223
424 3300005444 Ga0070694_100158449 Ga0070694_1001584491 223
425 3300005445 Ga0070708_100049765 Ga0070708_1000497654 223
426 3300005467 Ga0070706_100106940 Ga0070706_1001069402 223
427 3300005545 Ga0070695_100355315 Ga0070695_1003553151 223
428 3300006844 Ga0075428_100012015 Ga0075428_1000120155 223
429 3300006846 Ga0075430_100017257 Ga0075430_1000172579 223
430 3300006847 Ga0075431_100102563 Ga0075431_1001025633 223
431 3300026116 Ga0207674_10771927 Ga0207674_107719271 223
432 3300028381 Ga0268264_10612027 Ga0268264_106120272 223
433 3300046642 Ga0495634_0187051 Ga0495634_0187051_503_1216 223
434 3300049589 Ga0501073_0005110 Ga0501073_0005110_8865_9551 223
435 3300049742 Ga0501080_0057149 Ga0501080_0057149_2386_3072 223
436 3300050507 nmdc:mga05p37_114756_c1 nmdc:mga05p37_114756_c1_1760_2467 223
437 3300050508 nmdc:mga09592_5334_c1 nmdc:mga09592_5334_c1_5525_6232 223
438 3300050509 nmdc:mga0qj67_72040_c1 nmdc:mga0qj67_72040_c1_726_1433 223
439 3300050510 nmdc:mga06r32_266677_c1 nmdc:mga06r32_266677_c1_579_1286 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06508

QueC

Queuosine biosynthesis protein QueC

41

258

0.96

PF00733

Asn_synthase

Asparagine synthase

29

117

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pg3-assembly1.cif.gz_A-2 crystal structure of a queuosine biosynthesis protein quec (eca1155) from erwinia carotovora subsp. atroseptica scri1043 at 2.40 a resolution 0.8086 2 211
3bl5-assembly6.cif.gz_F crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.8051 2 211
3bl5-assembly1.cif.gz_A crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.7939 2 211
3bl5-assembly6.cif.gz_F crystal structure of quec from bacillus subtilis: an enzyme involved in preq1 biosynthesis 0.7718 2 211
4qri-assembly1.cif.gz_A 2.35 angstrom resolution crystal structure of hypoxanthine-guanine-xanthine phosphoribosyltransferase from leptospira interrogans serovar copenhageni str. fiocruz l1-130 0.7641 23 59
ID Description Score Start End Superfamily
af_Q58742_1_231_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.915 2 219 3.40.50.620
af_Q58742_1_231_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8914 2 219 3.40.50.620
af_Q2G1X6_7_221_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.852 2 210 3.40.50.620
af_Q2G1X6_7_221_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.8072 2 210 3.40.50.620
3if9B01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.7766 3 28 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A7W1IKR6-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) 0.9884 154 221
AF-A0A1D7NHA1-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) (7-cyano-7-carbaguanine synthase) (PreQ(0) synthase) (Queuosine biosynthesis protein QueC) 0.9874 12 220 GO:0005524
GO:0008270
GO:0008616
GO:0016879
AF-A0A2U1G3G2-F1-model_v4 deleted 0.9873 2 219
AF-A0A6J4F7Q5-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) (7-cyano-7-carbaguanine synthase) (PreQ(0) synthase) (Queuosine biosynthesis protein QueC) 0.9858 2 220 GO:0005524
GO:0008270
GO:0008616
GO:0016879
AF-A0A5E7ZD32-F1-model_v4 7-cyano-7-deazaguanine synthase (EC 6.3.4.20) (7-cyano-7-carbaguanine synthase) (PreQ(0) synthase) (Queuosine biosynthesis protein QueC) 0.9854 12 220 GO:0005524
GO:0008270
GO:0008616
GO:0016879

Feature Viewer

pLDDT pTM Quality
93.51 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map