F444170
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 439 | 281 | 415 | 291 |
Family's Representative Sequence
| Representative Sequence | 3300006186|Ga0075369_10029062|Ga0075369_100290623 |
| Length | 289 |
| Sequence | VKAPAFDYAKPRTLSEAFDLLERHGEEAKLLAGGQTLMATLNMRLSQPGILIDITGLAGESALSGIRHENGVVSIGALTRHREIERSSVIATQVPMLAQAVPHIAHIAIRNVGTFGGSIAFADPAAEYPVCAVALDANLVLISRQGERRVPARQFFKALYETDLKPGELVARGEFPAQKPGYRSVFMELARRHGDYAIVGVAAHAKVAGGVLSEVSLAYLGMGGIPMLARNAMTELEGKAYTLEMVGAAQRALAGELDPSADLYSSAATKLHLARVLTGRALAALVEGT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 2 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 3 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 4 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 5 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 6 | 2791355199 | |||
| 7 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 8 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 9 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 10 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 11 | 2904699407 | |||
| 12 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 13 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 14 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 15 | 2922425934 | |||
| 16 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 17 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 18 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 19 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 20 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 21 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 22 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 23 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 24 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 25 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 26 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 69 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 70 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 71 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 73 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 74 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 75 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 76 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 77 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 78 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 79 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 80 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 81 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 89 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 90 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 103 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 115 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 116 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 171 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 172 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 173 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 175 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 176 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 177 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 180 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 181 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 182 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 183 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 184 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 185 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 188 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 189 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 190 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 191 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 224 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 227 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 228 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 229 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 230 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 231 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 234 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 235 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 236 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 237 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 238 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 239 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 240 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 241 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 242 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 243 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 244 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 245 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 246 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 248 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 249 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 250 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 251 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 252 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 253 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 254 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 255 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 258 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 259 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 260 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 261 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 262 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 263 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 264 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 265 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 266 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 267 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 268 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 269 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 270 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 271 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 272 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 273 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 274 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 275 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 276 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 277 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 278 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 279 | 8019565922 | Bradyrhizobium sp. JR3.5 | Isolate | Nodule |
| 280 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 281 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.18 |
| Metatranscriptomes | 0 |
| Isolates | 4.82 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.35 |
| Nodule | 4.1 |
| Rhizoplane | 8.66 |
| Rhizosphere | 66.06 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10000665 | 3300003203 | Bacteria | 16012 |
| 2 | JGI25153J46596_10001468 | 3300003215 | Bacteria | 14070 |
| 3 | rootL2_10326592 | 3300003322 | Bacteria | 1585 |
| 4 | rootH1_10192806 | 3300003323 | Bacteria | 2585 |
| 5 | Ga0065707_10272985 | 3300005295 | Bacteria | 1066 |
| 6 | Ga0070683_100025184 | 3300005329 | Bacteria | 5340 |
| 7 | Ga0070690_100213855 | 3300005330 | Bacteria | 1347 |
| 8 | Ga0070680_100192427 | 3300005336 | Bacteria | 1719 |
| 9 | Ga0068868_100078090 | 3300005338 | Bacteria | 2649 |
| 10 | Ga0070689_100215091 | 3300005340 | Bacteria | 1575 |
| 11 | Ga0070668_100039747 | 3300005347 | Bacteria | 3597 |
| 12 | Ga0070668_100111289 | 3300005347 | Bacteria | 2179 |
| 13 | Ga0070668_100506752 | 3300005347 | Bacteria | 1045 |
| 14 | Ga0070669_100311651 | 3300005353 | Bacteria | 1269 |
| 15 | Ga0070675_100365647 | 3300005354 | Bacteria | 1282 |
| 16 | Ga0070671_100019364 | 3300005355 | Bacteria | 5538 |
| 17 | Ga0070671_100029173 | 3300005355 | Bacteria | 4549 |
| 18 | Ga0070671_100322709 | 3300005355 | Bacteria | 1316 |
| 19 | Ga0070659_100115585 | 3300005366 | Bacteria | 2169 |
| 20 | Ga0070714_100192017 | 3300005435 | Bacteria | 1864 |
| 21 | Ga0070713_100021806 | 3300005436 | Bacteria | 4937 |
| 22 | Ga0070713_100076366 | 3300005436 | Bacteria | 2845 |
| 23 | Ga0070713_100390703 | 3300005436 | Bacteria | 1298 |
| 24 | Ga0070701_10103923 | 3300005438 | Bacteria | 1578 |
| 25 | Ga0070711_100003023 | 3300005439 | Bacteria | 9725 |
| 26 | Ga0070711_100003525 | 3300005439 | Bacteria | 9132 |
| 27 | Ga0070711_100301138 | 3300005439 | Bacteria | 1275 |
| 28 | Ga0070700_100021830 | 3300005441 | Bacteria | 3724 |
| 29 | Ga0070663_100000736 | 3300005455 | Bacteria | 17673 |
| 30 | Ga0070663_100109874 | 3300005455 | Bacteria | 2070 |
| 31 | Ga0070663_100159687 | 3300005455 | Bacteria | 1734 |
| 32 | Ga0070678_100103764 | 3300005456 | Bacteria | 2209 |
| 33 | Ga0070678_100310390 | 3300005456 | Bacteria | 1343 |
| 34 | Ga0070662_100029622 | 3300005457 | Bacteria | 3821 |
| 35 | Ga0070662_100072640 | 3300005457 | Bacteria | 2540 |
| 36 | Ga0070681_10009108 | 3300005458 | Bacteria | 9756 |
| 37 | Ga0068867_100079871 | 3300005459 | Bacteria | 2462 |
| 38 | Ga0068867_100170372 | 3300005459 | Bacteria | 1724 |
| 39 | Ga0070685_10216666 | 3300005466 | Bacteria | 1252 |
| 40 | Ga0070706_100122730 | 3300005467 | Bacteria | 2422 |
| 41 | Ga0070699_100144478 | 3300005518 | Bacteria | 2102 |
| 42 | Ga0070679_100145139 | 3300005530 | Bacteria | 2351 |
| 43 | Ga0068853_100016904 | 3300005539 | Bacteria | 6012 |
| 44 | Ga0070693_100109636 | 3300005547 | Bacteria | 1696 |
| 45 | Ga0070693_100318354 | 3300005547 | Bacteria | 1054 |
| 46 | Ga0070665_100020717 | 3300005548 | Bacteria | 6606 |
| 47 | Ga0070665_100021401 | 3300005548 | Bacteria | 6504 |
| 48 | Ga0070665_100025420 | 3300005548 | Bacteria | 5967 |
| 49 | Ga0070665_100138811 | 3300005548 | Bacteria | 2434 |
| 50 | Ga0070665_100143011 | 3300005548 | Bacteria | 2395 |
| 51 | Ga0070665_100323144 | 3300005548 | Bacteria | 1547 |
| 52 | Ga0070665_100405894 | 3300005548 | Bacteria | 1371 |
| 53 | Ga0070704_100203209 | 3300005549 | Bacteria | 1601 |
| 54 | Ga0070664_100017744 | 3300005564 | Bacteria | 5846 |
| 55 | Ga0068856_100042682 | 3300005614 | Bacteria | 4461 |
| 56 | Ga0070702_100059432 | 3300005615 | Bacteria | 2218 |
| 57 | Ga0068852_100124921 | 3300005616 | Bacteria | 2361 |
| 58 | Ga0068852_100146171 | 3300005616 | Bacteria | 2193 |
| 59 | Ga0068852_100172159 | 3300005616 | Bacteria | 2031 |
| 60 | Ga0068859_100262266 | 3300005617 | Bacteria | 1819 |
| 61 | Ga0068864_100015786 | 3300005618 | Bacteria | 6283 |
| 62 | Ga0068864_100066209 | 3300005618 | Bacteria | 3135 |
| 63 | Ga0068864_100790651 | 3300005618 | Bacteria | 932 |
| 64 | Ga0068866_10041530 | 3300005718 | Bacteria | 2282 |
| 65 | Ga0068861_100011429 | 3300005719 | Bacteria | 6173 |
| 66 | Ga0068861_100221247 | 3300005719 | Bacteria | 1600 |
| 67 | Ga0068851_10029608 | 3300005834 | Bacteria | 2711 |
| 68 | Ga0068870_10057700 | 3300005840 | Bacteria | 2076 |
| 69 | Ga0068863_100075269 | 3300005841 | Bacteria | 3194 |
| 70 | Ga0068863_100637145 | 3300005841 | Bacteria | 1056 |
| 71 | Ga0068858_100100926 | 3300005842 | Bacteria | 2691 |
| 72 | Ga0068858_100287887 | 3300005842 | Bacteria | 1565 |
| 73 | Ga0068860_100101597 | 3300005843 | Bacteria | 2743 |
| 74 | Ga0068860_100128051 | 3300005843 | Bacteria | 2434 |
| 75 | Ga0068862_100055173 | 3300005844 | Bacteria | 3403 |
| 76 | Ga0068862_100118614 | 3300005844 | Bacteria | 2329 |
| 77 | Ga0068862_100139074 | 3300005844 | Bacteria | 2154 |
| 78 | Ga0068862_100212983 | 3300005844 | Bacteria | 1746 |
| 79 | Ga0068862_100267816 | 3300005844 | Bacteria | 1561 |
| 80 | Ga0081455_10000968 | 3300005937 | Bacteria | 36782 |
| 81 | Ga0081455_10006130 | 3300005937 | Bacteria | 12989 |
| 82 | Ga0081540_1001903 | 3300005983 | Bacteria | 17470 |
| 83 | Ga0081540_1008229 | 3300005983 | Bacteria | 7308 |
| 84 | Ga0081540_1023506 | 3300005983 | Bacteria | 3602 |
| 85 | Ga0081539_10000003 | 3300005985 | Bacteria | 594833 |
| 86 | Ga0081539_10001264 | 3300005985 | Bacteria | 44681 |
| 87 | Ga0070717_10003695 | 3300006028 | Bacteria | 10995 |
| 88 | Ga0070717_10090744 | 3300006028 | Bacteria | 2579 |
| 89 | Ga0070717_10125278 | 3300006028 | Bacteria | 2205 |
| 90 | Ga0075365_10033630 | 3300006038 | Bacteria | 3306 |
| 91 | Ga0075365_10049888 | 3300006038 | Bacteria | 2759 |
| 92 | Ga0075368_10029215 | 3300006042 | Bacteria | 2131 |
| 93 | Ga0075363_100089611 | 3300006048 | Bacteria | 1691 |
| 94 | Ga0075364_10026158 | 3300006051 | Bacteria | 3721 |
| 95 | Ga0075364_10138329 | 3300006051 | Bacteria | 1637 |
| 96 | Ga0070715_10134405 | 3300006163 | Bacteria | 1194 |
| 97 | Ga0070715_10177824 | 3300006163 | Bacteria | 1065 |
| 98 | Ga0075362_10006285 | 3300006177 | Bacteria | 4416 |
| 99 | Ga0075362_10010305 | 3300006177 | Bacteria | 3645 |
| 100 | Ga0075367_10040124 | 3300006178 | Bacteria | 2732 |
| 101 | Ga0075367_10040317 | 3300006178 | Bacteria | 2726 |
| 102 | Ga0075367_10043125 | 3300006178 | Bacteria | 2642 |
| 103 | Ga0075369_10006424 | 3300006186 | Bacteria | 4442 |
| 104 | Ga0075369_10029062 | 3300006186 | Bacteria | 2320 |
| 105 | Ga0075366_10012971 | 3300006195 | Bacteria | 4738 |
| 106 | Ga0075366_10076765 | 3300006195 | Bacteria | 1994 |
| 107 | Ga0075366_10089017 | 3300006195 | Bacteria | 1849 |
| 108 | Ga0097621_100226016 | 3300006237 | Bacteria | 1633 |
| 109 | Ga0097621_100296670 | 3300006237 | Bacteria | 1427 |
| 110 | Ga0068871_100018780 | 3300006358 | Bacteria | 5266 |
| 111 | Ga0068871_100264962 | 3300006358 | Bacteria | 1500 |
| 112 | Ga0075434_100118812 | 3300006871 | Bacteria | 2658 |
| 113 | Ga0075429_100334269 | 3300006880 | Bacteria | 1326 |
| 114 | Ga0068865_100201933 | 3300006881 | Bacteria | 1544 |
| 115 | Ga0097620_100262285 | 3300006931 | Bacteria | 1819 |
| 116 | Ga0075435_100270735 | 3300007076 | Bacteria | 1449 |
| 117 | Ga0099794_10002563 | 3300007265 | Bacteria | 6738 |
| 118 | Ga0099794_10081908 | 3300007265 | Bacteria | 1593 |
| 119 | Ga0099795_10018213 | 3300007788 | Bacteria | 2253 |
| 120 | Ga0105250_10116964 | 3300009092 | Bacteria | 1094 |
| 121 | Ga0111539_10438848 | 3300009094 | Bacteria | 1520 |
| 122 | Ga0105245_10120820 | 3300009098 | Bacteria | 2447 |
| 123 | Ga0105247_10048569 | 3300009101 | Bacteria | 2607 |
| 124 | Ga0105247_10322358 | 3300009101 | Bacteria | 1078 |
| 125 | Ga0114129_10307629 | 3300009147 | Bacteria | 2110 |
| 126 | Ga0105243_10112809 | 3300009148 | Bacteria | 2278 |
| 127 | Ga0105243_10138181 | 3300009148 | Bacteria | 2076 |
| 128 | Ga0105243_10146253 | 3300009148 | Bacteria | 2022 |
| 129 | Ga0105243_10147717 | 3300009148 | Bacteria | 2013 |
| 130 | Ga0105241_10001928 | 3300009174 | Bacteria | 15692 |
| 131 | Ga0105241_10144007 | 3300009174 | Bacteria | 1943 |
| 132 | Ga0105242_10696478 | 3300009176 | Bacteria | 993 |
| 133 | Ga0105248_10010552 | 3300009177 | Bacteria | 10178 |
| 134 | Ga0105248_10229799 | 3300009177 | Bacteria | 2088 |
| 135 | Ga0105248_10448889 | 3300009177 | Bacteria | 1453 |
| 136 | Ga0105248_10965099 | 3300009177 | Bacteria | 963 |
| 137 | Ga0105237_10100868 | 3300009545 | Bacteria | 2878 |
| 138 | Ga0105238_10227121 | 3300009551 | Bacteria | 1844 |
| 139 | Ga0105238_10359236 | 3300009551 | Bacteria | 1446 |
| 140 | Ga0105249_10227298 | 3300009553 | Bacteria | 1839 |
| 141 | Ga0099796_10003994 | 3300010159 | Bacteria | 3506 |
| 142 | Ga0099796_10029518 | 3300010159 | Bacteria | 1770 |
| 143 | Ga0105239_10016969 | 3300010375 | Bacteria | 8048 |
| 144 | Ga0105239_10069197 | 3300010375 | Bacteria | 3878 |
| 145 | Ga0105246_10022719 | 3300011119 | Bacteria | 4051 |
| 146 | Ga0157374_10017285 | 3300013296 | Bacteria | 6348 |
| 147 | Ga0157374_10029281 | 3300013296 | Bacteria | 4984 |
| 148 | Ga0157378_10004403 | 3300013297 | Bacteria | 12399 |
| 149 | Ga0157378_10237120 | 3300013297 | Bacteria | 1741 |
| 150 | Ga0157378_10244898 | 3300013297 | Bacteria | 1714 |
| 151 | Ga0157378_10275316 | 3300013297 | Bacteria | 1620 |
| 152 | Ga0163162_10007321 | 3300013306 | Bacteria | 10728 |
| 153 | Ga0157375_10078336 | 3300013308 | Bacteria | 3338 |
| 154 | Ga0163163_10031547 | 3300014325 | Bacteria | 5116 |
| 155 | Ga0163163_10403600 | 3300014325 | Bacteria | 1425 |
| 156 | Ga0157380_10195228 | 3300014326 | Bacteria | 1791 |
| 157 | Ga0157377_10023715 | 3300014745 | Bacteria | 3255 |
| 158 | Ga0157377_10098687 | 3300014745 | Bacteria | 1736 |
| 159 | Ga0157376_10002079 | 3300014969 | Bacteria | 13458 |
| 160 | Ga0163161_10115152 | 3300017792 | Bacteria | 2015 |
| 161 | Ga0163161_10446870 | 3300017792 | Bacteria | 1044 |
| 162 | Ga0213876_10021304 | 3300021384 | Bacteria | 3429 |
| 163 | Ga0209233_1017139 | 3300025261 | Bacteria | 1979 |
| 164 | Ga0209758_1001548 | 3300025297 | Bacteria | 26409 |
| 165 | Ga0209758_1011005 | 3300025297 | Bacteria | 5308 |
| 166 | Ga0207642_10014396 | 3300025899 | Bacteria | 2918 |
| 167 | Ga0207710_10047431 | 3300025900 | Bacteria | 1920 |
| 168 | Ga0207688_10042568 | 3300025901 | Bacteria | 2528 |
| 169 | Ga0207647_10064369 | 3300025904 | Bacteria | 2228 |
| 170 | Ga0207699_10015322 | 3300025906 | Bacteria | 3979 |
| 171 | Ga0207643_10053795 | 3300025908 | Bacteria | 2287 |
| 172 | Ga0207654_10009050 | 3300025911 | Bacteria | 5053 |
| 173 | Ga0207707_10038469 | 3300025912 | Bacteria | 4180 |
| 174 | Ga0207693_10005401 | 3300025915 | Bacteria | 10679 |
| 175 | Ga0207693_10049542 | 3300025915 | Bacteria | 3298 |
| 176 | Ga0207663_10028886 | 3300025916 | Bacteria | 3251 |
| 177 | Ga0207663_10045493 | 3300025916 | Bacteria | 2700 |
| 178 | Ga0207660_10160328 | 3300025917 | Bacteria | 1735 |
| 179 | Ga0207662_10128295 | 3300025918 | Bacteria | 1596 |
| 180 | Ga0207649_10070474 | 3300025920 | Bacteria | 2230 |
| 181 | Ga0207652_10125821 | 3300025921 | Bacteria | 2283 |
| 182 | Ga0207694_10015467 | 3300025924 | Bacteria | 5754 |
| 183 | Ga0207694_10146246 | 3300025924 | Bacteria | 1902 |
| 184 | Ga0207650_10477770 | 3300025925 | Bacteria | 1040 |
| 185 | Ga0207659_10046361 | 3300025926 | Bacteria | 3069 |
| 186 | Ga0207687_10056072 | 3300025927 | Bacteria | 2763 |
| 187 | Ga0207700_10022695 | 3300025928 | Bacteria | 4310 |
| 188 | Ga0207700_10064792 | 3300025928 | Bacteria | 2785 |
| 189 | Ga0207700_10152221 | 3300025928 | Bacteria | 1913 |
| 190 | Ga0207700_10207648 | 3300025928 | Bacteria | 1654 |
| 191 | Ga0207664_10130274 | 3300025929 | Bacteria | 2117 |
| 192 | Ga0207644_10014914 | 3300025931 | Bacteria | 5210 |
| 193 | Ga0207644_10169566 | 3300025931 | Bacteria | 1703 |
| 194 | Ga0207706_10037923 | 3300025933 | Bacteria | 4276 |
| 195 | Ga0207709_10038706 | 3300025935 | Bacteria | 2843 |
| 196 | Ga0207670_10040920 | 3300025936 | Bacteria | 3045 |
| 197 | Ga0207669_10009224 | 3300025937 | Bacteria | 4684 |
| 198 | Ga0207669_10161844 | 3300025937 | Bacteria | 1582 |
| 199 | Ga0207704_10028657 | 3300025938 | Bacteria | 3093 |
| 200 | Ga0207704_10073113 | 3300025938 | Bacteria | 2182 |
| 201 | Ga0207665_10068810 | 3300025939 | Bacteria | 2413 |
| 202 | Ga0207691_10331443 | 3300025940 | Bacteria | 1304 |
| 203 | Ga0207711_10018668 | 3300025941 | Bacteria | 5766 |
| 204 | Ga0207711_10510990 | 3300025941 | Bacteria | 1120 |
| 205 | Ga0207689_10038905 | 3300025942 | Bacteria | 3938 |
| 206 | Ga0207689_10041008 | 3300025942 | Bacteria | 3830 |
| 207 | Ga0207651_10417267 | 3300025960 | Bacteria | 1145 |
| 208 | Ga0207712_10126245 | 3300025961 | Bacteria | 1943 |
| 209 | Ga0207668_10058960 | 3300025972 | Bacteria | 2686 |
| 210 | Ga0207668_10187478 | 3300025972 | Bacteria | 1636 |
| 211 | Ga0207640_10228345 | 3300025981 | Bacteria | 1430 |
| 212 | Ga0207658_10113861 | 3300025986 | Bacteria | 2144 |
| 213 | Ga0207677_10026223 | 3300026023 | Bacteria | 3651 |
| 214 | Ga0207677_10088771 | 3300026023 | Bacteria | 2242 |
| 215 | Ga0207703_10030499 | 3300026035 | Bacteria | 4262 |
| 216 | Ga0207703_10058199 | 3300026035 | Bacteria | 3154 |
| 217 | Ga0207639_10057754 | 3300026041 | Bacteria | 2981 |
| 218 | Ga0207639_10482898 | 3300026041 | Bacteria | 1129 |
| 219 | Ga0207678_10018386 | 3300026067 | Bacteria | 6137 |
| 220 | Ga0207678_10025052 | 3300026067 | Bacteria | 5209 |
| 221 | Ga0207678_10030049 | 3300026067 | Bacteria | 4743 |
| 222 | Ga0207678_10066029 | 3300026067 | Bacteria | 3106 |
| 223 | Ga0207678_10069217 | 3300026067 | Bacteria | 3026 |
| 224 | Ga0207708_10025479 | 3300026075 | Bacteria | 4474 |
| 225 | Ga0207702_10019880 | 3300026078 | Bacteria | 5563 |
| 226 | Ga0207641_10124206 | 3300026088 | Bacteria | 2308 |
| 227 | Ga0207641_10349486 | 3300026088 | Bacteria | 1409 |
| 228 | Ga0207648_10024498 | 3300026089 | Bacteria | 5386 |
| 229 | Ga0207648_10192179 | 3300026089 | Bacteria | 1809 |
| 230 | Ga0207676_10080873 | 3300026095 | Bacteria | 2638 |
| 231 | Ga0207676_10103173 | 3300026095 | Bacteria | 2369 |
| 232 | Ga0207674_10172897 | 3300026116 | Bacteria | 2113 |
| 233 | Ga0207675_100017977 | 3300026118 | Bacteria | 6595 |
| 234 | Ga0207675_100139550 | 3300026118 | Bacteria | 2302 |
| 235 | Ga0207683_10140959 | 3300026121 | Bacteria | 2172 |
| 236 | Ga0207698_10065235 | 3300026142 | Bacteria | 2858 |
| 237 | Ga0207698_10198263 | 3300026142 | Bacteria | 1795 |
| 238 | Ga0209179_1003788 | 3300027512 | Bacteria | 2217 |
| 239 | Ga0209588_1012945 | 3300027671 | Bacteria | 2538 |
| 240 | Ga0268266_10029428 | 3300028379 | Bacteria | 4669 |
| 241 | Ga0268266_10035979 | 3300028379 | Bacteria | 4212 |
| 242 | Ga0268266_10122001 | 3300028379 | Bacteria | 2320 |
| 243 | Ga0268266_10347388 | 3300028379 | Bacteria | 1393 |
| 244 | Ga0268265_10049491 | 3300028380 | Bacteria | 3161 |
| 245 | Ga0268265_10084372 | 3300028380 | Bacteria | 2518 |
| 246 | Ga0268265_10174782 | 3300028380 | Bacteria | 1839 |
| 247 | Ga0268264_10085509 | 3300028381 | Bacteria | 2707 |
| 248 | Ga0268264_10124455 | 3300028381 | Bacteria | 2276 |
| 249 | Ga0307517_10168883 | 3300028786 | Bacteria | 1444 |
| 250 | Ga0307511_10000103 | 3300030521 | Bacteria | 75234 |
| 251 | Ga0265331_10010603 | 3300031250 | Bacteria | 5089 |
| 252 | Ga0265316_10084655 | 3300031344 | Bacteria | 2428 |
| 253 | Ga0265316_10127401 | 3300031344 | Bacteria | 1919 |
| 254 | Ga0307509_10167802 | 3300031507 | Bacteria | 2080 |
| 255 | Ga0307408_100131843 | 3300031548 | Bacteria | 1951 |
| 256 | Ga0307508_10053562 | 3300031616 | Bacteria | 3580 |
| 257 | Ga0307508_10131644 | 3300031616 | Bacteria | 2105 |
| 258 | Ga0265342_10005683 | 3300031712 | Bacteria | 9436 |
| 259 | Ga0307405_10221738 | 3300031731 | Bacteria | 1388 |
| 260 | Ga0307405_10245332 | 3300031731 | Bacteria | 1329 |
| 261 | Ga0307409_100329372 | 3300031995 | Bacteria | 1432 |
| 262 | Ga0307411_10103485 | 3300032005 | Bacteria | 2020 |
| 263 | Ga0307411_10399622 | 3300032005 | Bacteria | 1136 |
| 264 | Ga0307415_100030366 | 3300032126 | Bacteria | 3468 |
| 265 | Ga0307415_100087879 | 3300032126 | Bacteria | 2241 |
| 266 | Ga0307510_10032281 | 3300033180 | Bacteria | 5900 |
| 267 | Ga0373953_0029256 | 3300035117 | Bacteria | 2129 |
| 268 | Ga0373957_0071016 | 3300035120 | Bacteria | 1362 |
| 269 | Ga0373924_0000771 | 3300035410 | Bacteria | 9947 |
| 270 | Ga0373931_0254970 | 3300035691 | Bacteria | 1068 |
| 271 | Ga0451807_1644881 | 3300041486 | Bacteria | 1007 |
| 272 | Ga0451807_2421406 | 3300041486 | Bacteria | 986 |
| 273 | Ga0451577_0172266 | 3300042876 | Bacteria | 1950 |
| 274 | Ga0453684_0698170 | 3300044712 | Bacteria | 1103 |
| 275 | Ga0451576_0374062 | 3300045051 | Bacteria | 1493 |
| 276 | Ga0495603_0120297 | 3300046455 | Bacteria | 1530 |
| 277 | Ga0495603_0132855 | 3300046455 | Bacteria | 1449 |
| 278 | Ga0495603_0134946 | 3300046455 | Bacteria | 1436 |
| 279 | Ga0495638_0022806 | 3300046460 | Bacteria | 4104 |
| 280 | Ga0495638_0150502 | 3300046460 | Bacteria | 1350 |
| 281 | Ga0495650_0078341 | 3300046471 | Bacteria | 1280 |
| 282 | Ga0495580_0107065 | 3300046472 | Bacteria | 1942 |
| 283 | Ga0495584_0031570 | 3300046491 | Bacteria | 2681 |
| 284 | Ga0495584_0097107 | 3300046491 | Bacteria | 1488 |
| 285 | Ga0495584_0183454 | 3300046491 | Bacteria | 1063 |
| 286 | Ga0495585_0013139 | 3300046492 | Bacteria | 4852 |
| 287 | Ga0495594_0114388 | 3300046499 | Bacteria | 1523 |
| 288 | Ga0495594_0168213 | 3300046499 | Bacteria | 1247 |
| 289 | Ga0495607_0100135 | 3300046501 | Bacteria | 1554 |
| 290 | Ga0495610_0155392 | 3300046512 | Bacteria | 972 |
| 291 | Ga0495616_0031366 | 3300046513 | Bacteria | 2783 |
| 292 | Ga0495618_0077420 | 3300046514 | Bacteria | 2119 |
| 293 | Ga0495648_0147481 | 3300046524 | Bacteria | 1231 |
| 294 | Ga0495666_0134727 | 3300046526 | Bacteria | 1153 |
| 295 | Ga0495587_0068905 | 3300046536 | Bacteria | 2060 |
| 296 | Ga0495598_0012329 | 3300046537 | Bacteria | 2095 |
| 297 | Ga0495633_0148652 | 3300046558 | Bacteria | 1082 |
| 298 | Ga0495656_0007675 | 3300046615 | Bacteria | 3824 |
| 299 | Ga0495656_0049824 | 3300046615 | Bacteria | 1785 |
| 300 | Ga0495668_0146130 | 3300046616 | Bacteria | 1294 |
| 301 | Ga0495611_0031354 | 3300046648 | Bacteria | 2339 |
| 302 | Ga0495625_0028888 | 3300046660 | Bacteria | 4152 |
| 303 | Ga0495635_0003853 | 3300046663 | Bacteria | 10418 |
| 304 | Ga0495659_0143569 | 3300046664 | Bacteria | 954 |
| 305 | Ga0495669_0040721 | 3300046684 | Bacteria | 2061 |
| 306 | Ga0495669_0067194 | 3300046684 | Bacteria | 1629 |
| 307 | Ga0495613_0336209 | 3300046689 | Bacteria | 1040 |
| 308 | Ga0495589_0075377 | 3300046794 | Bacteria | 1645 |
| 309 | Ga0495604_0068237 | 3300047317 | Bacteria | 2699 |
| 310 | Ga0495674_0270522 | 3300047319 | Bacteria | 1394 |
| 311 | Ga0495672_0094815 | 3300047320 | Bacteria | 1631 |
| 312 | Ga0495680_0308541 | 3300047322 | Bacteria | 1109 |
| 313 | Ga0495673_0090535 | 3300047469 | Bacteria | 1251 |
| 314 | Ga0495673_0098497 | 3300047469 | Bacteria | 1185 |
| 315 | Ga0495684_0004769 | 3300047471 | Bacteria | 10598 |
| 316 | Ga0495626_0087219 | 3300048091 | Bacteria | 1378 |
| 317 | Ga0496100_0001966 | 3300048903 | Bacteria | 10302 |
| 318 | Ga0496101_0017527 | 3300048904 | Bacteria | 4857 |
| 319 | Ga0496101_0257927 | 3300048904 | Bacteria | 1359 |
| 320 | Ga0496102_0048672 | 3300048905 | Bacteria | 3854 |
| 321 | Ga0496102_0198732 | 3300048905 | Bacteria | 1890 |
| 322 | Ga0496103_0191004 | 3300048906 | Bacteria | 1317 |
| 323 | Ga0496104_0044151 | 3300048907 | Bacteria | 4188 |
| 324 | Ga0496105_0003693 | 3300048908 | Bacteria | 11390 |
| 325 | Ga0496106_0035274 | 3300048909 | Bacteria | 3740 |
| 326 | Ga0496106_0060824 | 3300048909 | Bacteria | 2864 |
| 327 | Ga0496106_0214802 | 3300048909 | Bacteria | 1533 |
| 328 | Ga0496107_0073581 | 3300048910 | Bacteria | 2486 |
| 329 | Ga0496108_0009248 | 3300048911 | Bacteria | 7972 |
| 330 | Ga0496108_0049240 | 3300048911 | Bacteria | 3524 |
| 331 | Ga0496108_0052041 | 3300048911 | Bacteria | 3431 |
| 332 | Ga0496108_0271283 | 3300048911 | Bacteria | 1477 |
| 333 | Ga0496109_0009741 | 3300048912 | Bacteria | 8201 |
| 334 | Ga0496109_0034672 | 3300048912 | Bacteria | 4548 |
| 335 | Ga0496109_0222250 | 3300048912 | Bacteria | 1776 |
| 336 | Ga0496110_0077716 | 3300048913 | Bacteria | 2953 |
| 337 | Ga0496110_0079675 | 3300048913 | Bacteria | 2917 |
| 338 | Ga0496110_0138365 | 3300048913 | Bacteria | 2201 |
| 339 | Ga0496110_0315265 | 3300048913 | Bacteria | 1424 |
| 340 | Ga0496111_0018005 | 3300048914 | Bacteria | 4887 |
| 341 | Ga0496112_0041094 | 3300048915 | Bacteria | 4524 |
| 342 | Ga0496112_0086520 | 3300048915 | Bacteria | 3101 |
| 343 | Ga0496112_0291275 | 3300048915 | Bacteria | 1578 |
| 344 | Ga0496112_0496607 | 3300048915 | Bacteria | 1156 |
| 345 | Ga0496112_0523756 | 3300048915 | Bacteria | 1120 |
| 346 | Ga0496113_0026739 | 3300048916 | Bacteria | 4129 |
| 347 | Ga0496114_0003347 | 3300048917 | Bacteria | 12322 |
| 348 | Ga0496114_0159103 | 3300048917 | Bacteria | 1963 |
| 349 | Ga0496114_0535202 | 3300048917 | Bacteria | 1036 |
| 350 | Ga0496115_0003657 | 3300048918 | Bacteria | 11062 |
| 351 | Ga0496115_0025922 | 3300048918 | Bacteria | 4569 |
| 352 | Ga0496117_0097320 | 3300048920 | Bacteria | 1875 |
| 353 | Ga0496118_0043458 | 3300048921 | Bacteria | 3532 |
| 354 | Ga0496118_0213535 | 3300048921 | Bacteria | 1130 |
| 355 | Ga0496121_0008049 | 3300048924 | Bacteria | 12567 |
| 356 | Ga0496121_0039498 | 3300048924 | Bacteria | 4157 |
| 357 | Ga0496121_0150739 | 3300048924 | Bacteria | 1711 |
| 358 | Ga0496121_0281665 | 3300048924 | Bacteria | 1137 |
| 359 | Ga0496124_0136283 | 3300048927 | Bacteria | 1943 |
| 360 | Ga0496125_0202616 | 3300048928 | Bacteria | 1297 |
| 361 | Ga0496126_0050463 | 3300048929 | Bacteria | 3791 |
| 362 | Ga0496126_0052940 | 3300048929 | Bacteria | 3685 |
| 363 | Ga0496126_0083814 | 3300048929 | Bacteria | 2813 |
| 364 | Ga0496126_0108216 | 3300048929 | Bacteria | 2424 |
| 365 | Ga0496126_0132141 | 3300048929 | Bacteria | 2156 |
| 366 | Ga0496126_0234463 | 3300048929 | Bacteria | 1536 |
| 367 | Ga0496126_0375228 | 3300048929 | Bacteria | 1159 |
| 368 | Ga0501076_0137271 | 3300049592 | Bacteria | 1986 |
| 369 | Ga0501081_0688433 | 3300049743 | Bacteria | 767 |
| 370 | nmdc:mga03683_26107_c1 | 3300050489 | Bacteria | 2302 |
| 371 | nmdc:mga00v17_296052_c1 | 3300050491 | Bacteria | 1051 |
| 372 | nmdc:mga00v17_5856_c1 | 3300050491 | Bacteria | 6492 |
| 373 | nmdc:mga0yw44_41805_c1 | 3300050492 | Bacteria | 2731 |
| 374 | nmdc:mga0yw44_60889_c1 | 3300050492 | Bacteria | 2314 |
| 375 | nmdc:mga06z11_10424_c1 | 3300050494 | Bacteria | 3961 |
| 376 | nmdc:mga06z11_118882_c1 | 3300050494 | Bacteria | 1472 |
| 377 | nmdc:mga07m45_2669_c2 | 3300050496 | Bacteria | 3334 |
| 378 | nmdc:mga07m45_66910_c1 | 3300050496 | Bacteria | 2042 |
| 379 | nmdc:mga07m45_78189_c1 | 3300050496 | Bacteria | 1887 |
| 380 | nmdc:mga07m45_94065_c1 | 3300050496 | Bacteria | 1718 |
| 381 | nmdc:mga09592_110563_c1 | 3300050508 | Bacteria | 2357 |
| 382 | nmdc:mga0sz30_20757_c1 | 3300050516 | Bacteria | 1984 |
| 383 | nmdc:mga0sz30_24912_c1 | 3300050516 | Bacteria | 2445 |
| 384 | Ga0500635_0002690 | 3300053080 | Bacteria | 4408 |
| 385 | Ga0495595_0000520 | 3300053084 | Bacteria | 14684 |
| 386 | Ga0495619_0416901 | 3300053085 | Bacteria | 926 |
| 387 | Ga0500646_0000870 | 3300053090 | Bacteria | 8319 |
| 388 | Ga0500583_0010028 | 3300053092 | Bacteria | 3493 |
| 389 | Ga0500583_0035176 | 3300053092 | Bacteria | 2233 |
| 390 | Ga0500651_0071921 | 3300053093 | Bacteria | 2151 |
| 391 | Ga0500651_0077501 | 3300053093 | Bacteria | 2062 |
| 392 | Ga0500566_0005926 | 3300053094 | Bacteria | 7269 |
| 393 | Ga0500641_0076659 | 3300053096 | Bacteria | 1414 |
| 394 | Ga0500650_0074265 | 3300053098 | Bacteria | 1590 |
| 395 | Ga0500554_001459 | 3300053102 | Bacteria | 4572 |
| 396 | Ga0500569_007875 | 3300053109 | Bacteria | 2413 |
| 397 | Ga0500594_0005487 | 3300053118 | Bacteria | 2815 |
| 398 | Ga0500594_0013431 | 3300053118 | Bacteria | 1946 |
| 399 | Ga0500595_002486 | 3300053119 | Bacteria | 9120 |
| 400 | Ga0500595_003031 | 3300053119 | Bacteria | 7980 |
| 401 | Ga0500595_015856 | 3300053119 | Bacteria | 2819 |
| 402 | Ga0500595_025664 | 3300053119 | Bacteria | 2040 |
| 403 | Ga0500642_0002107 | 3300053130 | Bacteria | 5777 |
| 404 | Ga0500658_0023412 | 3300053134 | Bacteria | 2357 |
| 405 | Ga0500568_0052161 | 3300053139 | Bacteria | 1607 |
| 406 | Ga0500577_0025742 | 3300053142 | Bacteria | 1994 |
| 407 | Ga0500590_041614 | 3300053148 | Bacteria | 2362 |
| 408 | Ga0500603_000124 | 3300053150 | Bacteria | 18201 |
| 409 | Ga0500604_0001532 | 3300053151 | Bacteria | 6466 |
| 410 | Ga0500638_007491 | 3300053162 | Bacteria | 4572 |
| 411 | Ga0500637_0039165 | 3300053178 | Bacteria | 2672 |
| 412 | Ga0500637_0044081 | 3300053178 | Bacteria | 2526 |
| 413 | Ga0500637_0189918 | 3300053178 | Bacteria | 1174 |
| 414 | Ga0500645_020172 | 3300053730 | Bacteria | 2067 |
| 415 | Ga0500661_001975 | 3300055283 | Bacteria | 3871 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049743 | Ga0501081_0688433 | Ga0501081_0688433_17_745 | 241 |
| 2 | 3300033180 | Ga0307510_10032281 | Ga0307510_100322812 | 271 |
| 3 | 3300046455 | Ga0495603_0120297 | Ga0495603_0120297_171_1076 | 271 |
| 4 | 3300053080 | Ga0500635_0002690 | Ga0500635_0002690_2570_3475 | 271 |
| 5 | 3300053102 | Ga0500554_001459 | Ga0500554_001459_518_1423 | 271 |
| 6 | 3300053150 | Ga0500603_000124 | Ga0500603_000124_1987_2892 | 271 |
| 7 | 3300053178 | Ga0500637_0039165 | Ga0500637_0039165_1346_2251 | 271 |
| 8 | 3300006177 | Ga0075362_10010305 | Ga0075362_100103052 | 272 |
| 9 | 3300006178 | Ga0075367_10043125 | Ga0075367_100431253 | 272 |
| 10 | 3300006195 | Ga0075366_10012971 | Ga0075366_100129714 | 272 |
| 11 | 3300050489 | nmdc:mga03683_26107_c1 | nmdc:mga03683_26107_c1_1265_2137 | 272 |
| 12 | 3300050496 | nmdc:mga07m45_2669_c2 | nmdc:mga07m45_2669_c2_2221_3093 | 272 |
| 13 | 3300006163 | Ga0070715_10177824 | Ga0070715_101778242 | 273 |
| 14 | 3300009094 | Ga0111539_10438848 | Ga0111539_104388482 | 274 |
| 15 | 3300025261 | Ga0209233_1017139 | Ga0209233_10171392 | 274 |
| 16 | 3300041486 | Ga0451807_2421406 | Ga0451807_2421406_26_850 | 274 |
| 17 | 3300010159 | Ga0099796_10029518 | Ga0099796_100295183 | 277 |
| 18 | 3300027512 | Ga0209179_1003788 | Ga0209179_10037883 | 277 |
| 19 | 3300048924 | Ga0496121_0281665 | Ga0496121_0281665_237_1118 | 277 |
| 20 | 3300053094 | Ga0500566_0005926 | Ga0500566_0005926_926_1807 | 277 |
| 21 | 3300053119 | Ga0500595_002486 | Ga0500595_002486_5831_6712 | 277 |
| 22 | 3300053162 | Ga0500638_007491 | Ga0500638_007491_3567_4448 | 277 |
| 23 | 3300053178 | Ga0500637_0044081 | Ga0500637_0044081_1314_2195 | 277 |
| 24 | 3300055283 | Ga0500661_001975 | Ga0500661_001975_2532_3413 | 277 |
| 25 | 3300048915 | Ga0496112_0041094 | Ga0496112_0041094_2974_3855 | 279 |
| 26 | 3300050491 | nmdc:mga00v17_296052_c1 | nmdc:mga00v17_296052_c1_26_865 | 279 |
| 27 | 3300005329 | Ga0070683_100025184 | Ga0070683_1000251845 | 280 |
| 28 | 3300005338 | Ga0068868_100078090 | Ga0068868_1000780902 | 280 |
| 29 | 3300005355 | Ga0070671_100019364 | Ga0070671_1000193644 | 280 |
| 30 | 3300005455 | Ga0070663_100000736 | Ga0070663_1000007366 | 280 |
| 31 | 3300005548 | Ga0070665_100020717 | Ga0070665_1000207176 | 280 |
| 32 | 3300005564 | Ga0070664_100017744 | Ga0070664_1000177444 | 280 |
| 33 | 3300005616 | Ga0068852_100124921 | Ga0068852_1001249212 | 280 |
| 34 | 3300005618 | Ga0068864_100066209 | Ga0068864_1000662093 | 280 |
| 35 | 3300005834 | Ga0068851_10029608 | Ga0068851_100296083 | 280 |
| 36 | 3300006237 | Ga0097621_100226016 | Ga0097621_1002260162 | 280 |
| 37 | 3300006358 | Ga0068871_100018780 | Ga0068871_1000187803 | 280 |
| 38 | 3300009148 | Ga0105243_10146253 | Ga0105243_101462532 | 280 |
| 39 | 3300009177 | Ga0105248_10448889 | Ga0105248_104488892 | 280 |
| 40 | 3300009551 | Ga0105238_10359236 | Ga0105238_103592362 | 280 |
| 41 | 3300010375 | Ga0105239_10016969 | Ga0105239_100169692 | 280 |
| 42 | 3300013296 | Ga0157374_10017285 | Ga0157374_100172855 | 280 |
| 43 | 3300013297 | Ga0157378_10244898 | Ga0157378_102448982 | 280 |
| 44 | 3300013306 | Ga0163162_10007321 | Ga0163162_1000732110 | 280 |
| 45 | 3300014325 | Ga0163163_10031547 | Ga0163163_100315473 | 280 |
| 46 | 3300014969 | Ga0157376_10002079 | Ga0157376_100020799 | 280 |
| 47 | 3300025927 | Ga0207687_10056072 | Ga0207687_100560723 | 280 |
| 48 | 3300025941 | Ga0207711_10510990 | Ga0207711_105109901 | 280 |
| 49 | 3300026023 | Ga0207677_10088771 | Ga0207677_100887712 | 280 |
| 50 | 3300026067 | Ga0207678_10025052 | Ga0207678_100250523 | 280 |
| 51 | 3300026095 | Ga0207676_10103173 | Ga0207676_101031732 | 280 |
| 52 | 3300026142 | Ga0207698_10198263 | Ga0207698_101982633 | 280 |
| 53 | 3300048903 | Ga0496100_0001966 | Ga0496100_0001966_3880_4761 | 280 |
| 54 | 3300048904 | Ga0496101_0017527 | Ga0496101_0017527_927_1808 | 280 |
| 55 | 3300048905 | Ga0496102_0048672 | Ga0496102_0048672_2861_3742 | 280 |
| 56 | 3300048908 | Ga0496105_0003693 | Ga0496105_0003693_2585_3466 | 280 |
| 57 | 3300048909 | Ga0496106_0060824 | Ga0496106_0060824_780_1661 | 280 |
| 58 | 3300048911 | Ga0496108_0052041 | Ga0496108_0052041_1382_2263 | 280 |
| 59 | 3300048912 | Ga0496109_0009741 | Ga0496109_0009741_6394_7275 | 280 |
| 60 | 3300048913 | Ga0496110_0138365 | Ga0496110_0138365_536_1417 | 280 |
| 61 | 3300048914 | Ga0496111_0018005 | Ga0496111_0018005_699_1580 | 280 |
| 62 | 3300048915 | Ga0496112_0291275 | Ga0496112_0291275_639_1520 | 280 |
| 63 | 3300048916 | Ga0496113_0026739 | Ga0496113_0026739_1973_2854 | 280 |
| 64 | 3300048917 | Ga0496114_0003347 | Ga0496114_0003347_11005_11886 | 280 |
| 65 | 3300048918 | Ga0496115_0003657 | Ga0496115_0003657_8456_9337 | 280 |
| 66 | 3300053093 | Ga0500651_0077501 | Ga0500651_0077501_1130_2011 | 280 |
| 67 | 3300053130 | Ga0500642_0002107 | Ga0500642_0002107_1279_2160 | 280 |
| 68 | 3300025981 | Ga0207640_10228345 | Ga0207640_102283451 | 281 |
| 69 | 3300005937 | Ga0081455_10006130 | Ga0081455_100061309 | 282 |
| 70 | 3300042876 | Ga0451577_0172266 | Ga0451577_0172266_753_1610 | 282 |
| 71 | 3300044712 | Ga0453684_0698170 | Ga0453684_0698170_27_884 | 282 |
| 72 | 3300045051 | Ga0451576_0374062 | Ga0451576_0374062_330_1187 | 282 |
| 73 | 3300053178 | Ga0500637_0189918 | Ga0500637_0189918_143_1003 | 282 |
| 74 | 3300006038 | Ga0075365_10033630 | Ga0075365_100336304 | 284 |
| 75 | 3300050492 | nmdc:mga0yw44_60889_c1 | nmdc:mga0yw44_60889_c1_930_1796 | 284 |
| 76 | 3300006186 | Ga0075369_10029062 | Ga0075369_100290623 | 285 |
| 77 | 3300006195 | Ga0075366_10076765 | Ga0075366_100767653 | 285 |
| 78 | 3300030521 | Ga0307511_10000103 | Ga0307511_1000010312 | 285 |
| 79 | 3300050516 | nmdc:mga0sz30_20757_c1 | nmdc:mga0sz30_20757_c1_361_1230 | 285 |
| 80 | 3300053090 | Ga0500646_0000870 | Ga0500646_0000870_6310_7179 | 285 |
| 81 | 3300053092 | Ga0500583_0010028 | Ga0500583_0010028_851_1720 | 285 |
| 82 | 3300053151 | Ga0500604_0001532 | Ga0500604_0001532_3583_4452 | 285 |
| 83 | 3300005548 | Ga0070665_100025420 | Ga0070665_1000254203 | 287 |
| 84 | 3300028379 | Ga0268266_10347388 | Ga0268266_103473882 | 287 |
| 85 | iso_pu_bacteria | 2513237141 | 2513888379 | 287 |
| 86 | 3300005355 | Ga0070671_100322709 | Ga0070671_1003227092 | 288 |
| 87 | iso_pu_bacteria | 2513237101 | 2513693623 | 289 |
| 88 | iso_pu_bacteria | 2524023228 | 2524535724 | 289 |
| 89 | iso_pu_bacteria | 2667528175 | 2671123977 | 289 |
| 90 | iso_pu_bacteria | 2791355197 | 2793071362 | 289 |
| 91 | iso_pu_bacteria | 2791355199 | 2793081285 | 289 |
| 92 | iso_pu_bacteria | 2876808645 | 2876817047 | 289 |
| 93 | iso_pu_bacteria | 2879110137 | 2879117568 | 289 |
| 94 | iso_pu_bacteria | 2904690495 | 2904697233 | 289 |
| 95 | iso_pu_bacteria | 2904699407 | 2904705443 | 289 |
| 96 | iso_pu_bacteria | 2908756301 | 2908762196 | 289 |
| 97 | iso_pu_bacteria | 2922361189 | 2922362911 | 289 |
| 98 | iso_pu_bacteria | 2922386360 | 2922390548 | 289 |
| 99 | iso_pu_bacteria | 2922425934 | 2922428187 | 289 |
| 100 | iso_pu_bacteria | 2935630451 | 2935631915 | 289 |
| 101 | iso_pu_bacteria | 2941507105 | 2941507863 | 289 |
| 102 | iso_pu_bacteria | 2941515067 | 2941515632 | 289 |
| 103 | iso_pu_bacteria | 2941523033 | 2941523793 | 289 |
| 104 | iso_pu_bacteria | 3005474847 | 3005478172 | 289 |
| 105 | iso_pu_bacteria | 8006994254 | 8006994509 | 289 |
| 106 | iso_pu_bacteria | 8056673599 | 8056681245 | 289 |
| 107 | iso_pu_bacteria | 8056689827 | 8056694445 | 289 |
| 108 | 3300007265 | Ga0099794_10081908 | Ga0099794_100819082 | 291 |
| 109 | 3300031548 | Ga0307408_100131843 | Ga0307408_1001318433 | 291 |
| 110 | 3300003322 | rootL2_10326592 | rootL2_103265922 | 292 |
| 111 | 3300003323 | rootH1_10192806 | rootH1_101928063 | 292 |
| 112 | 3300005336 | Ga0070680_100192427 | Ga0070680_1001924272 | 292 |
| 113 | 3300005435 | Ga0070714_100192017 | Ga0070714_1001920172 | 292 |
| 114 | 3300005436 | Ga0070713_100021806 | Ga0070713_1000218062 | 292 |
| 115 | 3300005439 | Ga0070711_100003525 | Ga0070711_1000035253 | 292 |
| 116 | 3300005458 | Ga0070681_10009108 | Ga0070681_100091087 | 292 |
| 117 | 3300005530 | Ga0070679_100145139 | Ga0070679_1001451392 | 292 |
| 118 | 3300005616 | Ga0068852_100146171 | Ga0068852_1001461712 | 292 |
| 119 | 3300006028 | Ga0070717_10003695 | Ga0070717_100036956 | 292 |
| 120 | 3300006028 | Ga0070717_10090744 | Ga0070717_100907443 | 292 |
| 121 | 3300021384 | Ga0213876_10021304 | Ga0213876_100213043 | 292 |
| 122 | 3300025906 | Ga0207699_10015322 | Ga0207699_100153224 | 292 |
| 123 | 3300025912 | Ga0207707_10038469 | Ga0207707_100384694 | 292 |
| 124 | 3300025915 | Ga0207693_10049542 | Ga0207693_100495422 | 292 |
| 125 | 3300025916 | Ga0207663_10028886 | Ga0207663_100288863 | 292 |
| 126 | 3300025917 | Ga0207660_10160328 | Ga0207660_101603282 | 292 |
| 127 | 3300025921 | Ga0207652_10125821 | Ga0207652_101258212 | 292 |
| 128 | 3300025924 | Ga0207694_10015467 | Ga0207694_100154673 | 292 |
| 129 | 3300025928 | Ga0207700_10022695 | Ga0207700_100226954 | 292 |
| 130 | 3300025929 | Ga0207664_10130274 | Ga0207664_101302743 | 292 |
| 131 | 3300003203 | JGI25406J46586_10000665 | JGI25406J46586_1000066512 | 293 |
| 132 | 3300003215 | JGI25153J46596_10001468 | JGI25153J46596_100014686 | 293 |
| 133 | 3300005295 | Ga0065707_10272985 | Ga0065707_102729851 | 293 |
| 134 | 3300005330 | Ga0070690_100213855 | Ga0070690_1002138551 | 293 |
| 135 | 3300005340 | Ga0070689_100215091 | Ga0070689_1002150912 | 293 |
| 136 | 3300005347 | Ga0070668_100039747 | Ga0070668_1000397473 | 293 |
| 137 | 3300005347 | Ga0070668_100111289 | Ga0070668_1001112892 | 293 |
| 138 | 3300005347 | Ga0070668_100506752 | Ga0070668_1005067521 | 293 |
| 139 | 3300005353 | Ga0070669_100311651 | Ga0070669_1003116512 | 293 |
| 140 | 3300005354 | Ga0070675_100365647 | Ga0070675_1003656471 | 293 |
| 141 | 3300005355 | Ga0070671_100029173 | Ga0070671_1000291733 | 293 |
| 142 | 3300005366 | Ga0070659_100115585 | Ga0070659_1001155852 | 293 |
| 143 | 3300005436 | Ga0070713_100076366 | Ga0070713_1000763661 | 293 |
| 144 | 3300005436 | Ga0070713_100390703 | Ga0070713_1003907031 | 293 |
| 145 | 3300005438 | Ga0070701_10103923 | Ga0070701_101039232 | 293 |
| 146 | 3300005439 | Ga0070711_100003023 | Ga0070711_1000030238 | 293 |
| 147 | 3300005439 | Ga0070711_100301138 | Ga0070711_1003011382 | 293 |
| 148 | 3300005441 | Ga0070700_100021830 | Ga0070700_1000218303 | 293 |
| 149 | 3300005455 | Ga0070663_100109874 | Ga0070663_1001098741 | 293 |
| 150 | 3300005455 | Ga0070663_100159687 | Ga0070663_1001596873 | 293 |
| 151 | 3300005456 | Ga0070678_100103764 | Ga0070678_1001037642 | 293 |
| 152 | 3300005456 | Ga0070678_100310390 | Ga0070678_1003103902 | 293 |
| 153 | 3300005457 | Ga0070662_100029622 | Ga0070662_1000296223 | 293 |
| 154 | 3300005457 | Ga0070662_100072640 | Ga0070662_1000726402 | 293 |
| 155 | 3300005459 | Ga0068867_100079871 | Ga0068867_1000798713 | 293 |
| 156 | 3300005459 | Ga0068867_100170372 | Ga0068867_1001703722 | 293 |
| 157 | 3300005466 | Ga0070685_10216666 | Ga0070685_102166661 | 293 |
| 158 | 3300005467 | Ga0070706_100122730 | Ga0070706_1001227302 | 293 |
| 159 | 3300005518 | Ga0070699_100144478 | Ga0070699_1001444783 | 293 |
| 160 | 3300005539 | Ga0068853_100016904 | Ga0068853_1000169043 | 293 |
| 161 | 3300005547 | Ga0070693_100109636 | Ga0070693_1001096362 | 293 |
| 162 | 3300005547 | Ga0070693_100318354 | Ga0070693_1003183541 | 293 |
| 163 | 3300005548 | Ga0070665_100021401 | Ga0070665_1000214015 | 293 |
| 164 | 3300005548 | Ga0070665_100138811 | Ga0070665_1001388113 | 293 |
| 165 | 3300005548 | Ga0070665_100143011 | Ga0070665_1001430113 | 293 |
| 166 | 3300005548 | Ga0070665_100323144 | Ga0070665_1003231441 | 293 |
| 167 | 3300005548 | Ga0070665_100405894 | Ga0070665_1004058942 | 293 |
| 168 | 3300005549 | Ga0070704_100203209 | Ga0070704_1002032092 | 293 |
| 169 | 3300005614 | Ga0068856_100042682 | Ga0068856_1000426824 | 293 |
| 170 | 3300005615 | Ga0070702_100059432 | Ga0070702_1000594322 | 293 |
| 171 | 3300005616 | Ga0068852_100172159 | Ga0068852_1001721592 | 293 |
| 172 | 3300005617 | Ga0068859_100262266 | Ga0068859_1002622662 | 293 |
| 173 | 3300005618 | Ga0068864_100015786 | Ga0068864_1000157862 | 293 |
| 174 | 3300005618 | Ga0068864_100790651 | Ga0068864_1007906511 | 293 |
| 175 | 3300005718 | Ga0068866_10041530 | Ga0068866_100415302 | 293 |
| 176 | 3300005719 | Ga0068861_100011429 | Ga0068861_1000114294 | 293 |
| 177 | 3300005719 | Ga0068861_100221247 | Ga0068861_1002212472 | 293 |
| 178 | 3300005840 | Ga0068870_10057700 | Ga0068870_100577002 | 293 |
| 179 | 3300005841 | Ga0068863_100075269 | Ga0068863_1000752693 | 293 |
| 180 | 3300005841 | Ga0068863_100637145 | Ga0068863_1006371451 | 293 |
| 181 | 3300005842 | Ga0068858_100100926 | Ga0068858_1001009263 | 293 |
| 182 | 3300005842 | Ga0068858_100287887 | Ga0068858_1002878872 | 293 |
| 183 | 3300005843 | Ga0068860_100101597 | Ga0068860_1001015972 | 293 |
| 184 | 3300005843 | Ga0068860_100128051 | Ga0068860_1001280512 | 293 |
| 185 | 3300005844 | Ga0068862_100055173 | Ga0068862_1000551733 | 293 |
| 186 | 3300005844 | Ga0068862_100118614 | Ga0068862_1001186142 | 293 |
| 187 | 3300005844 | Ga0068862_100139074 | Ga0068862_1001390742 | 293 |
| 188 | 3300005844 | Ga0068862_100212983 | Ga0068862_1002129832 | 293 |
| 189 | 3300005844 | Ga0068862_100267816 | Ga0068862_1002678162 | 293 |
| 190 | 3300005937 | Ga0081455_10000968 | Ga0081455_1000096835 | 293 |
| 191 | 3300005983 | Ga0081540_1001903 | Ga0081540_10019037 | 293 |
| 192 | 3300005983 | Ga0081540_1008229 | Ga0081540_10082297 | 293 |
| 193 | 3300005983 | Ga0081540_1023506 | Ga0081540_10235063 | 293 |
| 194 | 3300005985 | Ga0081539_10000003 | Ga0081539_1000000358 | 293 |
| 195 | 3300005985 | Ga0081539_10001264 | Ga0081539_1000126411 | 293 |
| 196 | 3300006028 | Ga0070717_10125278 | Ga0070717_101252781 | 293 |
| 197 | 3300006038 | Ga0075365_10049888 | Ga0075365_100498883 | 293 |
| 198 | 3300006042 | Ga0075368_10029215 | Ga0075368_100292152 | 293 |
| 199 | 3300006048 | Ga0075363_100089611 | Ga0075363_1000896112 | 293 |
| 200 | 3300006051 | Ga0075364_10026158 | Ga0075364_100261583 | 293 |
| 201 | 3300006051 | Ga0075364_10138329 | Ga0075364_101383292 | 293 |
| 202 | 3300006163 | Ga0070715_10134405 | Ga0070715_101344051 | 293 |
| 203 | 3300006177 | Ga0075362_10006285 | Ga0075362_100062854 | 293 |
| 204 | 3300006178 | Ga0075367_10040124 | Ga0075367_100401242 | 293 |
| 205 | 3300006178 | Ga0075367_10040317 | Ga0075367_100403173 | 293 |
| 206 | 3300006186 | Ga0075369_10006424 | Ga0075369_100064245 | 293 |
| 207 | 3300006195 | Ga0075366_10089017 | Ga0075366_100890172 | 293 |
| 208 | 3300006237 | Ga0097621_100296670 | Ga0097621_1002966701 | 293 |
| 209 | 3300006358 | Ga0068871_100264962 | Ga0068871_1002649622 | 293 |
| 210 | 3300006871 | Ga0075434_100118812 | Ga0075434_1001188123 | 293 |
| 211 | 3300006880 | Ga0075429_100334269 | Ga0075429_1003342691 | 293 |
| 212 | 3300006881 | Ga0068865_100201933 | Ga0068865_1002019332 | 293 |
| 213 | 3300006931 | Ga0097620_100262285 | Ga0097620_1002622852 | 293 |
| 214 | 3300007076 | Ga0075435_100270735 | Ga0075435_1002707352 | 293 |
| 215 | 3300007265 | Ga0099794_10002563 | Ga0099794_100025632 | 293 |
| 216 | 3300007788 | Ga0099795_10018213 | Ga0099795_100182131 | 293 |
| 217 | 3300009092 | Ga0105250_10116964 | Ga0105250_101169642 | 293 |
| 218 | 3300009098 | Ga0105245_10120820 | Ga0105245_101208201 | 293 |
| 219 | 3300009101 | Ga0105247_10048569 | Ga0105247_100485693 | 293 |
| 220 | 3300009101 | Ga0105247_10322358 | Ga0105247_103223582 | 293 |
| 221 | 3300009147 | Ga0114129_10307629 | Ga0114129_103076291 | 293 |
| 222 | 3300009148 | Ga0105243_10112809 | Ga0105243_101128093 | 293 |
| 223 | 3300009148 | Ga0105243_10138181 | Ga0105243_101381812 | 293 |
| 224 | 3300009148 | Ga0105243_10147717 | Ga0105243_101477172 | 293 |
| 225 | 3300009174 | Ga0105241_10001928 | Ga0105241_100019285 | 293 |
| 226 | 3300009174 | Ga0105241_10144007 | Ga0105241_101440072 | 293 |
| 227 | 3300009176 | Ga0105242_10696478 | Ga0105242_106964781 | 293 |
| 228 | 3300009177 | Ga0105248_10010552 | Ga0105248_100105525 | 293 |
| 229 | 3300009177 | Ga0105248_10229799 | Ga0105248_102297992 | 293 |
| 230 | 3300009177 | Ga0105248_10965099 | Ga0105248_109650991 | 293 |
| 231 | 3300009545 | Ga0105237_10100868 | Ga0105237_101008683 | 293 |
| 232 | 3300009551 | Ga0105238_10227121 | Ga0105238_102271211 | 293 |
| 233 | 3300009553 | Ga0105249_10227298 | Ga0105249_102272982 | 293 |
| 234 | 3300010159 | Ga0099796_10003994 | Ga0099796_100039941 | 293 |
| 235 | 3300010375 | Ga0105239_10069197 | Ga0105239_100691974 | 293 |
| 236 | 3300011119 | Ga0105246_10022719 | Ga0105246_100227193 | 293 |
| 237 | 3300013296 | Ga0157374_10029281 | Ga0157374_100292815 | 293 |
| 238 | 3300013297 | Ga0157378_10004403 | Ga0157378_1000440311 | 293 |
| 239 | 3300013297 | Ga0157378_10237120 | Ga0157378_102371203 | 293 |
| 240 | 3300013297 | Ga0157378_10275316 | Ga0157378_102753162 | 293 |
| 241 | 3300013308 | Ga0157375_10078336 | Ga0157375_100783362 | 293 |
| 242 | 3300014325 | Ga0163163_10403600 | Ga0163163_104036002 | 293 |
| 243 | 3300014326 | Ga0157380_10195228 | Ga0157380_101952283 | 293 |
| 244 | 3300014745 | Ga0157377_10023715 | Ga0157377_100237152 | 293 |
| 245 | 3300014745 | Ga0157377_10098687 | Ga0157377_100986872 | 293 |
| 246 | 3300017792 | Ga0163161_10115152 | Ga0163161_101151522 | 293 |
| 247 | 3300017792 | Ga0163161_10446870 | Ga0163161_104468701 | 293 |
| 248 | 3300025297 | Ga0209758_1001548 | Ga0209758_100154811 | 293 |
| 249 | 3300025297 | Ga0209758_1011005 | Ga0209758_10110053 | 293 |
| 250 | 3300025899 | Ga0207642_10014396 | Ga0207642_100143963 | 293 |
| 251 | 3300025900 | Ga0207710_10047431 | Ga0207710_100474313 | 293 |
| 252 | 3300025901 | Ga0207688_10042568 | Ga0207688_100425682 | 293 |
| 253 | 3300025904 | Ga0207647_10064369 | Ga0207647_100643692 | 293 |
| 254 | 3300025908 | Ga0207643_10053795 | Ga0207643_100537952 | 293 |
| 255 | 3300025911 | Ga0207654_10009050 | Ga0207654_100090504 | 293 |
| 256 | 3300025915 | Ga0207693_10005401 | Ga0207693_100054012 | 293 |
| 257 | 3300025916 | Ga0207663_10045493 | Ga0207663_100454932 | 293 |
| 258 | 3300025918 | Ga0207662_10128295 | Ga0207662_101282952 | 293 |
| 259 | 3300025920 | Ga0207649_10070474 | Ga0207649_100704743 | 293 |
| 260 | 3300025924 | Ga0207694_10146246 | Ga0207694_101462462 | 293 |
| 261 | 3300025925 | Ga0207650_10477770 | Ga0207650_104777701 | 293 |
| 262 | 3300025926 | Ga0207659_10046361 | Ga0207659_100463613 | 293 |
| 263 | 3300025928 | Ga0207700_10064792 | Ga0207700_100647922 | 293 |
| 264 | 3300025928 | Ga0207700_10152221 | Ga0207700_101522212 | 293 |
| 265 | 3300025928 | Ga0207700_10207648 | Ga0207700_102076482 | 293 |
| 266 | 3300025931 | Ga0207644_10014914 | Ga0207644_100149145 | 293 |
| 267 | 3300025931 | Ga0207644_10169566 | Ga0207644_101695662 | 293 |
| 268 | 3300025933 | Ga0207706_10037923 | Ga0207706_100379234 | 293 |
| 269 | 3300025935 | Ga0207709_10038706 | Ga0207709_100387062 | 293 |
| 270 | 3300025936 | Ga0207670_10040920 | Ga0207670_100409202 | 293 |
| 271 | 3300025937 | Ga0207669_10009224 | Ga0207669_100092242 | 293 |
| 272 | 3300025937 | Ga0207669_10161844 | Ga0207669_101618441 | 293 |
| 273 | 3300025938 | Ga0207704_10028657 | Ga0207704_100286573 | 293 |
| 274 | 3300025938 | Ga0207704_10073113 | Ga0207704_100731132 | 293 |
| 275 | 3300025939 | Ga0207665_10068810 | Ga0207665_100688102 | 293 |
| 276 | 3300025940 | Ga0207691_10331443 | Ga0207691_103314432 | 293 |
| 277 | 3300025941 | Ga0207711_10018668 | Ga0207711_100186682 | 293 |
| 278 | 3300025942 | Ga0207689_10038905 | Ga0207689_100389052 | 293 |
| 279 | 3300025942 | Ga0207689_10041008 | Ga0207689_100410083 | 293 |
| 280 | 3300025960 | Ga0207651_10417267 | Ga0207651_104172672 | 293 |
| 281 | 3300025961 | Ga0207712_10126245 | Ga0207712_101262453 | 293 |
| 282 | 3300025972 | Ga0207668_10058960 | Ga0207668_100589602 | 293 |
| 283 | 3300025972 | Ga0207668_10187478 | Ga0207668_101874782 | 293 |
| 284 | 3300025986 | Ga0207658_10113861 | Ga0207658_101138613 | 293 |
| 285 | 3300026023 | Ga0207677_10026223 | Ga0207677_100262233 | 293 |
| 286 | 3300026035 | Ga0207703_10030499 | Ga0207703_100304993 | 293 |
| 287 | 3300026035 | Ga0207703_10058199 | Ga0207703_100581992 | 293 |
| 288 | 3300026041 | Ga0207639_10057754 | Ga0207639_100577542 | 293 |
| 289 | 3300026041 | Ga0207639_10482898 | Ga0207639_104828982 | 293 |
| 290 | 3300026067 | Ga0207678_10018386 | Ga0207678_100183865 | 293 |
| 291 | 3300026067 | Ga0207678_10030049 | Ga0207678_100300494 | 293 |
| 292 | 3300026067 | Ga0207678_10066029 | Ga0207678_100660293 | 293 |
| 293 | 3300026067 | Ga0207678_10069217 | Ga0207678_100692172 | 293 |
| 294 | 3300026075 | Ga0207708_10025479 | Ga0207708_100254793 | 293 |
| 295 | 3300026078 | Ga0207702_10019880 | Ga0207702_100198803 | 293 |
| 296 | 3300026088 | Ga0207641_10124206 | Ga0207641_101242063 | 293 |
| 297 | 3300026088 | Ga0207641_10349486 | Ga0207641_103494862 | 293 |
| 298 | 3300026089 | Ga0207648_10024498 | Ga0207648_100244985 | 293 |
| 299 | 3300026089 | Ga0207648_10192179 | Ga0207648_101921793 | 293 |
| 300 | 3300026095 | Ga0207676_10080873 | Ga0207676_100808732 | 293 |
| 301 | 3300026116 | Ga0207674_10172897 | Ga0207674_101728973 | 293 |
| 302 | 3300026118 | Ga0207675_100017977 | Ga0207675_1000179774 | 293 |
| 303 | 3300026118 | Ga0207675_100139550 | Ga0207675_1001395502 | 293 |
| 304 | 3300026121 | Ga0207683_10140959 | Ga0207683_101409593 | 293 |
| 305 | 3300026142 | Ga0207698_10065235 | Ga0207698_100652353 | 293 |
| 306 | 3300027671 | Ga0209588_1012945 | Ga0209588_10129453 | 293 |
| 307 | 3300028379 | Ga0268266_10029428 | Ga0268266_100294282 | 293 |
| 308 | 3300028379 | Ga0268266_10035979 | Ga0268266_100359793 | 293 |
| 309 | 3300028379 | Ga0268266_10122001 | Ga0268266_101220012 | 293 |
| 310 | 3300028380 | Ga0268265_10049491 | Ga0268265_100494913 | 293 |
| 311 | 3300028380 | Ga0268265_10084372 | Ga0268265_100843722 | 293 |
| 312 | 3300028380 | Ga0268265_10174782 | Ga0268265_101747822 | 293 |
| 313 | 3300028381 | Ga0268264_10085509 | Ga0268264_100855093 | 293 |
| 314 | 3300028381 | Ga0268264_10124455 | Ga0268264_101244552 | 293 |
| 315 | 3300028786 | Ga0307517_10168883 | Ga0307517_101688832 | 293 |
| 316 | 3300031250 | Ga0265331_10010603 | Ga0265331_100106034 | 293 |
| 317 | 3300031344 | Ga0265316_10084655 | Ga0265316_100846553 | 293 |
| 318 | 3300031344 | Ga0265316_10127401 | Ga0265316_101274011 | 293 |
| 319 | 3300031507 | Ga0307509_10167802 | Ga0307509_101678022 | 293 |
| 320 | 3300031616 | Ga0307508_10053562 | Ga0307508_100535624 | 293 |
| 321 | 3300031616 | Ga0307508_10131644 | Ga0307508_101316443 | 293 |
| 322 | 3300031712 | Ga0265342_10005683 | Ga0265342_100056832 | 293 |
| 323 | 3300031731 | Ga0307405_10221738 | Ga0307405_102217382 | 293 |
| 324 | 3300031731 | Ga0307405_10245332 | Ga0307405_102453322 | 293 |
| 325 | 3300031995 | Ga0307409_100329372 | Ga0307409_1003293721 | 293 |
| 326 | 3300032005 | Ga0307411_10103485 | Ga0307411_101034852 | 293 |
| 327 | 3300032005 | Ga0307411_10399622 | Ga0307411_103996222 | 293 |
| 328 | 3300032126 | Ga0307415_100030366 | Ga0307415_1000303663 | 293 |
| 329 | 3300032126 | Ga0307415_100087879 | Ga0307415_1000878792 | 293 |
| 330 | 3300035117 | Ga0373953_0029256 | Ga0373953_0029256_1186_2067 | 293 |
| 331 | 3300035120 | Ga0373957_0071016 | Ga0373957_0071016_11_892 | 293 |
| 332 | 3300035410 | Ga0373924_0000771 | Ga0373924_0000771_4770_5651 | 293 |
| 333 | 3300035691 | Ga0373931_0254970 | Ga0373931_0254970_173_1054 | 293 |
| 334 | 3300041486 | Ga0451807_1644881 | Ga0451807_1644881_108_989 | 293 |
| 335 | 3300046455 | Ga0495603_0132855 | Ga0495603_0132855_255_1136 | 293 |
| 336 | 3300046455 | Ga0495603_0134946 | Ga0495603_0134946_135_1016 | 293 |
| 337 | 3300046460 | Ga0495638_0022806 | Ga0495638_0022806_2683_3564 | 293 |
| 338 | 3300046460 | Ga0495638_0150502 | Ga0495638_0150502_160_1041 | 293 |
| 339 | 3300046471 | Ga0495650_0078341 | Ga0495650_0078341_355_1236 | 293 |
| 340 | 3300046472 | Ga0495580_0107065 | Ga0495580_0107065_335_1216 | 293 |
| 341 | 3300046491 | Ga0495584_0031570 | Ga0495584_0031570_55_936 | 293 |
| 342 | 3300046491 | Ga0495584_0097107 | Ga0495584_0097107_159_1040 | 293 |
| 343 | 3300046491 | Ga0495584_0183454 | Ga0495584_0183454_46_927 | 293 |
| 344 | 3300046492 | Ga0495585_0013139 | Ga0495585_0013139_3049_3930 | 293 |
| 345 | 3300046499 | Ga0495594_0114388 | Ga0495594_0114388_11_892 | 293 |
| 346 | 3300046499 | Ga0495594_0168213 | Ga0495594_0168213_325_1206 | 293 |
| 347 | 3300046501 | Ga0495607_0100135 | Ga0495607_0100135_186_1067 | 293 |
| 348 | 3300046512 | Ga0495610_0155392 | Ga0495610_0155392_78_959 | 293 |
| 349 | 3300046513 | Ga0495616_0031366 | Ga0495616_0031366_1460_2341 | 293 |
| 350 | 3300046514 | Ga0495618_0077420 | Ga0495618_0077420_168_1049 | 293 |
| 351 | 3300046524 | Ga0495648_0147481 | Ga0495648_0147481_182_1063 | 293 |
| 352 | 3300046526 | Ga0495666_0134727 | Ga0495666_0134727_230_1111 | 293 |
| 353 | 3300046536 | Ga0495587_0068905 | Ga0495587_0068905_281_1162 | 293 |
| 354 | 3300046537 | Ga0495598_0012329 | Ga0495598_0012329_925_1806 | 293 |
| 355 | 3300046558 | Ga0495633_0148652 | Ga0495633_0148652_55_936 | 293 |
| 356 | 3300046615 | Ga0495656_0007675 | Ga0495656_0007675_2724_3605 | 293 |
| 357 | 3300046615 | Ga0495656_0049824 | Ga0495656_0049824_533_1438 | 293 |
| 358 | 3300046616 | Ga0495668_0146130 | Ga0495668_0146130_371_1252 | 293 |
| 359 | 3300046648 | Ga0495611_0031354 | Ga0495611_0031354_167_1048 | 293 |
| 360 | 3300046660 | Ga0495625_0028888 | Ga0495625_0028888_459_1340 | 293 |
| 361 | 3300046663 | Ga0495635_0003853 | Ga0495635_0003853_6161_7042 | 293 |
| 362 | 3300046664 | Ga0495659_0143569 | Ga0495659_0143569_46_927 | 293 |
| 363 | 3300046684 | Ga0495669_0040721 | Ga0495669_0040721_533_1414 | 293 |
| 364 | 3300046684 | Ga0495669_0067194 | Ga0495669_0067194_629_1510 | 293 |
| 365 | 3300046689 | Ga0495613_0336209 | Ga0495613_0336209_35_916 | 293 |
| 366 | 3300046794 | Ga0495589_0075377 | Ga0495589_0075377_232_1113 | 293 |
| 367 | 3300047317 | Ga0495604_0068237 | Ga0495604_0068237_1607_2488 | 293 |
| 368 | 3300047319 | Ga0495674_0270522 | Ga0495674_0270522_48_929 | 293 |
| 369 | 3300047320 | Ga0495672_0094815 | Ga0495672_0094815_273_1154 | 293 |
| 370 | 3300047322 | Ga0495680_0308541 | Ga0495680_0308541_218_1099 | 293 |
| 371 | 3300047469 | Ga0495673_0090535 | Ga0495673_0090535_65_946 | 293 |
| 372 | 3300047469 | Ga0495673_0098497 | Ga0495673_0098497_260_1141 | 293 |
| 373 | 3300047471 | Ga0495684_0004769 | Ga0495684_0004769_7944_8825 | 293 |
| 374 | 3300048091 | Ga0495626_0087219 | Ga0495626_0087219_114_995 | 293 |
| 375 | 3300048904 | Ga0496101_0257927 | Ga0496101_0257927_92_973 | 293 |
| 376 | 3300048905 | Ga0496102_0198732 | Ga0496102_0198732_354_1235 | 293 |
| 377 | 3300048906 | Ga0496103_0191004 | Ga0496103_0191004_45_926 | 293 |
| 378 | 3300048907 | Ga0496104_0044151 | Ga0496104_0044151_1713_2594 | 293 |
| 379 | 3300048909 | Ga0496106_0035274 | Ga0496106_0035274_604_1485 | 293 |
| 380 | 3300048909 | Ga0496106_0214802 | Ga0496106_0214802_251_1156 | 293 |
| 381 | 3300048910 | Ga0496107_0073581 | Ga0496107_0073581_512_1393 | 293 |
| 382 | 3300048911 | Ga0496108_0009248 | Ga0496108_0009248_1706_2587 | 293 |
| 383 | 3300048911 | Ga0496108_0049240 | Ga0496108_0049240_444_1325 | 293 |
| 384 | 3300048911 | Ga0496108_0271283 | Ga0496108_0271283_330_1211 | 293 |
| 385 | 3300048912 | Ga0496109_0034672 | Ga0496109_0034672_1657_2538 | 293 |
| 386 | 3300048912 | Ga0496109_0222250 | Ga0496109_0222250_694_1575 | 293 |
| 387 | 3300048913 | Ga0496110_0077716 | Ga0496110_0077716_776_1657 | 293 |
| 388 | 3300048913 | Ga0496110_0079675 | Ga0496110_0079675_681_1562 | 293 |
| 389 | 3300048913 | Ga0496110_0315265 | Ga0496110_0315265_73_954 | 293 |
| 390 | 3300048915 | Ga0496112_0086520 | Ga0496112_0086520_364_1245 | 293 |
| 391 | 3300048915 | Ga0496112_0496607 | Ga0496112_0496607_100_981 | 293 |
| 392 | 3300048915 | Ga0496112_0523756 | Ga0496112_0523756_207_1088 | 293 |
| 393 | 3300048917 | Ga0496114_0159103 | Ga0496114_0159103_569_1474 | 293 |
| 394 | 3300048917 | Ga0496114_0535202 | Ga0496114_0535202_143_1024 | 293 |
| 395 | 3300048918 | Ga0496115_0025922 | Ga0496115_0025922_1286_2167 | 293 |
| 396 | 3300048920 | Ga0496117_0097320 | Ga0496117_0097320_712_1593 | 293 |
| 397 | 3300048921 | Ga0496118_0043458 | Ga0496118_0043458_1476_2357 | 293 |
| 398 | 3300048921 | Ga0496118_0213535 | Ga0496118_0213535_13_894 | 293 |
| 399 | 3300048924 | Ga0496121_0008049 | Ga0496121_0008049_9706_10587 | 293 |
| 400 | 3300048924 | Ga0496121_0039498 | Ga0496121_0039498_1586_2467 | 293 |
| 401 | 3300048924 | Ga0496121_0150739 | Ga0496121_0150739_690_1571 | 293 |
| 402 | 3300048927 | Ga0496124_0136283 | Ga0496124_0136283_382_1299 | 293 |
| 403 | 3300048928 | Ga0496125_0202616 | Ga0496125_0202616_334_1215 | 293 |
| 404 | 3300048929 | Ga0496126_0050463 | Ga0496126_0050463_657_1541 | 293 |
| 405 | 3300048929 | Ga0496126_0052940 | Ga0496126_0052940_1992_2873 | 293 |
| 406 | 3300048929 | Ga0496126_0083814 | Ga0496126_0083814_686_1567 | 293 |
| 407 | 3300048929 | Ga0496126_0108216 | Ga0496126_0108216_379_1296 | 293 |
| 408 | 3300048929 | Ga0496126_0132141 | Ga0496126_0132141_1253_2134 | 293 |
| 409 | 3300048929 | Ga0496126_0234463 | Ga0496126_0234463_624_1505 | 293 |
| 410 | 3300048929 | Ga0496126_0375228 | Ga0496126_0375228_12_893 | 293 |
| 411 | 3300049592 | Ga0501076_0137271 | Ga0501076_0137271_471_1352 | 293 |
| 412 | 3300050491 | nmdc:mga00v17_5856_c1 | nmdc:mga00v17_5856_c1_1148_2029 | 293 |
| 413 | 3300050492 | nmdc:mga0yw44_41805_c1 | nmdc:mga0yw44_41805_c1_880_1761 | 293 |
| 414 | 3300050494 | nmdc:mga06z11_10424_c1 | nmdc:mga06z11_10424_c1_2720_3601 | 293 |
| 415 | 3300050494 | nmdc:mga06z11_118882_c1 | nmdc:mga06z11_118882_c1_168_1049 | 293 |
| 416 | 3300050496 | nmdc:mga07m45_66910_c1 | nmdc:mga07m45_66910_c1_795_1676 | 293 |
| 417 | 3300050496 | nmdc:mga07m45_78189_c1 | nmdc:mga07m45_78189_c1_976_1857 | 293 |
| 418 | 3300050496 | nmdc:mga07m45_94065_c1 | nmdc:mga07m45_94065_c1_189_1070 | 293 |
| 419 | 3300050508 | nmdc:mga09592_110563_c1 | nmdc:mga09592_110563_c1_237_1118 | 293 |
| 420 | 3300050516 | nmdc:mga0sz30_24912_c1 | nmdc:mga0sz30_24912_c1_925_1806 | 293 |
| 421 | 3300053084 | Ga0495595_0000520 | Ga0495595_0000520_6065_6946 | 293 |
| 422 | 3300053085 | Ga0495619_0416901 | Ga0495619_0416901_34_915 | 293 |
| 423 | 3300053092 | Ga0500583_0035176 | Ga0500583_0035176_1331_2212 | 293 |
| 424 | 3300053093 | Ga0500651_0071921 | Ga0500651_0071921_210_1091 | 293 |
| 425 | 3300053096 | Ga0500641_0076659 | Ga0500641_0076659_216_1121 | 293 |
| 426 | 3300053098 | Ga0500650_0074265 | Ga0500650_0074265_91_972 | 293 |
| 427 | 3300053109 | Ga0500569_007875 | Ga0500569_007875_981_1862 | 293 |
| 428 | 3300053118 | Ga0500594_0005487 | Ga0500594_0005487_389_1270 | 293 |
| 429 | 3300053118 | Ga0500594_0013431 | Ga0500594_0013431_355_1236 | 293 |
| 430 | 3300053119 | Ga0500595_003031 | Ga0500595_003031_2824_3705 | 293 |
| 431 | 3300053119 | Ga0500595_015856 | Ga0500595_015856_1356_2237 | 293 |
| 432 | 3300053119 | Ga0500595_025664 | Ga0500595_025664_195_1076 | 293 |
| 433 | 3300053134 | Ga0500658_0023412 | Ga0500658_0023412_421_1302 | 293 |
| 434 | 3300053139 | Ga0500568_0052161 | Ga0500568_0052161_434_1315 | 293 |
| 435 | 3300053142 | Ga0500577_0025742 | Ga0500577_0025742_828_1709 | 293 |
| 436 | 3300053148 | Ga0500590_041614 | Ga0500590_041614_510_1391 | 293 |
| 437 | 3300053730 | Ga0500645_020172 | Ga0500645_020172_632_1513 | 293 |
| 438 | iso_pu_bacteria | 2889033259 | 2889042287 | 293 |
| 439 | iso_pu_bacteria | 8019565922 | 8019566420 | 293 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1ffv-assembly1.cif.gz_F | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.94 | 1 | 284 |
| 1ffu-assembly1.cif.gz_F | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor | 0.9398 | 1 | 284 |
| 1zxi-assembly1.cif.gz_F | reconstituted co dehydrogenase from oligotropha carboxidovorans | 0.9334 | 1 | 284 |
| 1n5w-assembly1.cif.gz_C | crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form | 0.9302 | 1 | 284 |
| 1ffv-assembly1.cif.gz_F | carbon monoxide dehydrogenase from hydrogenophaga pseudoflava | 0.9274 | 1 | 284 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1t3qF02 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9509 | 58 | 174 | 3.30.465.10 |
| 1ffvC03 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9473 | 60 | 173 | 3.30.465.10 |
| af_Q46800_56_173_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9418 | 58 | 173 | 3.30.465.10 |
| 1ffvC03 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9394 | 60 | 173 | 3.30.465.10 |
| af_I6Y7N2_57_165_3.30.465.10 | Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; | 0.9375 | 65 | 173 | 3.30.465.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H1U904-F1-model_v4 | Carbon-monoxide dehydrogenase medium subunit | 0.9619 | 1 | 293 |
GO:0016491
GO:0071949 |
| AF-A0A1H1U904-F1-model_v4 | Carbon-monoxide dehydrogenase medium subunit | 0.9587 | 1 | 293 |
GO:0016491
GO:0071949 |
| AF-A0A5P9FT59-F1-model_v4 | 6-hydroxypseudooxynicotine dehydrogenase complex subunit alpha (EC 1.5.99.14) | 0.949 | 1 | 287 |
GO:0034909
GO:0071949 |
| AF-A0A535V6W6-F1-model_v4 | Xanthine dehydrogenase family protein subunit M | 0.9467 | 71 | 220 |
GO:0016491
GO:0071949 |
| AF-A0A023XLW3-F1-model_v4 | deleted | 0.9461 | 2 | 283 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar