F444170

General Info

Members Datasets Scaffolds Average Seq Length
439 281 415 291

Family's Representative Sequence

Representative Sequence 3300006186|Ga0075369_10029062|Ga0075369_100290623
Length 289
Sequence VKAPAFDYAKPRTLSEAFDLLERHGEEAKLLAGGQTLMATLNMRLSQPGILIDITGLAGESALSGIRHENGVVSIGALTRHREIERSSVIATQVPMLAQAVPHIAHIAIRNVGTFGGSIAFADPAAEYPVCAVALDANLVLISRQGERRVPARQFFKALYETDLKPGELVARGEFPAQKPGYRSVFMELARRHGDYAIVGVAAHAKVAGGVLSEVSLAYLGMGGIPMLARNAMTELEGKAYTLEMVGAAQRALAGELDPSADLYSSAATKLHLARVLTGRALAALVEGT

Samples

Sample ID Description Type Environment
1 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
2 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
3 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
4 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
5 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
6 2791355199
7 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
8 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
9 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
10 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
11 2904699407
12 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
13 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
14 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
15 2922425934
16 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
17 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
18 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
19 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
20 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
21 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
23 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
24 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
25 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
26 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
27 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
28 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
78 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
79 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
80 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
115 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
171 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
172 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
184 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
188 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
193 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
196 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
199 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
207 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
213 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
214 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
215 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
218 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
219 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
220 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
241 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
242 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
246 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
247 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
248 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
249 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
252 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
255 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
256 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
257 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
258 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
259 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
260 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
261 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
262 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
263 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
264 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
265 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
266 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
267 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
268 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
271 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
272 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
273 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
274 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
275 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
276 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
277 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
278 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
279 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
280 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
281 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.18
Metatranscriptomes 0
Isolates 4.82

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.35
Nodule 4.1
Rhizoplane 8.66
Rhizosphere 66.06
Stem 0
Stem Tuber 0
Unclassified 6.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10000665 3300003203 Bacteria 16012
2 JGI25153J46596_10001468 3300003215 Bacteria 14070
3 rootL2_10326592 3300003322 Bacteria 1585
4 rootH1_10192806 3300003323 Bacteria 2585
5 Ga0065707_10272985 3300005295 Bacteria 1066
6 Ga0070683_100025184 3300005329 Bacteria 5340
7 Ga0070690_100213855 3300005330 Bacteria 1347
8 Ga0070680_100192427 3300005336 Bacteria 1719
9 Ga0068868_100078090 3300005338 Bacteria 2649
10 Ga0070689_100215091 3300005340 Bacteria 1575
11 Ga0070668_100039747 3300005347 Bacteria 3597
12 Ga0070668_100111289 3300005347 Bacteria 2179
13 Ga0070668_100506752 3300005347 Bacteria 1045
14 Ga0070669_100311651 3300005353 Bacteria 1269
15 Ga0070675_100365647 3300005354 Bacteria 1282
16 Ga0070671_100019364 3300005355 Bacteria 5538
17 Ga0070671_100029173 3300005355 Bacteria 4549
18 Ga0070671_100322709 3300005355 Bacteria 1316
19 Ga0070659_100115585 3300005366 Bacteria 2169
20 Ga0070714_100192017 3300005435 Bacteria 1864
21 Ga0070713_100021806 3300005436 Bacteria 4937
22 Ga0070713_100076366 3300005436 Bacteria 2845
23 Ga0070713_100390703 3300005436 Bacteria 1298
24 Ga0070701_10103923 3300005438 Bacteria 1578
25 Ga0070711_100003023 3300005439 Bacteria 9725
26 Ga0070711_100003525 3300005439 Bacteria 9132
27 Ga0070711_100301138 3300005439 Bacteria 1275
28 Ga0070700_100021830 3300005441 Bacteria 3724
29 Ga0070663_100000736 3300005455 Bacteria 17673
30 Ga0070663_100109874 3300005455 Bacteria 2070
31 Ga0070663_100159687 3300005455 Bacteria 1734
32 Ga0070678_100103764 3300005456 Bacteria 2209
33 Ga0070678_100310390 3300005456 Bacteria 1343
34 Ga0070662_100029622 3300005457 Bacteria 3821
35 Ga0070662_100072640 3300005457 Bacteria 2540
36 Ga0070681_10009108 3300005458 Bacteria 9756
37 Ga0068867_100079871 3300005459 Bacteria 2462
38 Ga0068867_100170372 3300005459 Bacteria 1724
39 Ga0070685_10216666 3300005466 Bacteria 1252
40 Ga0070706_100122730 3300005467 Bacteria 2422
41 Ga0070699_100144478 3300005518 Bacteria 2102
42 Ga0070679_100145139 3300005530 Bacteria 2351
43 Ga0068853_100016904 3300005539 Bacteria 6012
44 Ga0070693_100109636 3300005547 Bacteria 1696
45 Ga0070693_100318354 3300005547 Bacteria 1054
46 Ga0070665_100020717 3300005548 Bacteria 6606
47 Ga0070665_100021401 3300005548 Bacteria 6504
48 Ga0070665_100025420 3300005548 Bacteria 5967
49 Ga0070665_100138811 3300005548 Bacteria 2434
50 Ga0070665_100143011 3300005548 Bacteria 2395
51 Ga0070665_100323144 3300005548 Bacteria 1547
52 Ga0070665_100405894 3300005548 Bacteria 1371
53 Ga0070704_100203209 3300005549 Bacteria 1601
54 Ga0070664_100017744 3300005564 Bacteria 5846
55 Ga0068856_100042682 3300005614 Bacteria 4461
56 Ga0070702_100059432 3300005615 Bacteria 2218
57 Ga0068852_100124921 3300005616 Bacteria 2361
58 Ga0068852_100146171 3300005616 Bacteria 2193
59 Ga0068852_100172159 3300005616 Bacteria 2031
60 Ga0068859_100262266 3300005617 Bacteria 1819
61 Ga0068864_100015786 3300005618 Bacteria 6283
62 Ga0068864_100066209 3300005618 Bacteria 3135
63 Ga0068864_100790651 3300005618 Bacteria 932
64 Ga0068866_10041530 3300005718 Bacteria 2282
65 Ga0068861_100011429 3300005719 Bacteria 6173
66 Ga0068861_100221247 3300005719 Bacteria 1600
67 Ga0068851_10029608 3300005834 Bacteria 2711
68 Ga0068870_10057700 3300005840 Bacteria 2076
69 Ga0068863_100075269 3300005841 Bacteria 3194
70 Ga0068863_100637145 3300005841 Bacteria 1056
71 Ga0068858_100100926 3300005842 Bacteria 2691
72 Ga0068858_100287887 3300005842 Bacteria 1565
73 Ga0068860_100101597 3300005843 Bacteria 2743
74 Ga0068860_100128051 3300005843 Bacteria 2434
75 Ga0068862_100055173 3300005844 Bacteria 3403
76 Ga0068862_100118614 3300005844 Bacteria 2329
77 Ga0068862_100139074 3300005844 Bacteria 2154
78 Ga0068862_100212983 3300005844 Bacteria 1746
79 Ga0068862_100267816 3300005844 Bacteria 1561
80 Ga0081455_10000968 3300005937 Bacteria 36782
81 Ga0081455_10006130 3300005937 Bacteria 12989
82 Ga0081540_1001903 3300005983 Bacteria 17470
83 Ga0081540_1008229 3300005983 Bacteria 7308
84 Ga0081540_1023506 3300005983 Bacteria 3602
85 Ga0081539_10000003 3300005985 Bacteria 594833
86 Ga0081539_10001264 3300005985 Bacteria 44681
87 Ga0070717_10003695 3300006028 Bacteria 10995
88 Ga0070717_10090744 3300006028 Bacteria 2579
89 Ga0070717_10125278 3300006028 Bacteria 2205
90 Ga0075365_10033630 3300006038 Bacteria 3306
91 Ga0075365_10049888 3300006038 Bacteria 2759
92 Ga0075368_10029215 3300006042 Bacteria 2131
93 Ga0075363_100089611 3300006048 Bacteria 1691
94 Ga0075364_10026158 3300006051 Bacteria 3721
95 Ga0075364_10138329 3300006051 Bacteria 1637
96 Ga0070715_10134405 3300006163 Bacteria 1194
97 Ga0070715_10177824 3300006163 Bacteria 1065
98 Ga0075362_10006285 3300006177 Bacteria 4416
99 Ga0075362_10010305 3300006177 Bacteria 3645
100 Ga0075367_10040124 3300006178 Bacteria 2732
101 Ga0075367_10040317 3300006178 Bacteria 2726
102 Ga0075367_10043125 3300006178 Bacteria 2642
103 Ga0075369_10006424 3300006186 Bacteria 4442
104 Ga0075369_10029062 3300006186 Bacteria 2320
105 Ga0075366_10012971 3300006195 Bacteria 4738
106 Ga0075366_10076765 3300006195 Bacteria 1994
107 Ga0075366_10089017 3300006195 Bacteria 1849
108 Ga0097621_100226016 3300006237 Bacteria 1633
109 Ga0097621_100296670 3300006237 Bacteria 1427
110 Ga0068871_100018780 3300006358 Bacteria 5266
111 Ga0068871_100264962 3300006358 Bacteria 1500
112 Ga0075434_100118812 3300006871 Bacteria 2658
113 Ga0075429_100334269 3300006880 Bacteria 1326
114 Ga0068865_100201933 3300006881 Bacteria 1544
115 Ga0097620_100262285 3300006931 Bacteria 1819
116 Ga0075435_100270735 3300007076 Bacteria 1449
117 Ga0099794_10002563 3300007265 Bacteria 6738
118 Ga0099794_10081908 3300007265 Bacteria 1593
119 Ga0099795_10018213 3300007788 Bacteria 2253
120 Ga0105250_10116964 3300009092 Bacteria 1094
121 Ga0111539_10438848 3300009094 Bacteria 1520
122 Ga0105245_10120820 3300009098 Bacteria 2447
123 Ga0105247_10048569 3300009101 Bacteria 2607
124 Ga0105247_10322358 3300009101 Bacteria 1078
125 Ga0114129_10307629 3300009147 Bacteria 2110
126 Ga0105243_10112809 3300009148 Bacteria 2278
127 Ga0105243_10138181 3300009148 Bacteria 2076
128 Ga0105243_10146253 3300009148 Bacteria 2022
129 Ga0105243_10147717 3300009148 Bacteria 2013
130 Ga0105241_10001928 3300009174 Bacteria 15692
131 Ga0105241_10144007 3300009174 Bacteria 1943
132 Ga0105242_10696478 3300009176 Bacteria 993
133 Ga0105248_10010552 3300009177 Bacteria 10178
134 Ga0105248_10229799 3300009177 Bacteria 2088
135 Ga0105248_10448889 3300009177 Bacteria 1453
136 Ga0105248_10965099 3300009177 Bacteria 963
137 Ga0105237_10100868 3300009545 Bacteria 2878
138 Ga0105238_10227121 3300009551 Bacteria 1844
139 Ga0105238_10359236 3300009551 Bacteria 1446
140 Ga0105249_10227298 3300009553 Bacteria 1839
141 Ga0099796_10003994 3300010159 Bacteria 3506
142 Ga0099796_10029518 3300010159 Bacteria 1770
143 Ga0105239_10016969 3300010375 Bacteria 8048
144 Ga0105239_10069197 3300010375 Bacteria 3878
145 Ga0105246_10022719 3300011119 Bacteria 4051
146 Ga0157374_10017285 3300013296 Bacteria 6348
147 Ga0157374_10029281 3300013296 Bacteria 4984
148 Ga0157378_10004403 3300013297 Bacteria 12399
149 Ga0157378_10237120 3300013297 Bacteria 1741
150 Ga0157378_10244898 3300013297 Bacteria 1714
151 Ga0157378_10275316 3300013297 Bacteria 1620
152 Ga0163162_10007321 3300013306 Bacteria 10728
153 Ga0157375_10078336 3300013308 Bacteria 3338
154 Ga0163163_10031547 3300014325 Bacteria 5116
155 Ga0163163_10403600 3300014325 Bacteria 1425
156 Ga0157380_10195228 3300014326 Bacteria 1791
157 Ga0157377_10023715 3300014745 Bacteria 3255
158 Ga0157377_10098687 3300014745 Bacteria 1736
159 Ga0157376_10002079 3300014969 Bacteria 13458
160 Ga0163161_10115152 3300017792 Bacteria 2015
161 Ga0163161_10446870 3300017792 Bacteria 1044
162 Ga0213876_10021304 3300021384 Bacteria 3429
163 Ga0209233_1017139 3300025261 Bacteria 1979
164 Ga0209758_1001548 3300025297 Bacteria 26409
165 Ga0209758_1011005 3300025297 Bacteria 5308
166 Ga0207642_10014396 3300025899 Bacteria 2918
167 Ga0207710_10047431 3300025900 Bacteria 1920
168 Ga0207688_10042568 3300025901 Bacteria 2528
169 Ga0207647_10064369 3300025904 Bacteria 2228
170 Ga0207699_10015322 3300025906 Bacteria 3979
171 Ga0207643_10053795 3300025908 Bacteria 2287
172 Ga0207654_10009050 3300025911 Bacteria 5053
173 Ga0207707_10038469 3300025912 Bacteria 4180
174 Ga0207693_10005401 3300025915 Bacteria 10679
175 Ga0207693_10049542 3300025915 Bacteria 3298
176 Ga0207663_10028886 3300025916 Bacteria 3251
177 Ga0207663_10045493 3300025916 Bacteria 2700
178 Ga0207660_10160328 3300025917 Bacteria 1735
179 Ga0207662_10128295 3300025918 Bacteria 1596
180 Ga0207649_10070474 3300025920 Bacteria 2230
181 Ga0207652_10125821 3300025921 Bacteria 2283
182 Ga0207694_10015467 3300025924 Bacteria 5754
183 Ga0207694_10146246 3300025924 Bacteria 1902
184 Ga0207650_10477770 3300025925 Bacteria 1040
185 Ga0207659_10046361 3300025926 Bacteria 3069
186 Ga0207687_10056072 3300025927 Bacteria 2763
187 Ga0207700_10022695 3300025928 Bacteria 4310
188 Ga0207700_10064792 3300025928 Bacteria 2785
189 Ga0207700_10152221 3300025928 Bacteria 1913
190 Ga0207700_10207648 3300025928 Bacteria 1654
191 Ga0207664_10130274 3300025929 Bacteria 2117
192 Ga0207644_10014914 3300025931 Bacteria 5210
193 Ga0207644_10169566 3300025931 Bacteria 1703
194 Ga0207706_10037923 3300025933 Bacteria 4276
195 Ga0207709_10038706 3300025935 Bacteria 2843
196 Ga0207670_10040920 3300025936 Bacteria 3045
197 Ga0207669_10009224 3300025937 Bacteria 4684
198 Ga0207669_10161844 3300025937 Bacteria 1582
199 Ga0207704_10028657 3300025938 Bacteria 3093
200 Ga0207704_10073113 3300025938 Bacteria 2182
201 Ga0207665_10068810 3300025939 Bacteria 2413
202 Ga0207691_10331443 3300025940 Bacteria 1304
203 Ga0207711_10018668 3300025941 Bacteria 5766
204 Ga0207711_10510990 3300025941 Bacteria 1120
205 Ga0207689_10038905 3300025942 Bacteria 3938
206 Ga0207689_10041008 3300025942 Bacteria 3830
207 Ga0207651_10417267 3300025960 Bacteria 1145
208 Ga0207712_10126245 3300025961 Bacteria 1943
209 Ga0207668_10058960 3300025972 Bacteria 2686
210 Ga0207668_10187478 3300025972 Bacteria 1636
211 Ga0207640_10228345 3300025981 Bacteria 1430
212 Ga0207658_10113861 3300025986 Bacteria 2144
213 Ga0207677_10026223 3300026023 Bacteria 3651
214 Ga0207677_10088771 3300026023 Bacteria 2242
215 Ga0207703_10030499 3300026035 Bacteria 4262
216 Ga0207703_10058199 3300026035 Bacteria 3154
217 Ga0207639_10057754 3300026041 Bacteria 2981
218 Ga0207639_10482898 3300026041 Bacteria 1129
219 Ga0207678_10018386 3300026067 Bacteria 6137
220 Ga0207678_10025052 3300026067 Bacteria 5209
221 Ga0207678_10030049 3300026067 Bacteria 4743
222 Ga0207678_10066029 3300026067 Bacteria 3106
223 Ga0207678_10069217 3300026067 Bacteria 3026
224 Ga0207708_10025479 3300026075 Bacteria 4474
225 Ga0207702_10019880 3300026078 Bacteria 5563
226 Ga0207641_10124206 3300026088 Bacteria 2308
227 Ga0207641_10349486 3300026088 Bacteria 1409
228 Ga0207648_10024498 3300026089 Bacteria 5386
229 Ga0207648_10192179 3300026089 Bacteria 1809
230 Ga0207676_10080873 3300026095 Bacteria 2638
231 Ga0207676_10103173 3300026095 Bacteria 2369
232 Ga0207674_10172897 3300026116 Bacteria 2113
233 Ga0207675_100017977 3300026118 Bacteria 6595
234 Ga0207675_100139550 3300026118 Bacteria 2302
235 Ga0207683_10140959 3300026121 Bacteria 2172
236 Ga0207698_10065235 3300026142 Bacteria 2858
237 Ga0207698_10198263 3300026142 Bacteria 1795
238 Ga0209179_1003788 3300027512 Bacteria 2217
239 Ga0209588_1012945 3300027671 Bacteria 2538
240 Ga0268266_10029428 3300028379 Bacteria 4669
241 Ga0268266_10035979 3300028379 Bacteria 4212
242 Ga0268266_10122001 3300028379 Bacteria 2320
243 Ga0268266_10347388 3300028379 Bacteria 1393
244 Ga0268265_10049491 3300028380 Bacteria 3161
245 Ga0268265_10084372 3300028380 Bacteria 2518
246 Ga0268265_10174782 3300028380 Bacteria 1839
247 Ga0268264_10085509 3300028381 Bacteria 2707
248 Ga0268264_10124455 3300028381 Bacteria 2276
249 Ga0307517_10168883 3300028786 Bacteria 1444
250 Ga0307511_10000103 3300030521 Bacteria 75234
251 Ga0265331_10010603 3300031250 Bacteria 5089
252 Ga0265316_10084655 3300031344 Bacteria 2428
253 Ga0265316_10127401 3300031344 Bacteria 1919
254 Ga0307509_10167802 3300031507 Bacteria 2080
255 Ga0307408_100131843 3300031548 Bacteria 1951
256 Ga0307508_10053562 3300031616 Bacteria 3580
257 Ga0307508_10131644 3300031616 Bacteria 2105
258 Ga0265342_10005683 3300031712 Bacteria 9436
259 Ga0307405_10221738 3300031731 Bacteria 1388
260 Ga0307405_10245332 3300031731 Bacteria 1329
261 Ga0307409_100329372 3300031995 Bacteria 1432
262 Ga0307411_10103485 3300032005 Bacteria 2020
263 Ga0307411_10399622 3300032005 Bacteria 1136
264 Ga0307415_100030366 3300032126 Bacteria 3468
265 Ga0307415_100087879 3300032126 Bacteria 2241
266 Ga0307510_10032281 3300033180 Bacteria 5900
267 Ga0373953_0029256 3300035117 Bacteria 2129
268 Ga0373957_0071016 3300035120 Bacteria 1362
269 Ga0373924_0000771 3300035410 Bacteria 9947
270 Ga0373931_0254970 3300035691 Bacteria 1068
271 Ga0451807_1644881 3300041486 Bacteria 1007
272 Ga0451807_2421406 3300041486 Bacteria 986
273 Ga0451577_0172266 3300042876 Bacteria 1950
274 Ga0453684_0698170 3300044712 Bacteria 1103
275 Ga0451576_0374062 3300045051 Bacteria 1493
276 Ga0495603_0120297 3300046455 Bacteria 1530
277 Ga0495603_0132855 3300046455 Bacteria 1449
278 Ga0495603_0134946 3300046455 Bacteria 1436
279 Ga0495638_0022806 3300046460 Bacteria 4104
280 Ga0495638_0150502 3300046460 Bacteria 1350
281 Ga0495650_0078341 3300046471 Bacteria 1280
282 Ga0495580_0107065 3300046472 Bacteria 1942
283 Ga0495584_0031570 3300046491 Bacteria 2681
284 Ga0495584_0097107 3300046491 Bacteria 1488
285 Ga0495584_0183454 3300046491 Bacteria 1063
286 Ga0495585_0013139 3300046492 Bacteria 4852
287 Ga0495594_0114388 3300046499 Bacteria 1523
288 Ga0495594_0168213 3300046499 Bacteria 1247
289 Ga0495607_0100135 3300046501 Bacteria 1554
290 Ga0495610_0155392 3300046512 Bacteria 972
291 Ga0495616_0031366 3300046513 Bacteria 2783
292 Ga0495618_0077420 3300046514 Bacteria 2119
293 Ga0495648_0147481 3300046524 Bacteria 1231
294 Ga0495666_0134727 3300046526 Bacteria 1153
295 Ga0495587_0068905 3300046536 Bacteria 2060
296 Ga0495598_0012329 3300046537 Bacteria 2095
297 Ga0495633_0148652 3300046558 Bacteria 1082
298 Ga0495656_0007675 3300046615 Bacteria 3824
299 Ga0495656_0049824 3300046615 Bacteria 1785
300 Ga0495668_0146130 3300046616 Bacteria 1294
301 Ga0495611_0031354 3300046648 Bacteria 2339
302 Ga0495625_0028888 3300046660 Bacteria 4152
303 Ga0495635_0003853 3300046663 Bacteria 10418
304 Ga0495659_0143569 3300046664 Bacteria 954
305 Ga0495669_0040721 3300046684 Bacteria 2061
306 Ga0495669_0067194 3300046684 Bacteria 1629
307 Ga0495613_0336209 3300046689 Bacteria 1040
308 Ga0495589_0075377 3300046794 Bacteria 1645
309 Ga0495604_0068237 3300047317 Bacteria 2699
310 Ga0495674_0270522 3300047319 Bacteria 1394
311 Ga0495672_0094815 3300047320 Bacteria 1631
312 Ga0495680_0308541 3300047322 Bacteria 1109
313 Ga0495673_0090535 3300047469 Bacteria 1251
314 Ga0495673_0098497 3300047469 Bacteria 1185
315 Ga0495684_0004769 3300047471 Bacteria 10598
316 Ga0495626_0087219 3300048091 Bacteria 1378
317 Ga0496100_0001966 3300048903 Bacteria 10302
318 Ga0496101_0017527 3300048904 Bacteria 4857
319 Ga0496101_0257927 3300048904 Bacteria 1359
320 Ga0496102_0048672 3300048905 Bacteria 3854
321 Ga0496102_0198732 3300048905 Bacteria 1890
322 Ga0496103_0191004 3300048906 Bacteria 1317
323 Ga0496104_0044151 3300048907 Bacteria 4188
324 Ga0496105_0003693 3300048908 Bacteria 11390
325 Ga0496106_0035274 3300048909 Bacteria 3740
326 Ga0496106_0060824 3300048909 Bacteria 2864
327 Ga0496106_0214802 3300048909 Bacteria 1533
328 Ga0496107_0073581 3300048910 Bacteria 2486
329 Ga0496108_0009248 3300048911 Bacteria 7972
330 Ga0496108_0049240 3300048911 Bacteria 3524
331 Ga0496108_0052041 3300048911 Bacteria 3431
332 Ga0496108_0271283 3300048911 Bacteria 1477
333 Ga0496109_0009741 3300048912 Bacteria 8201
334 Ga0496109_0034672 3300048912 Bacteria 4548
335 Ga0496109_0222250 3300048912 Bacteria 1776
336 Ga0496110_0077716 3300048913 Bacteria 2953
337 Ga0496110_0079675 3300048913 Bacteria 2917
338 Ga0496110_0138365 3300048913 Bacteria 2201
339 Ga0496110_0315265 3300048913 Bacteria 1424
340 Ga0496111_0018005 3300048914 Bacteria 4887
341 Ga0496112_0041094 3300048915 Bacteria 4524
342 Ga0496112_0086520 3300048915 Bacteria 3101
343 Ga0496112_0291275 3300048915 Bacteria 1578
344 Ga0496112_0496607 3300048915 Bacteria 1156
345 Ga0496112_0523756 3300048915 Bacteria 1120
346 Ga0496113_0026739 3300048916 Bacteria 4129
347 Ga0496114_0003347 3300048917 Bacteria 12322
348 Ga0496114_0159103 3300048917 Bacteria 1963
349 Ga0496114_0535202 3300048917 Bacteria 1036
350 Ga0496115_0003657 3300048918 Bacteria 11062
351 Ga0496115_0025922 3300048918 Bacteria 4569
352 Ga0496117_0097320 3300048920 Bacteria 1875
353 Ga0496118_0043458 3300048921 Bacteria 3532
354 Ga0496118_0213535 3300048921 Bacteria 1130
355 Ga0496121_0008049 3300048924 Bacteria 12567
356 Ga0496121_0039498 3300048924 Bacteria 4157
357 Ga0496121_0150739 3300048924 Bacteria 1711
358 Ga0496121_0281665 3300048924 Bacteria 1137
359 Ga0496124_0136283 3300048927 Bacteria 1943
360 Ga0496125_0202616 3300048928 Bacteria 1297
361 Ga0496126_0050463 3300048929 Bacteria 3791
362 Ga0496126_0052940 3300048929 Bacteria 3685
363 Ga0496126_0083814 3300048929 Bacteria 2813
364 Ga0496126_0108216 3300048929 Bacteria 2424
365 Ga0496126_0132141 3300048929 Bacteria 2156
366 Ga0496126_0234463 3300048929 Bacteria 1536
367 Ga0496126_0375228 3300048929 Bacteria 1159
368 Ga0501076_0137271 3300049592 Bacteria 1986
369 Ga0501081_0688433 3300049743 Bacteria 767
370 nmdc:mga03683_26107_c1 3300050489 Bacteria 2302
371 nmdc:mga00v17_296052_c1 3300050491 Bacteria 1051
372 nmdc:mga00v17_5856_c1 3300050491 Bacteria 6492
373 nmdc:mga0yw44_41805_c1 3300050492 Bacteria 2731
374 nmdc:mga0yw44_60889_c1 3300050492 Bacteria 2314
375 nmdc:mga06z11_10424_c1 3300050494 Bacteria 3961
376 nmdc:mga06z11_118882_c1 3300050494 Bacteria 1472
377 nmdc:mga07m45_2669_c2 3300050496 Bacteria 3334
378 nmdc:mga07m45_66910_c1 3300050496 Bacteria 2042
379 nmdc:mga07m45_78189_c1 3300050496 Bacteria 1887
380 nmdc:mga07m45_94065_c1 3300050496 Bacteria 1718
381 nmdc:mga09592_110563_c1 3300050508 Bacteria 2357
382 nmdc:mga0sz30_20757_c1 3300050516 Bacteria 1984
383 nmdc:mga0sz30_24912_c1 3300050516 Bacteria 2445
384 Ga0500635_0002690 3300053080 Bacteria 4408
385 Ga0495595_0000520 3300053084 Bacteria 14684
386 Ga0495619_0416901 3300053085 Bacteria 926
387 Ga0500646_0000870 3300053090 Bacteria 8319
388 Ga0500583_0010028 3300053092 Bacteria 3493
389 Ga0500583_0035176 3300053092 Bacteria 2233
390 Ga0500651_0071921 3300053093 Bacteria 2151
391 Ga0500651_0077501 3300053093 Bacteria 2062
392 Ga0500566_0005926 3300053094 Bacteria 7269
393 Ga0500641_0076659 3300053096 Bacteria 1414
394 Ga0500650_0074265 3300053098 Bacteria 1590
395 Ga0500554_001459 3300053102 Bacteria 4572
396 Ga0500569_007875 3300053109 Bacteria 2413
397 Ga0500594_0005487 3300053118 Bacteria 2815
398 Ga0500594_0013431 3300053118 Bacteria 1946
399 Ga0500595_002486 3300053119 Bacteria 9120
400 Ga0500595_003031 3300053119 Bacteria 7980
401 Ga0500595_015856 3300053119 Bacteria 2819
402 Ga0500595_025664 3300053119 Bacteria 2040
403 Ga0500642_0002107 3300053130 Bacteria 5777
404 Ga0500658_0023412 3300053134 Bacteria 2357
405 Ga0500568_0052161 3300053139 Bacteria 1607
406 Ga0500577_0025742 3300053142 Bacteria 1994
407 Ga0500590_041614 3300053148 Bacteria 2362
408 Ga0500603_000124 3300053150 Bacteria 18201
409 Ga0500604_0001532 3300053151 Bacteria 6466
410 Ga0500638_007491 3300053162 Bacteria 4572
411 Ga0500637_0039165 3300053178 Bacteria 2672
412 Ga0500637_0044081 3300053178 Bacteria 2526
413 Ga0500637_0189918 3300053178 Bacteria 1174
414 Ga0500645_020172 3300053730 Bacteria 2067
415 Ga0500661_001975 3300055283 Bacteria 3871

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049743 Ga0501081_0688433 Ga0501081_0688433_17_745 241
2 3300033180 Ga0307510_10032281 Ga0307510_100322812 271
3 3300046455 Ga0495603_0120297 Ga0495603_0120297_171_1076 271
4 3300053080 Ga0500635_0002690 Ga0500635_0002690_2570_3475 271
5 3300053102 Ga0500554_001459 Ga0500554_001459_518_1423 271
6 3300053150 Ga0500603_000124 Ga0500603_000124_1987_2892 271
7 3300053178 Ga0500637_0039165 Ga0500637_0039165_1346_2251 271
8 3300006177 Ga0075362_10010305 Ga0075362_100103052 272
9 3300006178 Ga0075367_10043125 Ga0075367_100431253 272
10 3300006195 Ga0075366_10012971 Ga0075366_100129714 272
11 3300050489 nmdc:mga03683_26107_c1 nmdc:mga03683_26107_c1_1265_2137 272
12 3300050496 nmdc:mga07m45_2669_c2 nmdc:mga07m45_2669_c2_2221_3093 272
13 3300006163 Ga0070715_10177824 Ga0070715_101778242 273
14 3300009094 Ga0111539_10438848 Ga0111539_104388482 274
15 3300025261 Ga0209233_1017139 Ga0209233_10171392 274
16 3300041486 Ga0451807_2421406 Ga0451807_2421406_26_850 274
17 3300010159 Ga0099796_10029518 Ga0099796_100295183 277
18 3300027512 Ga0209179_1003788 Ga0209179_10037883 277
19 3300048924 Ga0496121_0281665 Ga0496121_0281665_237_1118 277
20 3300053094 Ga0500566_0005926 Ga0500566_0005926_926_1807 277
21 3300053119 Ga0500595_002486 Ga0500595_002486_5831_6712 277
22 3300053162 Ga0500638_007491 Ga0500638_007491_3567_4448 277
23 3300053178 Ga0500637_0044081 Ga0500637_0044081_1314_2195 277
24 3300055283 Ga0500661_001975 Ga0500661_001975_2532_3413 277
25 3300048915 Ga0496112_0041094 Ga0496112_0041094_2974_3855 279
26 3300050491 nmdc:mga00v17_296052_c1 nmdc:mga00v17_296052_c1_26_865 279
27 3300005329 Ga0070683_100025184 Ga0070683_1000251845 280
28 3300005338 Ga0068868_100078090 Ga0068868_1000780902 280
29 3300005355 Ga0070671_100019364 Ga0070671_1000193644 280
30 3300005455 Ga0070663_100000736 Ga0070663_1000007366 280
31 3300005548 Ga0070665_100020717 Ga0070665_1000207176 280
32 3300005564 Ga0070664_100017744 Ga0070664_1000177444 280
33 3300005616 Ga0068852_100124921 Ga0068852_1001249212 280
34 3300005618 Ga0068864_100066209 Ga0068864_1000662093 280
35 3300005834 Ga0068851_10029608 Ga0068851_100296083 280
36 3300006237 Ga0097621_100226016 Ga0097621_1002260162 280
37 3300006358 Ga0068871_100018780 Ga0068871_1000187803 280
38 3300009148 Ga0105243_10146253 Ga0105243_101462532 280
39 3300009177 Ga0105248_10448889 Ga0105248_104488892 280
40 3300009551 Ga0105238_10359236 Ga0105238_103592362 280
41 3300010375 Ga0105239_10016969 Ga0105239_100169692 280
42 3300013296 Ga0157374_10017285 Ga0157374_100172855 280
43 3300013297 Ga0157378_10244898 Ga0157378_102448982 280
44 3300013306 Ga0163162_10007321 Ga0163162_1000732110 280
45 3300014325 Ga0163163_10031547 Ga0163163_100315473 280
46 3300014969 Ga0157376_10002079 Ga0157376_100020799 280
47 3300025927 Ga0207687_10056072 Ga0207687_100560723 280
48 3300025941 Ga0207711_10510990 Ga0207711_105109901 280
49 3300026023 Ga0207677_10088771 Ga0207677_100887712 280
50 3300026067 Ga0207678_10025052 Ga0207678_100250523 280
51 3300026095 Ga0207676_10103173 Ga0207676_101031732 280
52 3300026142 Ga0207698_10198263 Ga0207698_101982633 280
53 3300048903 Ga0496100_0001966 Ga0496100_0001966_3880_4761 280
54 3300048904 Ga0496101_0017527 Ga0496101_0017527_927_1808 280
55 3300048905 Ga0496102_0048672 Ga0496102_0048672_2861_3742 280
56 3300048908 Ga0496105_0003693 Ga0496105_0003693_2585_3466 280
57 3300048909 Ga0496106_0060824 Ga0496106_0060824_780_1661 280
58 3300048911 Ga0496108_0052041 Ga0496108_0052041_1382_2263 280
59 3300048912 Ga0496109_0009741 Ga0496109_0009741_6394_7275 280
60 3300048913 Ga0496110_0138365 Ga0496110_0138365_536_1417 280
61 3300048914 Ga0496111_0018005 Ga0496111_0018005_699_1580 280
62 3300048915 Ga0496112_0291275 Ga0496112_0291275_639_1520 280
63 3300048916 Ga0496113_0026739 Ga0496113_0026739_1973_2854 280
64 3300048917 Ga0496114_0003347 Ga0496114_0003347_11005_11886 280
65 3300048918 Ga0496115_0003657 Ga0496115_0003657_8456_9337 280
66 3300053093 Ga0500651_0077501 Ga0500651_0077501_1130_2011 280
67 3300053130 Ga0500642_0002107 Ga0500642_0002107_1279_2160 280
68 3300025981 Ga0207640_10228345 Ga0207640_102283451 281
69 3300005937 Ga0081455_10006130 Ga0081455_100061309 282
70 3300042876 Ga0451577_0172266 Ga0451577_0172266_753_1610 282
71 3300044712 Ga0453684_0698170 Ga0453684_0698170_27_884 282
72 3300045051 Ga0451576_0374062 Ga0451576_0374062_330_1187 282
73 3300053178 Ga0500637_0189918 Ga0500637_0189918_143_1003 282
74 3300006038 Ga0075365_10033630 Ga0075365_100336304 284
75 3300050492 nmdc:mga0yw44_60889_c1 nmdc:mga0yw44_60889_c1_930_1796 284
76 3300006186 Ga0075369_10029062 Ga0075369_100290623 285
77 3300006195 Ga0075366_10076765 Ga0075366_100767653 285
78 3300030521 Ga0307511_10000103 Ga0307511_1000010312 285
79 3300050516 nmdc:mga0sz30_20757_c1 nmdc:mga0sz30_20757_c1_361_1230 285
80 3300053090 Ga0500646_0000870 Ga0500646_0000870_6310_7179 285
81 3300053092 Ga0500583_0010028 Ga0500583_0010028_851_1720 285
82 3300053151 Ga0500604_0001532 Ga0500604_0001532_3583_4452 285
83 3300005548 Ga0070665_100025420 Ga0070665_1000254203 287
84 3300028379 Ga0268266_10347388 Ga0268266_103473882 287
85 iso_pu_bacteria 2513237141 2513888379 287
86 3300005355 Ga0070671_100322709 Ga0070671_1003227092 288
87 iso_pu_bacteria 2513237101 2513693623 289
88 iso_pu_bacteria 2524023228 2524535724 289
89 iso_pu_bacteria 2667528175 2671123977 289
90 iso_pu_bacteria 2791355197 2793071362 289
91 iso_pu_bacteria 2791355199 2793081285 289
92 iso_pu_bacteria 2876808645 2876817047 289
93 iso_pu_bacteria 2879110137 2879117568 289
94 iso_pu_bacteria 2904690495 2904697233 289
95 iso_pu_bacteria 2904699407 2904705443 289
96 iso_pu_bacteria 2908756301 2908762196 289
97 iso_pu_bacteria 2922361189 2922362911 289
98 iso_pu_bacteria 2922386360 2922390548 289
99 iso_pu_bacteria 2922425934 2922428187 289
100 iso_pu_bacteria 2935630451 2935631915 289
101 iso_pu_bacteria 2941507105 2941507863 289
102 iso_pu_bacteria 2941515067 2941515632 289
103 iso_pu_bacteria 2941523033 2941523793 289
104 iso_pu_bacteria 3005474847 3005478172 289
105 iso_pu_bacteria 8006994254 8006994509 289
106 iso_pu_bacteria 8056673599 8056681245 289
107 iso_pu_bacteria 8056689827 8056694445 289
108 3300007265 Ga0099794_10081908 Ga0099794_100819082 291
109 3300031548 Ga0307408_100131843 Ga0307408_1001318433 291
110 3300003322 rootL2_10326592 rootL2_103265922 292
111 3300003323 rootH1_10192806 rootH1_101928063 292
112 3300005336 Ga0070680_100192427 Ga0070680_1001924272 292
113 3300005435 Ga0070714_100192017 Ga0070714_1001920172 292
114 3300005436 Ga0070713_100021806 Ga0070713_1000218062 292
115 3300005439 Ga0070711_100003525 Ga0070711_1000035253 292
116 3300005458 Ga0070681_10009108 Ga0070681_100091087 292
117 3300005530 Ga0070679_100145139 Ga0070679_1001451392 292
118 3300005616 Ga0068852_100146171 Ga0068852_1001461712 292
119 3300006028 Ga0070717_10003695 Ga0070717_100036956 292
120 3300006028 Ga0070717_10090744 Ga0070717_100907443 292
121 3300021384 Ga0213876_10021304 Ga0213876_100213043 292
122 3300025906 Ga0207699_10015322 Ga0207699_100153224 292
123 3300025912 Ga0207707_10038469 Ga0207707_100384694 292
124 3300025915 Ga0207693_10049542 Ga0207693_100495422 292
125 3300025916 Ga0207663_10028886 Ga0207663_100288863 292
126 3300025917 Ga0207660_10160328 Ga0207660_101603282 292
127 3300025921 Ga0207652_10125821 Ga0207652_101258212 292
128 3300025924 Ga0207694_10015467 Ga0207694_100154673 292
129 3300025928 Ga0207700_10022695 Ga0207700_100226954 292
130 3300025929 Ga0207664_10130274 Ga0207664_101302743 292
131 3300003203 JGI25406J46586_10000665 JGI25406J46586_1000066512 293
132 3300003215 JGI25153J46596_10001468 JGI25153J46596_100014686 293
133 3300005295 Ga0065707_10272985 Ga0065707_102729851 293
134 3300005330 Ga0070690_100213855 Ga0070690_1002138551 293
135 3300005340 Ga0070689_100215091 Ga0070689_1002150912 293
136 3300005347 Ga0070668_100039747 Ga0070668_1000397473 293
137 3300005347 Ga0070668_100111289 Ga0070668_1001112892 293
138 3300005347 Ga0070668_100506752 Ga0070668_1005067521 293
139 3300005353 Ga0070669_100311651 Ga0070669_1003116512 293
140 3300005354 Ga0070675_100365647 Ga0070675_1003656471 293
141 3300005355 Ga0070671_100029173 Ga0070671_1000291733 293
142 3300005366 Ga0070659_100115585 Ga0070659_1001155852 293
143 3300005436 Ga0070713_100076366 Ga0070713_1000763661 293
144 3300005436 Ga0070713_100390703 Ga0070713_1003907031 293
145 3300005438 Ga0070701_10103923 Ga0070701_101039232 293
146 3300005439 Ga0070711_100003023 Ga0070711_1000030238 293
147 3300005439 Ga0070711_100301138 Ga0070711_1003011382 293
148 3300005441 Ga0070700_100021830 Ga0070700_1000218303 293
149 3300005455 Ga0070663_100109874 Ga0070663_1001098741 293
150 3300005455 Ga0070663_100159687 Ga0070663_1001596873 293
151 3300005456 Ga0070678_100103764 Ga0070678_1001037642 293
152 3300005456 Ga0070678_100310390 Ga0070678_1003103902 293
153 3300005457 Ga0070662_100029622 Ga0070662_1000296223 293
154 3300005457 Ga0070662_100072640 Ga0070662_1000726402 293
155 3300005459 Ga0068867_100079871 Ga0068867_1000798713 293
156 3300005459 Ga0068867_100170372 Ga0068867_1001703722 293
157 3300005466 Ga0070685_10216666 Ga0070685_102166661 293
158 3300005467 Ga0070706_100122730 Ga0070706_1001227302 293
159 3300005518 Ga0070699_100144478 Ga0070699_1001444783 293
160 3300005539 Ga0068853_100016904 Ga0068853_1000169043 293
161 3300005547 Ga0070693_100109636 Ga0070693_1001096362 293
162 3300005547 Ga0070693_100318354 Ga0070693_1003183541 293
163 3300005548 Ga0070665_100021401 Ga0070665_1000214015 293
164 3300005548 Ga0070665_100138811 Ga0070665_1001388113 293
165 3300005548 Ga0070665_100143011 Ga0070665_1001430113 293
166 3300005548 Ga0070665_100323144 Ga0070665_1003231441 293
167 3300005548 Ga0070665_100405894 Ga0070665_1004058942 293
168 3300005549 Ga0070704_100203209 Ga0070704_1002032092 293
169 3300005614 Ga0068856_100042682 Ga0068856_1000426824 293
170 3300005615 Ga0070702_100059432 Ga0070702_1000594322 293
171 3300005616 Ga0068852_100172159 Ga0068852_1001721592 293
172 3300005617 Ga0068859_100262266 Ga0068859_1002622662 293
173 3300005618 Ga0068864_100015786 Ga0068864_1000157862 293
174 3300005618 Ga0068864_100790651 Ga0068864_1007906511 293
175 3300005718 Ga0068866_10041530 Ga0068866_100415302 293
176 3300005719 Ga0068861_100011429 Ga0068861_1000114294 293
177 3300005719 Ga0068861_100221247 Ga0068861_1002212472 293
178 3300005840 Ga0068870_10057700 Ga0068870_100577002 293
179 3300005841 Ga0068863_100075269 Ga0068863_1000752693 293
180 3300005841 Ga0068863_100637145 Ga0068863_1006371451 293
181 3300005842 Ga0068858_100100926 Ga0068858_1001009263 293
182 3300005842 Ga0068858_100287887 Ga0068858_1002878872 293
183 3300005843 Ga0068860_100101597 Ga0068860_1001015972 293
184 3300005843 Ga0068860_100128051 Ga0068860_1001280512 293
185 3300005844 Ga0068862_100055173 Ga0068862_1000551733 293
186 3300005844 Ga0068862_100118614 Ga0068862_1001186142 293
187 3300005844 Ga0068862_100139074 Ga0068862_1001390742 293
188 3300005844 Ga0068862_100212983 Ga0068862_1002129832 293
189 3300005844 Ga0068862_100267816 Ga0068862_1002678162 293
190 3300005937 Ga0081455_10000968 Ga0081455_1000096835 293
191 3300005983 Ga0081540_1001903 Ga0081540_10019037 293
192 3300005983 Ga0081540_1008229 Ga0081540_10082297 293
193 3300005983 Ga0081540_1023506 Ga0081540_10235063 293
194 3300005985 Ga0081539_10000003 Ga0081539_1000000358 293
195 3300005985 Ga0081539_10001264 Ga0081539_1000126411 293
196 3300006028 Ga0070717_10125278 Ga0070717_101252781 293
197 3300006038 Ga0075365_10049888 Ga0075365_100498883 293
198 3300006042 Ga0075368_10029215 Ga0075368_100292152 293
199 3300006048 Ga0075363_100089611 Ga0075363_1000896112 293
200 3300006051 Ga0075364_10026158 Ga0075364_100261583 293
201 3300006051 Ga0075364_10138329 Ga0075364_101383292 293
202 3300006163 Ga0070715_10134405 Ga0070715_101344051 293
203 3300006177 Ga0075362_10006285 Ga0075362_100062854 293
204 3300006178 Ga0075367_10040124 Ga0075367_100401242 293
205 3300006178 Ga0075367_10040317 Ga0075367_100403173 293
206 3300006186 Ga0075369_10006424 Ga0075369_100064245 293
207 3300006195 Ga0075366_10089017 Ga0075366_100890172 293
208 3300006237 Ga0097621_100296670 Ga0097621_1002966701 293
209 3300006358 Ga0068871_100264962 Ga0068871_1002649622 293
210 3300006871 Ga0075434_100118812 Ga0075434_1001188123 293
211 3300006880 Ga0075429_100334269 Ga0075429_1003342691 293
212 3300006881 Ga0068865_100201933 Ga0068865_1002019332 293
213 3300006931 Ga0097620_100262285 Ga0097620_1002622852 293
214 3300007076 Ga0075435_100270735 Ga0075435_1002707352 293
215 3300007265 Ga0099794_10002563 Ga0099794_100025632 293
216 3300007788 Ga0099795_10018213 Ga0099795_100182131 293
217 3300009092 Ga0105250_10116964 Ga0105250_101169642 293
218 3300009098 Ga0105245_10120820 Ga0105245_101208201 293
219 3300009101 Ga0105247_10048569 Ga0105247_100485693 293
220 3300009101 Ga0105247_10322358 Ga0105247_103223582 293
221 3300009147 Ga0114129_10307629 Ga0114129_103076291 293
222 3300009148 Ga0105243_10112809 Ga0105243_101128093 293
223 3300009148 Ga0105243_10138181 Ga0105243_101381812 293
224 3300009148 Ga0105243_10147717 Ga0105243_101477172 293
225 3300009174 Ga0105241_10001928 Ga0105241_100019285 293
226 3300009174 Ga0105241_10144007 Ga0105241_101440072 293
227 3300009176 Ga0105242_10696478 Ga0105242_106964781 293
228 3300009177 Ga0105248_10010552 Ga0105248_100105525 293
229 3300009177 Ga0105248_10229799 Ga0105248_102297992 293
230 3300009177 Ga0105248_10965099 Ga0105248_109650991 293
231 3300009545 Ga0105237_10100868 Ga0105237_101008683 293
232 3300009551 Ga0105238_10227121 Ga0105238_102271211 293
233 3300009553 Ga0105249_10227298 Ga0105249_102272982 293
234 3300010159 Ga0099796_10003994 Ga0099796_100039941 293
235 3300010375 Ga0105239_10069197 Ga0105239_100691974 293
236 3300011119 Ga0105246_10022719 Ga0105246_100227193 293
237 3300013296 Ga0157374_10029281 Ga0157374_100292815 293
238 3300013297 Ga0157378_10004403 Ga0157378_1000440311 293
239 3300013297 Ga0157378_10237120 Ga0157378_102371203 293
240 3300013297 Ga0157378_10275316 Ga0157378_102753162 293
241 3300013308 Ga0157375_10078336 Ga0157375_100783362 293
242 3300014325 Ga0163163_10403600 Ga0163163_104036002 293
243 3300014326 Ga0157380_10195228 Ga0157380_101952283 293
244 3300014745 Ga0157377_10023715 Ga0157377_100237152 293
245 3300014745 Ga0157377_10098687 Ga0157377_100986872 293
246 3300017792 Ga0163161_10115152 Ga0163161_101151522 293
247 3300017792 Ga0163161_10446870 Ga0163161_104468701 293
248 3300025297 Ga0209758_1001548 Ga0209758_100154811 293
249 3300025297 Ga0209758_1011005 Ga0209758_10110053 293
250 3300025899 Ga0207642_10014396 Ga0207642_100143963 293
251 3300025900 Ga0207710_10047431 Ga0207710_100474313 293
252 3300025901 Ga0207688_10042568 Ga0207688_100425682 293
253 3300025904 Ga0207647_10064369 Ga0207647_100643692 293
254 3300025908 Ga0207643_10053795 Ga0207643_100537952 293
255 3300025911 Ga0207654_10009050 Ga0207654_100090504 293
256 3300025915 Ga0207693_10005401 Ga0207693_100054012 293
257 3300025916 Ga0207663_10045493 Ga0207663_100454932 293
258 3300025918 Ga0207662_10128295 Ga0207662_101282952 293
259 3300025920 Ga0207649_10070474 Ga0207649_100704743 293
260 3300025924 Ga0207694_10146246 Ga0207694_101462462 293
261 3300025925 Ga0207650_10477770 Ga0207650_104777701 293
262 3300025926 Ga0207659_10046361 Ga0207659_100463613 293
263 3300025928 Ga0207700_10064792 Ga0207700_100647922 293
264 3300025928 Ga0207700_10152221 Ga0207700_101522212 293
265 3300025928 Ga0207700_10207648 Ga0207700_102076482 293
266 3300025931 Ga0207644_10014914 Ga0207644_100149145 293
267 3300025931 Ga0207644_10169566 Ga0207644_101695662 293
268 3300025933 Ga0207706_10037923 Ga0207706_100379234 293
269 3300025935 Ga0207709_10038706 Ga0207709_100387062 293
270 3300025936 Ga0207670_10040920 Ga0207670_100409202 293
271 3300025937 Ga0207669_10009224 Ga0207669_100092242 293
272 3300025937 Ga0207669_10161844 Ga0207669_101618441 293
273 3300025938 Ga0207704_10028657 Ga0207704_100286573 293
274 3300025938 Ga0207704_10073113 Ga0207704_100731132 293
275 3300025939 Ga0207665_10068810 Ga0207665_100688102 293
276 3300025940 Ga0207691_10331443 Ga0207691_103314432 293
277 3300025941 Ga0207711_10018668 Ga0207711_100186682 293
278 3300025942 Ga0207689_10038905 Ga0207689_100389052 293
279 3300025942 Ga0207689_10041008 Ga0207689_100410083 293
280 3300025960 Ga0207651_10417267 Ga0207651_104172672 293
281 3300025961 Ga0207712_10126245 Ga0207712_101262453 293
282 3300025972 Ga0207668_10058960 Ga0207668_100589602 293
283 3300025972 Ga0207668_10187478 Ga0207668_101874782 293
284 3300025986 Ga0207658_10113861 Ga0207658_101138613 293
285 3300026023 Ga0207677_10026223 Ga0207677_100262233 293
286 3300026035 Ga0207703_10030499 Ga0207703_100304993 293
287 3300026035 Ga0207703_10058199 Ga0207703_100581992 293
288 3300026041 Ga0207639_10057754 Ga0207639_100577542 293
289 3300026041 Ga0207639_10482898 Ga0207639_104828982 293
290 3300026067 Ga0207678_10018386 Ga0207678_100183865 293
291 3300026067 Ga0207678_10030049 Ga0207678_100300494 293
292 3300026067 Ga0207678_10066029 Ga0207678_100660293 293
293 3300026067 Ga0207678_10069217 Ga0207678_100692172 293
294 3300026075 Ga0207708_10025479 Ga0207708_100254793 293
295 3300026078 Ga0207702_10019880 Ga0207702_100198803 293
296 3300026088 Ga0207641_10124206 Ga0207641_101242063 293
297 3300026088 Ga0207641_10349486 Ga0207641_103494862 293
298 3300026089 Ga0207648_10024498 Ga0207648_100244985 293
299 3300026089 Ga0207648_10192179 Ga0207648_101921793 293
300 3300026095 Ga0207676_10080873 Ga0207676_100808732 293
301 3300026116 Ga0207674_10172897 Ga0207674_101728973 293
302 3300026118 Ga0207675_100017977 Ga0207675_1000179774 293
303 3300026118 Ga0207675_100139550 Ga0207675_1001395502 293
304 3300026121 Ga0207683_10140959 Ga0207683_101409593 293
305 3300026142 Ga0207698_10065235 Ga0207698_100652353 293
306 3300027671 Ga0209588_1012945 Ga0209588_10129453 293
307 3300028379 Ga0268266_10029428 Ga0268266_100294282 293
308 3300028379 Ga0268266_10035979 Ga0268266_100359793 293
309 3300028379 Ga0268266_10122001 Ga0268266_101220012 293
310 3300028380 Ga0268265_10049491 Ga0268265_100494913 293
311 3300028380 Ga0268265_10084372 Ga0268265_100843722 293
312 3300028380 Ga0268265_10174782 Ga0268265_101747822 293
313 3300028381 Ga0268264_10085509 Ga0268264_100855093 293
314 3300028381 Ga0268264_10124455 Ga0268264_101244552 293
315 3300028786 Ga0307517_10168883 Ga0307517_101688832 293
316 3300031250 Ga0265331_10010603 Ga0265331_100106034 293
317 3300031344 Ga0265316_10084655 Ga0265316_100846553 293
318 3300031344 Ga0265316_10127401 Ga0265316_101274011 293
319 3300031507 Ga0307509_10167802 Ga0307509_101678022 293
320 3300031616 Ga0307508_10053562 Ga0307508_100535624 293
321 3300031616 Ga0307508_10131644 Ga0307508_101316443 293
322 3300031712 Ga0265342_10005683 Ga0265342_100056832 293
323 3300031731 Ga0307405_10221738 Ga0307405_102217382 293
324 3300031731 Ga0307405_10245332 Ga0307405_102453322 293
325 3300031995 Ga0307409_100329372 Ga0307409_1003293721 293
326 3300032005 Ga0307411_10103485 Ga0307411_101034852 293
327 3300032005 Ga0307411_10399622 Ga0307411_103996222 293
328 3300032126 Ga0307415_100030366 Ga0307415_1000303663 293
329 3300032126 Ga0307415_100087879 Ga0307415_1000878792 293
330 3300035117 Ga0373953_0029256 Ga0373953_0029256_1186_2067 293
331 3300035120 Ga0373957_0071016 Ga0373957_0071016_11_892 293
332 3300035410 Ga0373924_0000771 Ga0373924_0000771_4770_5651 293
333 3300035691 Ga0373931_0254970 Ga0373931_0254970_173_1054 293
334 3300041486 Ga0451807_1644881 Ga0451807_1644881_108_989 293
335 3300046455 Ga0495603_0132855 Ga0495603_0132855_255_1136 293
336 3300046455 Ga0495603_0134946 Ga0495603_0134946_135_1016 293
337 3300046460 Ga0495638_0022806 Ga0495638_0022806_2683_3564 293
338 3300046460 Ga0495638_0150502 Ga0495638_0150502_160_1041 293
339 3300046471 Ga0495650_0078341 Ga0495650_0078341_355_1236 293
340 3300046472 Ga0495580_0107065 Ga0495580_0107065_335_1216 293
341 3300046491 Ga0495584_0031570 Ga0495584_0031570_55_936 293
342 3300046491 Ga0495584_0097107 Ga0495584_0097107_159_1040 293
343 3300046491 Ga0495584_0183454 Ga0495584_0183454_46_927 293
344 3300046492 Ga0495585_0013139 Ga0495585_0013139_3049_3930 293
345 3300046499 Ga0495594_0114388 Ga0495594_0114388_11_892 293
346 3300046499 Ga0495594_0168213 Ga0495594_0168213_325_1206 293
347 3300046501 Ga0495607_0100135 Ga0495607_0100135_186_1067 293
348 3300046512 Ga0495610_0155392 Ga0495610_0155392_78_959 293
349 3300046513 Ga0495616_0031366 Ga0495616_0031366_1460_2341 293
350 3300046514 Ga0495618_0077420 Ga0495618_0077420_168_1049 293
351 3300046524 Ga0495648_0147481 Ga0495648_0147481_182_1063 293
352 3300046526 Ga0495666_0134727 Ga0495666_0134727_230_1111 293
353 3300046536 Ga0495587_0068905 Ga0495587_0068905_281_1162 293
354 3300046537 Ga0495598_0012329 Ga0495598_0012329_925_1806 293
355 3300046558 Ga0495633_0148652 Ga0495633_0148652_55_936 293
356 3300046615 Ga0495656_0007675 Ga0495656_0007675_2724_3605 293
357 3300046615 Ga0495656_0049824 Ga0495656_0049824_533_1438 293
358 3300046616 Ga0495668_0146130 Ga0495668_0146130_371_1252 293
359 3300046648 Ga0495611_0031354 Ga0495611_0031354_167_1048 293
360 3300046660 Ga0495625_0028888 Ga0495625_0028888_459_1340 293
361 3300046663 Ga0495635_0003853 Ga0495635_0003853_6161_7042 293
362 3300046664 Ga0495659_0143569 Ga0495659_0143569_46_927 293
363 3300046684 Ga0495669_0040721 Ga0495669_0040721_533_1414 293
364 3300046684 Ga0495669_0067194 Ga0495669_0067194_629_1510 293
365 3300046689 Ga0495613_0336209 Ga0495613_0336209_35_916 293
366 3300046794 Ga0495589_0075377 Ga0495589_0075377_232_1113 293
367 3300047317 Ga0495604_0068237 Ga0495604_0068237_1607_2488 293
368 3300047319 Ga0495674_0270522 Ga0495674_0270522_48_929 293
369 3300047320 Ga0495672_0094815 Ga0495672_0094815_273_1154 293
370 3300047322 Ga0495680_0308541 Ga0495680_0308541_218_1099 293
371 3300047469 Ga0495673_0090535 Ga0495673_0090535_65_946 293
372 3300047469 Ga0495673_0098497 Ga0495673_0098497_260_1141 293
373 3300047471 Ga0495684_0004769 Ga0495684_0004769_7944_8825 293
374 3300048091 Ga0495626_0087219 Ga0495626_0087219_114_995 293
375 3300048904 Ga0496101_0257927 Ga0496101_0257927_92_973 293
376 3300048905 Ga0496102_0198732 Ga0496102_0198732_354_1235 293
377 3300048906 Ga0496103_0191004 Ga0496103_0191004_45_926 293
378 3300048907 Ga0496104_0044151 Ga0496104_0044151_1713_2594 293
379 3300048909 Ga0496106_0035274 Ga0496106_0035274_604_1485 293
380 3300048909 Ga0496106_0214802 Ga0496106_0214802_251_1156 293
381 3300048910 Ga0496107_0073581 Ga0496107_0073581_512_1393 293
382 3300048911 Ga0496108_0009248 Ga0496108_0009248_1706_2587 293
383 3300048911 Ga0496108_0049240 Ga0496108_0049240_444_1325 293
384 3300048911 Ga0496108_0271283 Ga0496108_0271283_330_1211 293
385 3300048912 Ga0496109_0034672 Ga0496109_0034672_1657_2538 293
386 3300048912 Ga0496109_0222250 Ga0496109_0222250_694_1575 293
387 3300048913 Ga0496110_0077716 Ga0496110_0077716_776_1657 293
388 3300048913 Ga0496110_0079675 Ga0496110_0079675_681_1562 293
389 3300048913 Ga0496110_0315265 Ga0496110_0315265_73_954 293
390 3300048915 Ga0496112_0086520 Ga0496112_0086520_364_1245 293
391 3300048915 Ga0496112_0496607 Ga0496112_0496607_100_981 293
392 3300048915 Ga0496112_0523756 Ga0496112_0523756_207_1088 293
393 3300048917 Ga0496114_0159103 Ga0496114_0159103_569_1474 293
394 3300048917 Ga0496114_0535202 Ga0496114_0535202_143_1024 293
395 3300048918 Ga0496115_0025922 Ga0496115_0025922_1286_2167 293
396 3300048920 Ga0496117_0097320 Ga0496117_0097320_712_1593 293
397 3300048921 Ga0496118_0043458 Ga0496118_0043458_1476_2357 293
398 3300048921 Ga0496118_0213535 Ga0496118_0213535_13_894 293
399 3300048924 Ga0496121_0008049 Ga0496121_0008049_9706_10587 293
400 3300048924 Ga0496121_0039498 Ga0496121_0039498_1586_2467 293
401 3300048924 Ga0496121_0150739 Ga0496121_0150739_690_1571 293
402 3300048927 Ga0496124_0136283 Ga0496124_0136283_382_1299 293
403 3300048928 Ga0496125_0202616 Ga0496125_0202616_334_1215 293
404 3300048929 Ga0496126_0050463 Ga0496126_0050463_657_1541 293
405 3300048929 Ga0496126_0052940 Ga0496126_0052940_1992_2873 293
406 3300048929 Ga0496126_0083814 Ga0496126_0083814_686_1567 293
407 3300048929 Ga0496126_0108216 Ga0496126_0108216_379_1296 293
408 3300048929 Ga0496126_0132141 Ga0496126_0132141_1253_2134 293
409 3300048929 Ga0496126_0234463 Ga0496126_0234463_624_1505 293
410 3300048929 Ga0496126_0375228 Ga0496126_0375228_12_893 293
411 3300049592 Ga0501076_0137271 Ga0501076_0137271_471_1352 293
412 3300050491 nmdc:mga00v17_5856_c1 nmdc:mga00v17_5856_c1_1148_2029 293
413 3300050492 nmdc:mga0yw44_41805_c1 nmdc:mga0yw44_41805_c1_880_1761 293
414 3300050494 nmdc:mga06z11_10424_c1 nmdc:mga06z11_10424_c1_2720_3601 293
415 3300050494 nmdc:mga06z11_118882_c1 nmdc:mga06z11_118882_c1_168_1049 293
416 3300050496 nmdc:mga07m45_66910_c1 nmdc:mga07m45_66910_c1_795_1676 293
417 3300050496 nmdc:mga07m45_78189_c1 nmdc:mga07m45_78189_c1_976_1857 293
418 3300050496 nmdc:mga07m45_94065_c1 nmdc:mga07m45_94065_c1_189_1070 293
419 3300050508 nmdc:mga09592_110563_c1 nmdc:mga09592_110563_c1_237_1118 293
420 3300050516 nmdc:mga0sz30_24912_c1 nmdc:mga0sz30_24912_c1_925_1806 293
421 3300053084 Ga0495595_0000520 Ga0495595_0000520_6065_6946 293
422 3300053085 Ga0495619_0416901 Ga0495619_0416901_34_915 293
423 3300053092 Ga0500583_0035176 Ga0500583_0035176_1331_2212 293
424 3300053093 Ga0500651_0071921 Ga0500651_0071921_210_1091 293
425 3300053096 Ga0500641_0076659 Ga0500641_0076659_216_1121 293
426 3300053098 Ga0500650_0074265 Ga0500650_0074265_91_972 293
427 3300053109 Ga0500569_007875 Ga0500569_007875_981_1862 293
428 3300053118 Ga0500594_0005487 Ga0500594_0005487_389_1270 293
429 3300053118 Ga0500594_0013431 Ga0500594_0013431_355_1236 293
430 3300053119 Ga0500595_003031 Ga0500595_003031_2824_3705 293
431 3300053119 Ga0500595_015856 Ga0500595_015856_1356_2237 293
432 3300053119 Ga0500595_025664 Ga0500595_025664_195_1076 293
433 3300053134 Ga0500658_0023412 Ga0500658_0023412_421_1302 293
434 3300053139 Ga0500568_0052161 Ga0500568_0052161_434_1315 293
435 3300053142 Ga0500577_0025742 Ga0500577_0025742_828_1709 293
436 3300053148 Ga0500590_041614 Ga0500590_041614_510_1391 293
437 3300053730 Ga0500645_020172 Ga0500645_020172_632_1513 293
438 iso_pu_bacteria 2889033259 2889042287 293
439 iso_pu_bacteria 8019565922 8019566420 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03450

CO_deh_flav_C

CO dehydrogenase flavoprotein C-terminal domain

184

285

0.97

PF00941

FAD_binding_5

FAD binding domain in molybdopterin dehydrogenase

4

178

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.94 1 284
1ffu-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor 0.9398 1 284
1zxi-assembly1.cif.gz_F reconstituted co dehydrogenase from oligotropha carboxidovorans 0.9334 1 284
1n5w-assembly1.cif.gz_C crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.9302 1 284
1ffv-assembly1.cif.gz_F carbon monoxide dehydrogenase from hydrogenophaga pseudoflava 0.9274 1 284
ID Description Score Start End Superfamily
1t3qF02 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9509 58 174 3.30.465.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9473 60 173 3.30.465.10
af_Q46800_56_173_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9418 58 173 3.30.465.10
1ffvC03 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9394 60 173 3.30.465.10
af_I6Y7N2_57_165_3.30.465.10 Alpha Beta;2-Layer Sandwich;Uridine Diphospho-n-acetylenolpyruvylglucosamine Reductase; domain 3; 0.9375 65 173 3.30.465.10
ID Description Score Start End GO Terms
AF-A0A1H1U904-F1-model_v4 Carbon-monoxide dehydrogenase medium subunit 0.9619 1 293 GO:0016491
GO:0071949
AF-A0A1H1U904-F1-model_v4 Carbon-monoxide dehydrogenase medium subunit 0.9587 1 293 GO:0016491
GO:0071949
AF-A0A5P9FT59-F1-model_v4 6-hydroxypseudooxynicotine dehydrogenase complex subunit alpha (EC 1.5.99.14) 0.949 1 287 GO:0034909
GO:0071949
AF-A0A535V6W6-F1-model_v4 Xanthine dehydrogenase family protein subunit M 0.9467 71 220 GO:0016491
GO:0071949
AF-A0A023XLW3-F1-model_v4 deleted 0.9461 2 283

Feature Viewer

pLDDT pTM Quality
87.2 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map