F444079

General Info

Members Datasets Scaffolds Average Seq Length
438 208 876 335

Family's Representative Sequence

Representative Sequence 3300049573|Ga0501037_0036084|Ga0501037_0036084_2485_3606
Length 373
Sequence MPATWHMAAKHRTNAALADFYLSLNFCCILYVHAETMKKLICTLGVMLALCGITIAQDPNFSQFFASPLTLNPALTGKFDGVYRVAGNYRNQWPTINNAFTTATASIDFGILKNRIPEIDQFGVGIMGFTDKSGNGVLQNNYAALSVAYHKGLDEDGLHQLGAGFQGTFVNKRLDVTKVQFEDQLTPLGFTGVTSEIFSQNQVNVKYFDLNAGILYNGSTNGYNNFYLGASLYHINHPKETFQGGQFYLPGRVTIQAGGKIPAGQYNYLHFSANYSRQANATNTVIGGAYALNVNQDENNPTNLYLGSWYRFGDAIIPYVGLEFGEFHIGATYDINISSLKPGSTMRGGAEISLIYIKKPSDPNAKKLNCPKF

Samples

Sample ID Description Type Environment
1 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
60 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
62 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
72 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
136 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
137 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
138 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
139 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
140 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
141 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
142 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
143 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
144 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
145 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
146 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
147 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
148 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
151 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
152 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
153 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
154 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
155 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
156 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
157 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
158 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
159 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
160 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
161 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
170 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
177 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
178 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
179 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
180 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
181 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
182 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
183 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
184 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
185 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
186 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
187 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
188 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
189 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
190 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
191 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
192 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
193 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
196 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
200 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
201 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
202 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
203 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
204 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
205 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
206 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
207 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
208 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.51
Nodule 0
Rhizoplane 0.23
Rhizosphere 96.12
Stem 0
Stem Tuber 0
Unclassified 17.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501037_0036084 3300049573 Bacteria 3644
2 MRS1b_contig_1954468 2162886011 Bacteria 2744
3 JGI24751J29686_10003907 3300002459 Bacteria 3011
4 rootL2_10129387 3300003322 Unclassified 2210
5 rootL2_10181006 3300003322 Bacteria 3637
6 rootL2_10259841 3300003322 Bacteria 2791
7 rootL2_10289875 3300003322 Bacteria 2382
8 Ga0065712_10001912 3300005290 Bacteria 13957
9 Ga0065712_10002959 3300005290 Bacteria 5986
10 Ga0065712_10016360 3300005290 Unclassified 2105
11 Ga0065712_10138489 3300005290 Bacteria 1473
12 Ga0065715_10001700 3300005293 Bacteria 12165
13 Ga0065707_10005547 3300005295 Bacteria 4010
14 Ga0065707_10092699 3300005295 Bacteria 3731
15 Ga0065707_10109582 3300005295 Bacteria 2464
16 Ga0070676_10002952 3300005328 Bacteria 8782
17 Ga0070676_10045846 3300005328 Bacteria 2547
18 Ga0070683_100000659 3300005329 Bacteria 24948
19 Ga0070683_100014987 3300005329 Bacteria 6800
20 Ga0070683_100411962 3300005329 Bacteria 1289
21 Ga0070690_100050853 3300005330 Unclassified 2644
22 Ga0070670_100032746 3300005331 Bacteria 4478
23 Ga0070670_100039493 3300005331 Bacteria 4058
24 Ga0070670_100158037 3300005331 Bacteria 1964
25 Ga0068869_100019822 3300005334 Bacteria 4604
26 Ga0068869_100035128 3300005334 Bacteria 3551
27 Ga0068869_100049569 3300005334 Unclassified 3040
28 Ga0068869_100053424 3300005334 Bacteria 2937
29 Ga0068869_100157218 3300005334 Bacteria 1767
30 Ga0068869_100191123 3300005334 Unclassified 1610
31 Ga0068869_100234172 3300005334 Bacteria 1460
32 Ga0070666_10002946 3300005335 Bacteria 10304
33 Ga0070666_10051457 3300005335 Unclassified 2774
34 Ga0068868_100014762 3300005338 Bacteria 5764
35 Ga0068868_100103682 3300005338 Unclassified 2304
36 Ga0068868_100505184 3300005338 Bacteria 1059
37 Ga0070689_100012950 3300005340 Bacteria 6024
38 Ga0070689_100077183 3300005340 Unclassified 2611
39 Ga0070689_100120093 3300005340 Bacteria 2099
40 Ga0070687_100052324 3300005343 Bacteria 2119
41 Ga0070661_100009156 3300005344 Bacteria 6843
42 Ga0070661_100048357 3300005344 Unclassified 3113
43 Ga0070668_100007961 3300005347 Bacteria 7871
44 Ga0070668_100066326 3300005347 Bacteria 2801
45 Ga0070668_100112289 3300005347 Unclassified 2170
46 Ga0070669_100007407 3300005353 Bacteria 7863
47 Ga0070669_100029165 3300005353 Bacteria 3976
48 Ga0070669_100192177 3300005353 Bacteria 1602
49 Ga0070675_100015948 3300005354 Bacteria 5952
50 Ga0070675_100016216 3300005354 Bacteria 5911
51 Ga0070675_100261351 3300005354 Bacteria 1517
52 Ga0070675_100359267 3300005354 Bacteria 1293
53 Ga0070671_100063802 3300005355 Unclassified 3068
54 Ga0070671_100123683 3300005355 Bacteria 2178
55 Ga0070671_100259987 3300005355 Bacteria 1475
56 Ga0070673_100006567 3300005364 Bacteria 7569
57 Ga0070673_100007751 3300005364 Bacteria 7105
58 Ga0070673_100016521 3300005364 Bacteria 5222
59 Ga0070673_100020236 3300005364 Bacteria 4796
60 Ga0070673_100063347 3300005364 Unclassified 2942
61 Ga0070673_100143336 3300005364 Bacteria 2017
62 Ga0070688_100009006 3300005365 Bacteria 5441
63 Ga0070688_100010769 3300005365 Bacteria 5054
64 Ga0070688_100032610 3300005365 Unclassified 3142
65 Ga0070688_100053192 3300005365 Bacteria 2532
66 Ga0070688_100097286 3300005365 Bacteria 1934
67 Ga0070688_100126732 3300005365 Bacteria 1717
68 Ga0070659_100005524 3300005366 Bacteria 9084
69 Ga0070659_100048868 3300005366 Bacteria 3324
70 Ga0070667_100045677 3300005367 Bacteria 3683
71 Ga0070667_100093759 3300005367 Bacteria 2586
72 Ga0070667_100127015 3300005367 Unclassified 2223
73 Ga0070667_100206089 3300005367 Bacteria 1746
74 Ga0070667_100237615 3300005367 Unclassified 1626
75 Ga0070667_100418734 3300005367 Unclassified 1221
76 Ga0070701_10036886 3300005438 Bacteria 2465
77 Ga0070701_10056912 3300005438 Bacteria 2048
78 Ga0070701_10133248 3300005438 Bacteria 1414
79 Ga0070700_100128123 3300005441 Unclassified 1709
80 Ga0070678_100019675 3300005456 Bacteria 4409
81 Ga0070678_100020256 3300005456 Bacteria 4360
82 Ga0070662_100012743 3300005457 Bacteria 5581
83 Ga0068867_100010592 3300005459 Bacteria 6507
84 Ga0068867_100203751 3300005459 Bacteria 1585
85 Ga0068867_100205730 3300005459 Bacteria 1578
86 Ga0070685_10017106 3300005466 Unclassified 3876
87 Ga0070685_10118104 3300005466 Bacteria 1643
88 Ga0070698_100005145 3300005471 Bacteria 14305
89 Ga0070698_100005739 3300005471 Bacteria 13570
90 Ga0070698_100101182 3300005471 Bacteria 2853
91 Ga0070684_100001403 3300005535 Bacteria 17339
92 Ga0070684_100003737 3300005535 Bacteria 11481
93 Ga0070684_100506690 3300005535 Bacteria 1118
94 Ga0068853_100004545 3300005539 Bacteria 10768
95 Ga0068853_100016660 3300005539 Bacteria 6052
96 Ga0070686_100093849 3300005544 Bacteria 2013
97 Ga0070693_100201074 3300005547 Bacteria 1294
98 Ga0070665_100032646 3300005548 Bacteria 5239
99 Ga0070665_100436511 3300005548 Bacteria 1319
100 Ga0070664_100000140 3300005564 Bacteria 49126
101 Ga0070664_100046706 3300005564 Unclassified 3658
102 Ga0068857_100021957 3300005577 Bacteria 5617
103 Ga0068857_100053671 3300005577 Bacteria 3575
104 Ga0068854_100057440 3300005578 Bacteria 2807
105 Ga0068854_100090509 3300005578 Bacteria 2275
106 Ga0070702_100019765 3300005615 Bacteria 3520
107 Ga0068852_100000999 3300005616 Bacteria 18658
108 Ga0068852_100143997 3300005616 Bacteria 2209
109 Ga0068852_100385524 3300005616 Unclassified 1376
110 Ga0068852_100453649 3300005616 Bacteria 1270
111 Ga0068859_100003537 3300005617 Bacteria 15905
112 Ga0068859_100021050 3300005617 Bacteria 6545
113 Ga0068859_100050235 3300005617 Bacteria 4189
114 Ga0068859_100105943 3300005617 Unclassified 2871
115 Ga0068859_100107103 3300005617 Unclassified 2855
116 Ga0068859_100123691 3300005617 Bacteria 2654
117 Ga0068859_100156640 3300005617 Unclassified 2355
118 Ga0068864_100013799 3300005618 Bacteria 6697
119 Ga0068864_100017006 3300005618 Bacteria 6060
120 Ga0068864_100150762 3300005618 Unclassified 2106
121 Ga0068864_100162621 3300005618 Unclassified 2030
122 Ga0068861_100008249 3300005719 Bacteria 7167
123 Ga0068861_100039758 3300005719 Bacteria 3513
124 Ga0068861_100050167 3300005719 Unclassified 3163
125 Ga0068861_100090584 3300005719 Bacteria 2413
126 Ga0068870_10001668 3300005840 Bacteria 9086
127 Ga0068870_10010587 3300005840 Bacteria 4243
128 Ga0068870_10086103 3300005840 Bacteria 1748
129 Ga0068870_10170155 3300005840 Bacteria 1300
130 Ga0068863_100073421 3300005841 Bacteria 3236
131 Ga0068863_100155256 3300005841 Bacteria 2191
132 Ga0068858_100017339 3300005842 Bacteria 6754
133 Ga0068858_100062769 3300005842 Unclassified 3436
134 Ga0068858_100106913 3300005842 Bacteria 2611
135 Ga0068858_100125180 3300005842 Unclassified 2406
136 Ga0068858_100155467 3300005842 Bacteria 2152
137 Ga0068860_100019749 3300005843 Bacteria 6533
138 Ga0068860_100028131 3300005843 Bacteria 5412
139 Ga0068862_100023025 3300005844 Bacteria 5217
140 Ga0068862_100030935 3300005844 Bacteria 4513
141 Ga0068862_100053154 3300005844 Bacteria 3467
142 Ga0081539_10012863 3300005985 Bacteria 6379
143 Ga0075366_10003693 3300006195 Bacteria 8121
144 Ga0075366_10014957 3300006195 Bacteria 4437
145 Ga0075366_10133239 3300006195 Bacteria 1500
146 Ga0097621_100013072 3300006237 Bacteria 6173
147 Ga0097621_100062601 3300006237 Unclassified 3055
148 Ga0097621_100071075 3300006237 Bacteria 2875
149 Ga0068871_100007280 3300006358 Bacteria 7894
150 Ga0068871_100392575 3300006358 Bacteria 1234
151 Ga0075428_100006664 3300006844 Bacteria 12848
152 Ga0075428_100367510 3300006844 Unclassified 1543
153 Ga0075430_100047594 3300006846 Bacteria 3621
154 Ga0068865_100019225 3300006881 Bacteria 4420
155 Ga0068865_100274794 3300006881 Bacteria 1339
156 Ga0097620_100003537 3300006931 Bacteria 15905
157 Ga0097620_100021048 3300006931 Bacteria 6545
158 Ga0097620_100050240 3300006931 Bacteria 4189
159 Ga0097620_100105940 3300006931 Unclassified 2871
160 Ga0097620_100107108 3300006931 Unclassified 2855
161 Ga0097620_100123684 3300006931 Bacteria 2654
162 Ga0097620_100156639 3300006931 Unclassified 2355
163 Ga0105251_10099106 3300009011 Bacteria 1333
164 Ga0111539_10011540 3300009094 Bacteria 11086
165 Ga0111539_10479883 3300009094 Bacteria 1448
166 Ga0105247_10000918 3300009101 Bacteria 22128
167 Ga0114129_10295206 3300009147 Bacteria 2162
168 Ga0105243_10287605 3300009148 Unclassified 1484
169 Ga0105241_10232383 3300009174 Unclassified 1555
170 Ga0105241_10276834 3300009174 Bacteria 1432
171 Ga0105242_10002571 3300009176 Bacteria 14204
172 Ga0105242_10020673 3300009176 Bacteria 5164
173 Ga0105242_10252278 3300009176 Bacteria 1590
174 Ga0105248_10112484 3300009177 Unclassified 3070
175 Ga0105249_10016984 3300009553 Bacteria 6456
176 Ga0105249_10018030 3300009553 Bacteria 6275
177 Ga0105249_10048592 3300009553 Bacteria 3867
178 Ga0105249_10059227 3300009553 Bacteria 3512
179 Ga0105249_10333991 3300009553 Bacteria 1530
180 Ga0105249_10465139 3300009553 Bacteria 1305
181 Ga0105246_10021942 3300011119 Bacteria 4116
182 Ga0105246_10054873 3300011119 Bacteria 2748
183 Ga0105246_10158532 3300011119 Unclassified 1721
184 Ga0157373_10037549 3300013100 Unclassified 3472
185 Ga0157371_10018874 3300013102 Bacteria 5094
186 Ga0157371_10247364 3300013102 Bacteria 1283
187 Ga0157369_10141569 3300013105 Unclassified 2545
188 Ga0157369_10226595 3300013105 Unclassified 1955
189 Ga0157374_10012937 3300013296 Bacteria 7272
190 Ga0157374_10019229 3300013296 Bacteria 6044
191 Ga0157374_10029637 3300013296 Bacteria 4959
192 Ga0157374_10142976 3300013296 Bacteria 2323
193 Ga0157378_10010126 3300013297 Bacteria 8222
194 Ga0157378_10058058 3300013297 Bacteria 3451
195 Ga0163162_10004131 3300013306 Bacteria 13940
196 Ga0163162_10046467 3300013306 Unclassified 4352
197 Ga0163162_10049184 3300013306 Bacteria 4225
198 Ga0163162_10172910 3300013306 Bacteria 2285
199 Ga0163162_10172919 3300013306 Unclassified 2285
200 Ga0157372_10004629 3300013307 Bacteria 14625
201 Ga0157372_10039631 3300013307 Bacteria 5200
202 Ga0157372_10087732 3300013307 Unclassified 3530
203 Ga0157375_10043952 3300013308 Bacteria 4335
204 Ga0157375_10116570 3300013308 Bacteria 2775
205 Ga0157375_10181851 3300013308 Bacteria 2254
206 Ga0163163_10000088 3300014325 Bacteria 101126
207 Ga0163163_10024136 3300014325 Bacteria 5785
208 Ga0163163_10048144 3300014325 Bacteria 4191
209 Ga0163163_10345013 3300014325 Bacteria 1545
210 Ga0157380_10007617 3300014326 Bacteria 7696
211 Ga0157380_10029165 3300014326 Bacteria 4216
212 Ga0157380_10124669 3300014326 Bacteria 2187
213 Ga0157380_10257796 3300014326 Bacteria 1582
214 Ga0157377_10004326 3300014745 Bacteria 6522
215 Ga0157377_10012000 3300014745 Bacteria 4345
216 Ga0157377_10014162 3300014745 Bacteria 4053
217 Ga0157377_10239306 3300014745 Bacteria 1171
218 Ga0157379_10013554 3300014968 Bacteria 7144
219 Ga0157379_10221294 3300014968 Unclassified 1715
220 Ga0157379_10418711 3300014968 Bacteria 1233
221 Ga0157376_10029340 3300014969 Bacteria 4381
222 Ga0157376_10121654 3300014969 Bacteria 2314
223 Ga0157376_10141024 3300014969 Unclassified 2162
224 Ga0163161_10003749 3300017792 Bacteria 10646
225 Ga0207697_10102021 3300025315 Bacteria 1223
226 Ga0207682_10044965 3300025893 Unclassified 1811
227 Ga0207682_10073216 3300025893 Unclassified 1455
228 Ga0207642_10025259 3300025899 Unclassified 2400
229 Ga0207688_10002010 3300025901 Bacteria 10907
230 Ga0207688_10221544 3300025901 Bacteria 1140
231 Ga0207647_10000088 3300025904 Bacteria 70267
232 Ga0207647_10074707 3300025904 Unclassified 2041
233 Ga0207645_10002924 3300025907 Bacteria 13200
234 Ga0207645_10003880 3300025907 Bacteria 11181
235 Ga0207645_10016615 3300025907 Bacteria 4869
236 Ga0207645_10024687 3300025907 Bacteria 3893
237 Ga0207645_10096701 3300025907 Bacteria 1903
238 Ga0207643_10006094 3300025908 Bacteria 6446
239 Ga0207643_10016407 3300025908 Bacteria 4041
240 Ga0207643_10021280 3300025908 Bacteria 3561
241 Ga0207643_10036847 3300025908 Unclassified 2744
242 Ga0207654_10180598 3300025911 Unclassified 1377
243 Ga0207649_10244684 3300025920 Bacteria 1289
244 Ga0207681_10008119 3300025923 Bacteria 6423
245 Ga0207681_10012421 3300025923 Bacteria 5257
246 Ga0207681_10204998 3300025923 Bacteria 1516
247 Ga0207681_10235590 3300025923 Bacteria 1423
248 Ga0207650_10016031 3300025925 Bacteria 5228
249 Ga0207650_10018943 3300025925 Bacteria 4836
250 Ga0207650_10205190 3300025925 Bacteria 1581
251 Ga0207659_10020002 3300025926 Bacteria 4417
252 Ga0207659_10303751 3300025926 Bacteria 1311
253 Ga0207690_10005852 3300025932 Bacteria 7276
254 Ga0207690_10051840 3300025932 Bacteria 2746
255 Ga0207706_10012549 3300025933 Bacteria 7716
256 Ga0207706_10075734 3300025933 Unclassified 2960
257 Ga0207686_10011930 3300025934 Bacteria 4769
258 Ga0207709_10193393 3300025935 Bacteria 1447
259 Ga0207670_10072521 3300025936 Bacteria 2384
260 Ga0207670_10283513 3300025936 Bacteria 1292
261 Ga0207669_10019567 3300025937 Bacteria 3528
262 Ga0207669_10221823 3300025937 Bacteria 1388
263 Ga0207704_10068911 3300025938 Bacteria 2232
264 Ga0207704_10097105 3300025938 Unclassified 1953
265 Ga0207691_10010574 3300025940 Bacteria 8851
266 Ga0207691_10035545 3300025940 Bacteria 4623
267 Ga0207689_10001010 3300025942 Bacteria 27038
268 Ga0207689_10006093 3300025942 Bacteria 10665
269 Ga0207689_10007281 3300025942 Bacteria 9713
270 Ga0207689_10011219 3300025942 Bacteria 7689
271 Ga0207689_10012935 3300025942 Bacteria 7125
272 Ga0207689_10016209 3300025942 Bacteria 6312
273 Ga0207689_10024356 3300025942 Bacteria 5079
274 Ga0207689_10030376 3300025942 Bacteria 4503
275 Ga0207689_10045990 3300025942 Bacteria 3609
276 Ga0207689_10167972 3300025942 Unclassified 1807
277 Ga0207689_10401976 3300025942 Bacteria 1142
278 Ga0207661_10057427 3300025944 Unclassified 3129
279 Ga0207661_10402759 3300025944 Bacteria 1241
280 Ga0207679_10001022 3300025945 Bacteria 17875
281 Ga0207679_10011099 3300025945 Bacteria 5817
282 Ga0207679_10080698 3300025945 Bacteria 2484
283 Ga0207651_10023894 3300025960 Bacteria 3769
284 Ga0207651_10037836 3300025960 Unclassified 3164
285 Ga0207651_10047744 3300025960 Bacteria 2889
286 Ga0207651_10099712 3300025960 Bacteria 2152
287 Ga0207712_10007675 3300025961 Bacteria 6822
288 Ga0207712_10023821 3300025961 Bacteria 4046
289 Ga0207712_10366926 3300025961 Bacteria 1201
290 Ga0207668_10008706 3300025972 Bacteria 6063
291 Ga0207668_10117733 3300025972 Unclassified 2006
292 Ga0207658_10017276 3300025986 Bacteria 4970
293 Ga0207658_10050997 3300025986 Unclassified 3048
294 Ga0207658_10201239 3300025986 Bacteria 1663
295 Ga0207677_10024432 3300026023 Bacteria 3755
296 Ga0207677_10054179 3300026023 Unclassified 2735
297 Ga0207677_10277518 3300026023 Unclassified 1374
298 Ga0207703_10091559 3300026035 Bacteria 2558
299 Ga0207703_10158786 3300026035 Unclassified 1979
300 Ga0207639_10034590 3300026041 Bacteria 3735
301 Ga0207678_10078238 3300026067 Bacteria 2832
302 Ga0207678_10380771 3300026067 Bacteria 1220
303 Ga0207708_10297722 3300026075 Bacteria 1311
304 Ga0207641_10000416 3300026088 Bacteria 49757
305 Ga0207641_10029335 3300026088 Unclassified 4548
306 Ga0207648_10001709 3300026089 Bacteria 24030
307 Ga0207648_10025200 3300026089 Bacteria 5302
308 Ga0207648_10062661 3300026089 Unclassified 3241
309 Ga0207648_10112573 3300026089 Unclassified 2390
310 Ga0207648_10135663 3300026089 Unclassified 2168
311 Ga0207648_10236786 3300026089 Bacteria 1625
312 Ga0207676_10005115 3300026095 Bacteria 9285
313 Ga0207676_10006355 3300026095 Bacteria 8347
314 Ga0207676_10077769 3300026095 Unclassified 2685
315 Ga0207674_10002088 3300026116 Bacteria 25283
316 Ga0207674_10005225 3300026116 Bacteria 15451
317 Ga0207674_10090331 3300026116 Bacteria 3054
318 Ga0207675_100005095 3300026118 Bacteria 12643
319 Ga0207675_100007992 3300026118 Bacteria 9967
320 Ga0207675_100009634 3300026118 Bacteria 9040
321 Ga0207675_100030648 3300026118 Bacteria 5010
322 Ga0207675_100170440 3300026118 Bacteria 2080
323 Ga0207675_100275778 3300026118 Bacteria 1633
324 Ga0207683_10000974 3300026121 Bacteria 26229
325 Ga0207683_10007830 3300026121 Bacteria 9145
326 Ga0207683_10306949 3300026121 Bacteria 1452
327 Ga0207698_10001607 3300026142 Bacteria 13152
328 Ga0207698_10272960 3300026142 Bacteria 1560
329 Ga0207428_10112757 3300027907 Bacteria 2091
330 Ga0268265_10020739 3300028380 Bacteria 4592
331 Ga0268265_10025732 3300028380 Bacteria 4181
332 Ga0268265_10094979 3300028380 Bacteria 2393
333 Ga0268265_10291556 3300028380 Bacteria 1465
334 Ga0268264_10020977 3300028381 Bacteria 5338
335 Ga0268264_10024082 3300028381 Bacteria 4968
336 Ga0268264_10109175 3300028381 Unclassified 2420
337 Ga0268264_10126560 3300028381 Unclassified 2259
338 Ga0265327_10000117 3300031251 Bacteria 173075
339 Ga0265313_10035831 3300031595 Bacteria 2495
340 Ga0307405_10043733 3300031731 Bacteria 2735
341 Ga0307410_10053955 3300031852 Bacteria 2722
342 Ga0307414_10134392 3300032004 Bacteria 1926
343 Ga0373923_0023938 3300035111 Bacteria 2407
344 Ga0373955_0002985 3300035172 Bacteria 7415
345 Ga0373937_0010206 3300036401 Bacteria 8196
346 Ga0373937_0119669 3300036401 Bacteria 2454
347 Ga0395900_0110709 3300037418 Bacteria 2821
348 Ga0395905_0000880 3300037471 Bacteria 39152
349 Ga0395905_0066225 3300037471 Bacteria 3383
350 Ga0439453_0029018 3300041408 Unclassified 1039
351 Ga0451807_2368817 3300041486 Bacteria 1086
352 Ga0439433_0005870 3300041999 Bacteria 2638
353 Ga0439441_004204 3300042001 Bacteria 2167
354 Ga0439443_004378 3300042003 Bacteria 1837
355 Ga0439457_038561 3300042014 Bacteria 1063
356 Ga0450898_001047 3300042134 Bacteria 3506
357 Ga0453684_0188039 3300044712 Bacteria 2418
358 Ga0495653_0045247 3300046463 Bacteria 3413
359 Ga0495662_0134393 3300046476 Bacteria 1217
360 Ga0495628_0008008 3300046516 Bacteria 9106
361 Ga0495643_0020734 3300046522 Bacteria 3783
362 Ga0495587_0006727 3300046536 Bacteria 7486
363 Ga0495621_0082135 3300046539 Unclassified 1203
364 Ga0495622_0080780 3300046557 Bacteria 1496
365 Ga0495667_0161500 3300046559 Bacteria 1441
366 Ga0495668_0008836 3300046616 Bacteria 6243
367 Ga0495634_0014132 3300046642 Bacteria 5764
368 Ga0495635_0100142 3300046663 Bacteria 1981
369 Ga0495658_0148352 3300046683 Unclassified 1439
370 Ga0495600_0023886 3300046809 Bacteria 3934
371 Ga0495672_0002547 3300047320 Bacteria 16619
372 Ga0495680_0062961 3300047322 Unclassified 2850
373 Ga0495684_0062929 3300047471 Bacteria 2822
374 Ga0495686_0006208 3300047472 Bacteria 9214
375 Ga0501298_004839 3300049521 Bacteria 2141
376 Ga0501032_0001404 3300049569 Bacteria 19156
377 Ga0501032_0308364 3300049569 Bacteria 1022
378 Ga0501034_0004933 3300049571 Bacteria 14687
379 Ga0501034_0007014 3300049571 Bacteria 12029
380 Ga0501036_0001169 3300049572 Bacteria 19962
381 Ga0501036_0120599 3300049572 Bacteria 2215
382 Ga0501037_0042210 3300049573 Bacteria 3353
383 Ga0501038_0005473 3300049574 Bacteria 11793
384 Ga0501038_0056218 3300049574 Bacteria 3379
385 Ga0501039_0019441 3300049575 Bacteria 5207
386 Ga0501043_0003535 3300049579 Bacteria 12843
387 Ga0501043_0147019 3300049579 Bacteria 1845
388 Ga0501046_0004169 3300049580 Bacteria 13164
389 Ga0501047_0012534 3300049581 Bacteria 8028
390 Ga0501047_0122900 3300049581 Bacteria 2477
391 Ga0501047_0147639 3300049581 Bacteria 2228
392 Ga0501048_0028676 3300049582 Bacteria 4041
393 Ga0501067_0010354 3300049583 Bacteria 5160
394 Ga0501068_0004384 3300049584 Bacteria 7681
395 Ga0501070_0016449 3300049586 Bacteria 6216
396 Ga0501072_0059589 3300049588 Bacteria 3010
397 Ga0501073_0000839 3300049589 Bacteria 21859
398 Ga0501074_0002773 3300049590 Bacteria 12257
399 Ga0501201_004459 3300049651 Bacteria 1297
400 Ga0501202_000359 3300049652 Bacteria 6357
401 Ga0501202_003348 3300049652 Bacteria 2740
402 Ga0501217_000190 3300049661 Bacteria 9148
403 Ga0501217_006657 3300049661 Bacteria 2462
404 Ga0501222_000546 3300049662 Bacteria 5580
405 Ga0501223_001006 3300049663 Bacteria 6666
406 Ga0501233_005667 3300049668 Bacteria 2321
407 Ga0501242_003418 3300049674 Unclassified 1717
408 Ga0501243_000816 3300049675 Bacteria 4329
409 Ga0501257_024182 3300049686 Unclassified 1442
410 Ga0501261_001267 3300049690 Bacteria 3101
411 Ga0501221_000013 3300049704 Bacteria 22152
412 Ga0501225_0003389 3300049705 Bacteria 4841
413 Ga0501234_000394 3300049707 Bacteria 6465
414 Ga0501079_0019429 3300049741 Bacteria 5190
415 Ga0501080_0016299 3300049742 Bacteria 6860
416 Ga0501080_0020994 3300049742 Bacteria 6044
417 Ga0501083_0003883 3300049744 Bacteria 10494
418 Ga0501266_000162 3300049763 Bacteria 8591
419 Ga0501035_0006639 3300049822 Bacteria 10827
420 Ga0501035_0150406 3300049822 Bacteria 2021
421 Ga0501044_0004241 3300049823 Bacteria 16092
422 Ga0501044_0013960 3300049823 Bacteria 8677
423 Ga0501044_0093319 3300049823 Bacteria 3035
424 Ga0501212_000331 3300049851 Bacteria 4411
425 nmdc:mga0k408_30873_c1 3300050493 Bacteria 3057
426 nmdc:mga09592_54620_c1 3300050508 Bacteria 3375
427 nmdc:mga0qj67_41337_c1 3300050509 Bacteria 3626
428 nmdc:mga08y16_321866_c1 3300050511 Unclassified 1592
429 nmdc:mga08y16_42411_c1 3300050511 Bacteria 4766
430 Ga0500644_0005900 3300053088 Unclassified 3112
431 Ga0500646_0008586 3300053090 Bacteria 2615
432 Ga0500562_000042 3300053108 Bacteria 67284
433 Ga0500616_0053177 3300053153 Bacteria 2126
434 Ga0500622_0000814 3300053156 Bacteria 26673
435 Ga0500611_000004 3300053727 Bacteria 253326
436 Ga0500645_006940 3300053730 Bacteria 3992
437 Ga0501084_0196451 3300054114 Bacteria 1702
438 2929157142 2929154850 Bacteria 6753285
439 Ga0501037_0036084
440 MRS1b_contig_1954468
441 JGI24751J29686_10003907
442 rootL2_10129387
443 rootL2_10181006
444 rootL2_10259841
445 rootL2_10289875
446 Ga0065712_10001912
447 Ga0065712_10002959
448 Ga0065712_10016360
449 Ga0065712_10138489
450 Ga0065715_10001700
451 Ga0065707_10005547
452 Ga0065707_10092699
453 Ga0065707_10109582
454 Ga0070676_10002952
455 Ga0070676_10045846
456 Ga0070683_100000659
457 Ga0070683_100014987
458 Ga0070683_100411962
459 Ga0070690_100050853
460 Ga0070670_100032746
461 Ga0070670_100039493
462 Ga0070670_100158037
463 Ga0068869_100019822
464 Ga0068869_100035128
465 Ga0068869_100049569
466 Ga0068869_100053424
467 Ga0068869_100157218
468 Ga0068869_100191123
469 Ga0068869_100234172
470 Ga0070666_10002946
471 Ga0070666_10051457
472 Ga0068868_100014762
473 Ga0068868_100103682
474 Ga0068868_100505184
475 Ga0070689_100012950
476 Ga0070689_100077183
477 Ga0070689_100120093
478 Ga0070687_100052324
479 Ga0070661_100009156
480 Ga0070661_100048357
481 Ga0070668_100007961
482 Ga0070668_100066326
483 Ga0070668_100112289
484 Ga0070669_100007407
485 Ga0070669_100029165
486 Ga0070669_100192177
487 Ga0070675_100015948
488 Ga0070675_100016216
489 Ga0070675_100261351
490 Ga0070675_100359267
491 Ga0070671_100063802
492 Ga0070671_100123683
493 Ga0070671_100259987
494 Ga0070673_100006567
495 Ga0070673_100007751
496 Ga0070673_100016521
497 Ga0070673_100020236
498 Ga0070673_100063347
499 Ga0070673_100143336
500 Ga0070688_100009006
501 Ga0070688_100010769
502 Ga0070688_100032610
503 Ga0070688_100053192
504 Ga0070688_100097286
505 Ga0070688_100126732
506 Ga0070659_100005524
507 Ga0070659_100048868
508 Ga0070667_100045677
509 Ga0070667_100093759
510 Ga0070667_100127015
511 Ga0070667_100206089
512 Ga0070667_100237615
513 Ga0070667_100418734
514 Ga0070701_10036886
515 Ga0070701_10056912
516 Ga0070701_10133248
517 Ga0070700_100128123
518 Ga0070678_100019675
519 Ga0070678_100020256
520 Ga0070662_100012743
521 Ga0068867_100010592
522 Ga0068867_100203751
523 Ga0068867_100205730
524 Ga0070685_10017106
525 Ga0070685_10118104
526 Ga0070698_100005145
527 Ga0070698_100005739
528 Ga0070698_100101182
529 Ga0070684_100001403
530 Ga0070684_100003737
531 Ga0070684_100506690
532 Ga0068853_100004545
533 Ga0068853_100016660
534 Ga0070686_100093849
535 Ga0070693_100201074
536 Ga0070665_100032646
537 Ga0070665_100436511
538 Ga0070664_100000140
539 Ga0070664_100046706
540 Ga0068857_100021957
541 Ga0068857_100053671
542 Ga0068854_100057440
543 Ga0068854_100090509
544 Ga0070702_100019765
545 Ga0068852_100000999
546 Ga0068852_100143997
547 Ga0068852_100385524
548 Ga0068852_100453649
549 Ga0068859_100003537
550 Ga0068859_100021050
551 Ga0068859_100050235
552 Ga0068859_100105943
553 Ga0068859_100107103
554 Ga0068859_100123691
555 Ga0068859_100156640
556 Ga0068864_100013799
557 Ga0068864_100017006
558 Ga0068864_100150762
559 Ga0068864_100162621
560 Ga0068861_100008249
561 Ga0068861_100039758
562 Ga0068861_100050167
563 Ga0068861_100090584
564 Ga0068870_10001668
565 Ga0068870_10010587
566 Ga0068870_10086103
567 Ga0068870_10170155
568 Ga0068863_100073421
569 Ga0068863_100155256
570 Ga0068858_100017339
571 Ga0068858_100062769
572 Ga0068858_100106913
573 Ga0068858_100125180
574 Ga0068858_100155467
575 Ga0068860_100019749
576 Ga0068860_100028131
577 Ga0068862_100023025
578 Ga0068862_100030935
579 Ga0068862_100053154
580 Ga0081539_10012863
581 Ga0075366_10003693
582 Ga0075366_10014957
583 Ga0075366_10133239
584 Ga0097621_100013072
585 Ga0097621_100062601
586 Ga0097621_100071075
587 Ga0068871_100007280
588 Ga0068871_100392575
589 Ga0075428_100006664
590 Ga0075428_100367510
591 Ga0075430_100047594
592 Ga0068865_100019225
593 Ga0068865_100274794
594 Ga0097620_100003537
595 Ga0097620_100021048
596 Ga0097620_100050240
597 Ga0097620_100105940
598 Ga0097620_100107108
599 Ga0097620_100123684
600 Ga0097620_100156639
601 Ga0105251_10099106
602 Ga0111539_10011540
603 Ga0111539_10479883
604 Ga0105247_10000918
605 Ga0114129_10295206
606 Ga0105243_10287605
607 Ga0105241_10232383
608 Ga0105241_10276834
609 Ga0105242_10002571
610 Ga0105242_10020673
611 Ga0105242_10252278
612 Ga0105248_10112484
613 Ga0105249_10016984
614 Ga0105249_10018030
615 Ga0105249_10048592
616 Ga0105249_10059227
617 Ga0105249_10333991
618 Ga0105249_10465139
619 Ga0105246_10021942
620 Ga0105246_10054873
621 Ga0105246_10158532
622 Ga0157373_10037549
623 Ga0157371_10018874
624 Ga0157371_10247364
625 Ga0157369_10141569
626 Ga0157369_10226595
627 Ga0157374_10012937
628 Ga0157374_10019229
629 Ga0157374_10029637
630 Ga0157374_10142976
631 Ga0157378_10010126
632 Ga0157378_10058058
633 Ga0163162_10004131
634 Ga0163162_10046467
635 Ga0163162_10049184
636 Ga0163162_10172910
637 Ga0163162_10172919
638 Ga0157372_10004629
639 Ga0157372_10039631
640 Ga0157372_10087732
641 Ga0157375_10043952
642 Ga0157375_10116570
643 Ga0157375_10181851
644 Ga0163163_10000088
645 Ga0163163_10024136
646 Ga0163163_10048144
647 Ga0163163_10345013
648 Ga0157380_10007617
649 Ga0157380_10029165
650 Ga0157380_10124669
651 Ga0157380_10257796
652 Ga0157377_10004326
653 Ga0157377_10012000
654 Ga0157377_10014162
655 Ga0157377_10239306
656 Ga0157379_10013554
657 Ga0157379_10221294
658 Ga0157379_10418711
659 Ga0157376_10029340
660 Ga0157376_10121654
661 Ga0157376_10141024
662 Ga0163161_10003749
663 Ga0207697_10102021
664 Ga0207682_10044965
665 Ga0207682_10073216
666 Ga0207642_10025259
667 Ga0207688_10002010
668 Ga0207688_10221544
669 Ga0207647_10000088
670 Ga0207647_10074707
671 Ga0207645_10002924
672 Ga0207645_10003880
673 Ga0207645_10016615
674 Ga0207645_10024687
675 Ga0207645_10096701
676 Ga0207643_10006094
677 Ga0207643_10016407
678 Ga0207643_10021280
679 Ga0207643_10036847
680 Ga0207654_10180598
681 Ga0207649_10244684
682 Ga0207681_10008119
683 Ga0207681_10012421
684 Ga0207681_10204998
685 Ga0207681_10235590
686 Ga0207650_10016031
687 Ga0207650_10018943
688 Ga0207650_10205190
689 Ga0207659_10020002
690 Ga0207659_10303751
691 Ga0207690_10005852
692 Ga0207690_10051840
693 Ga0207706_10012549
694 Ga0207706_10075734
695 Ga0207686_10011930
696 Ga0207709_10193393
697 Ga0207670_10072521
698 Ga0207670_10283513
699 Ga0207669_10019567
700 Ga0207669_10221823
701 Ga0207704_10068911
702 Ga0207704_10097105
703 Ga0207691_10010574
704 Ga0207691_10035545
705 Ga0207689_10001010
706 Ga0207689_10006093
707 Ga0207689_10007281
708 Ga0207689_10011219
709 Ga0207689_10012935
710 Ga0207689_10016209
711 Ga0207689_10024356
712 Ga0207689_10030376
713 Ga0207689_10045990
714 Ga0207689_10167972
715 Ga0207689_10401976
716 Ga0207661_10057427
717 Ga0207661_10402759
718 Ga0207679_10001022
719 Ga0207679_10011099
720 Ga0207679_10080698
721 Ga0207651_10023894
722 Ga0207651_10037836
723 Ga0207651_10047744
724 Ga0207651_10099712
725 Ga0207712_10007675
726 Ga0207712_10023821
727 Ga0207712_10366926
728 Ga0207668_10008706
729 Ga0207668_10117733
730 Ga0207658_10017276
731 Ga0207658_10050997
732 Ga0207658_10201239
733 Ga0207677_10024432
734 Ga0207677_10054179
735 Ga0207677_10277518
736 Ga0207703_10091559
737 Ga0207703_10158786
738 Ga0207639_10034590
739 Ga0207678_10078238
740 Ga0207678_10380771
741 Ga0207708_10297722
742 Ga0207641_10000416
743 Ga0207641_10029335
744 Ga0207648_10001709
745 Ga0207648_10025200
746 Ga0207648_10062661
747 Ga0207648_10112573
748 Ga0207648_10135663
749 Ga0207648_10236786
750 Ga0207676_10005115
751 Ga0207676_10006355
752 Ga0207676_10077769
753 Ga0207674_10002088
754 Ga0207674_10005225
755 Ga0207674_10090331
756 Ga0207675_100005095
757 Ga0207675_100007992
758 Ga0207675_100009634
759 Ga0207675_100030648
760 Ga0207675_100170440
761 Ga0207675_100275778
762 Ga0207683_10000974
763 Ga0207683_10007830
764 Ga0207683_10306949
765 Ga0207698_10001607
766 Ga0207698_10272960
767 Ga0207428_10112757
768 Ga0268265_10020739
769 Ga0268265_10025732
770 Ga0268265_10094979
771 Ga0268265_10291556
772 Ga0268264_10020977
773 Ga0268264_10024082
774 Ga0268264_10109175
775 Ga0268264_10126560
776 Ga0265327_10000117
777 Ga0265313_10035831
778 Ga0307405_10043733
779 Ga0307410_10053955
780 Ga0307414_10134392
781 Ga0373923_0023938
782 Ga0373955_0002985
783 Ga0373937_0010206
784 Ga0373937_0119669
785 Ga0395900_0110709
786 Ga0395905_0000880
787 Ga0395905_0066225
788 Ga0439453_0029018
789 Ga0451807_2368817
790 Ga0439433_0005870
791 Ga0439441_004204
792 Ga0439443_004378
793 Ga0439457_038561
794 Ga0450898_001047
795 Ga0453684_0188039
796 Ga0495653_0045247
797 Ga0495662_0134393
798 Ga0495628_0008008
799 Ga0495643_0020734
800 Ga0495587_0006727
801 Ga0495621_0082135
802 Ga0495622_0080780
803 Ga0495667_0161500
804 Ga0495668_0008836
805 Ga0495634_0014132
806 Ga0495635_0100142
807 Ga0495658_0148352
808 Ga0495600_0023886
809 Ga0495672_0002547
810 Ga0495680_0062961
811 Ga0495684_0062929
812 Ga0495686_0006208
813 Ga0501298_004839
814 Ga0501032_0001404
815 Ga0501032_0308364
816 Ga0501034_0004933
817 Ga0501034_0007014
818 Ga0501036_0001169
819 Ga0501036_0120599
820 Ga0501037_0042210
821 Ga0501038_0005473
822 Ga0501038_0056218
823 Ga0501039_0019441
824 Ga0501043_0003535
825 Ga0501043_0147019
826 Ga0501046_0004169
827 Ga0501047_0012534
828 Ga0501047_0122900
829 Ga0501047_0147639
830 Ga0501048_0028676
831 Ga0501067_0010354
832 Ga0501068_0004384
833 Ga0501070_0016449
834 Ga0501072_0059589
835 Ga0501073_0000839
836 Ga0501074_0002773
837 Ga0501201_004459
838 Ga0501202_000359
839 Ga0501202_003348
840 Ga0501217_000190
841 Ga0501217_006657
842 Ga0501222_000546
843 Ga0501223_001006
844 Ga0501233_005667
845 Ga0501242_003418
846 Ga0501243_000816
847 Ga0501257_024182
848 Ga0501261_001267
849 Ga0501221_000013
850 Ga0501225_0003389
851 Ga0501234_000394
852 Ga0501079_0019429
853 Ga0501080_0016299
854 Ga0501080_0020994
855 Ga0501083_0003883
856 Ga0501266_000162
857 Ga0501035_0006639
858 Ga0501035_0150406
859 Ga0501044_0004241
860 Ga0501044_0013960
861 Ga0501044_0093319
862 Ga0501212_000331
863 nmdc:mga0k408_30873_c1
864 nmdc:mga09592_54620_c1
865 nmdc:mga0qj67_41337_c1
866 nmdc:mga08y16_321866_c1
867 nmdc:mga08y16_42411_c1
868 Ga0500644_0005900
869 Ga0500646_0008586
870 Ga0500562_000042
871 Ga0500616_0053177
872 Ga0500622_0000814
873 Ga0500611_000004
874 Ga0500645_006940
875 Ga0501084_0196451
876 2929157142

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11751

PorP_SprF

Type IX secretion system membrane protein PorP/SprF

53

356

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
4pr7-assembly1.cif.gz_A kdgm porin in complex with disordered oligogalacturonate 0.7206 48 320
7dsa-assembly1.cif.gz_B crystal structure of actin capping protein in complex with v-1 (space group p62) 0.7133 81 185
4fqe-assembly1.cif.gz_A kdgm porin 0.7099 48 320
4pr7-assembly1.cif.gz_A kdgm porin in complex with disordered oligogalacturonate 0.7025 48 320
4fqe-assembly1.cif.gz_A kdgm porin 0.6928 48 320
ID Description Score Start End Superfamily
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.7099 48 320 2.40.160.40
4fqeA00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6928 48 320 2.40.160.40
4ctdB00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6695 47 320 2.40.160.40
af_O07422_62_244_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.65 64 118 3.40.630.30
4ctdB00 Mainly Beta;Beta Barrel;Porin;monomeric porin ompg 0.6459 47 320 2.40.160.40
ID Description Score Start End GO Terms
AF-A0A851GMK6-F1-model_v4 PorP/SprF family type IX secretion system membrane protein 0.9359 14 337
AF-A0A851GMK6-F1-model_v4 PorP/SprF family type IX secretion system membrane protein 0.9274 14 337
AF-A0A2G4GIX3-F1-model_v4 Type IX secretion system membrane protein PorP/SprF 0.9241 173 327
AF-A0A4P5TLE9-F1-model_v4 Type IX secretion system membrane protein PorP/SprF 0.9205 19 337
AF-A0A4P5TLE9-F1-model_v4 Type IX secretion system membrane protein PorP/SprF 0.915 19 337

Map