F444059

General Info

Members Datasets Scaffolds Average Seq Length
438 348 262 234

Family's Representative Sequence

Representative Sequence 3300046542|Ga0495597_0002564|Ga0495597_0002564_5185_5994
Length 254
Sequence MTLVKGSSAFWSQDQFKFWDVFQTGMKRMARVAFVTGGTRGIGHEIVARLKADGMKVAAGYSGNDAAAEACARELGVMVIKGNVGVFEDCQRAVASVEAALGPVDVLVNNAGITRDTVFHRMSPEQWGEVVRVNMDSLFNMTRQVIEGMRERGWGRIVNISSAKAGMLGFTRSLALENAKKGVTVNAIAPGYIDTEMVQAVPEKVLQAIIDQIPVGRLGRGEEIADVVSFLAGERAGYVTGATLTINGGQFMAG

Samples

Sample ID Description Type Environment
1 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
2 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
3 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
4 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
5 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
6 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
7 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
8 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
9 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
10 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
11 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
12 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
13 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
14 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
15 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
16 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
17 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
18 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
19 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
20 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
21 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
22 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
23 2849560528 Caulobacter zeae 410 Isolate Unclassified
24 2851153111 Caulobacter radicis 736 Isolate Unclassified
25 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
26 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
27 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
28 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
29 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
30 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
31 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
32 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
33 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
34 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
35 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
36 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
37 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
38 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
39 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
40 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
41 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
42 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
43 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
44 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
45 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
46 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
47 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
48 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
49 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
50 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
51 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
52 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
53 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
54 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
55 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
56 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
57 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
58 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
59 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
60 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
61 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
62 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
63 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
64 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
65 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
66 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
67 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
68 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
69 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
70 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
71 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
72 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
73 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
74 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
75 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
76 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
77 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
78 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
79 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
80 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
81 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
82 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
83 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
84 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
85 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
86 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
87 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
88 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
89 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
90 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
91 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
92 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
93 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
94 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
95 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
96 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
97 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
98 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
99 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
100 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
101 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
102 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
103 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
104 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
105 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
106 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
107 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
108 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
109 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
110 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
111 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
112 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
113 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
114 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
115 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
116 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
117 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
118 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
119 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
120 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
121 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
122 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
123 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
124 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
125 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
126 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
127 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
128 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
129 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
130 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
131 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
132 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
133 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
134 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
135 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
136 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
137 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
138 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
139 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
140 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
141 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
142 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
143 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
144 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
145 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
146 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
147 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
148 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
149 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
150 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
151 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
152 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
153 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
154 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
155 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
156 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
157 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
158 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
159 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
160 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
161 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
162 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
163 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
164 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
165 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
166 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
167 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
168 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
169 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
170 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
171 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
172 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
173 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
174 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
175 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
176 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
177 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
178 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
179 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
180 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
181 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
182 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
183 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
184 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
185 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
186 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
187 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
188 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
189 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
190 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
191 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
192 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
193 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
194 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
195 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
196 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
197 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
198 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
199 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
200 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
201 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
202 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
203 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
204 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
205 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
206 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
207 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
208 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
209 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
210 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
211 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
212 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
213 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
214 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
215 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
216 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
217 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
238 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
239 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
240 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
241 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
244 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
245 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
246 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
247 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
248 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
249 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
250 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
251 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
252 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
253 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
254 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
255 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
256 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
260 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
261 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
262 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
263 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
264 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
265 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
266 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
267 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
268 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
269 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
270 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
271 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
272 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
273 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
274 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
275 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
276 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
277 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
278 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
279 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
280 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
281 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
282 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
283 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
284 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
285 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
288 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
289 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
290 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
291 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
292 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
293 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
294 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
295 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
296 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
300 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
303 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
304 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
305 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
306 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
307 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
308 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
310 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
311 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
312 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
313 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
314 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
315 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
316 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
317 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
318 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
319 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
320 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
321 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
322 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
323 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
324 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
325 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
326 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
327 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
328 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
329 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
330 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
331 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
332 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
333 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
334 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
335 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
336 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
337 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
338 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
339 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
340 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
341 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
342 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
343 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
344 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
345 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
346 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
347 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
348 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 59.13
Metatranscriptomes 0.68
Isolates 40.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.47
Nodule 37.67
Rhizoplane 2.28
Rhizosphere 42.24
Stem 0
Stem Tuber 0
Unclassified 4.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0055536_1000251 3300003781 Bacteria 42530
2 Ga0055531_10012056 3300003794 Bacteria 4101
3 Ga0070658_10533797 3300005327 Bacteria 1015
4 Ga0070670_100022148 3300005331 Bacteria 5469
5 Ga0070680_100107404 3300005336 Bacteria 2321
6 Ga0070680_100173888 3300005336 Bacteria 1813
7 Ga0070691_10004606 3300005341 Bacteria 6265
8 Ga0070668_100000397 3300005347 Bacteria 28857
9 Ga0070669_100015301 3300005353 Bacteria 5466
10 Ga0070671_100259467 3300005355 Bacteria 1477
11 Ga0070671_100291497 3300005355 Bacteria 1389
12 Ga0070671_100378059 3300005355 Bacteria 1210
13 Ga0070674_100138452 3300005356 Bacteria 1824
14 Ga0070667_100000263 3300005367 Bacteria 59687
15 Ga0070667_100002003 3300005367 Bacteria 18051
16 Ga0070667_100012800 3300005367 Bacteria 6933
17 Ga0070663_100520753 3300005455 Bacteria 990
18 Ga0070681_10003075 3300005458 Bacteria 15484
19 Ga0070681_10062380 3300005458 Bacteria 3701
20 Ga0070679_100004940 3300005530 Bacteria 12301
21 Ga0070679_100007487 3300005530 Bacteria 10209
22 Ga0068855_100029515 3300005563 Bacteria 6554
23 Ga0068856_100464995 3300005614 Bacteria 1286
24 Ga0068859_100014209 3300005617 Bacteria 7984
25 Ga0068864_100000067 3300005618 Bacteria 115834
26 Ga0068864_100000180 3300005618 Bacteria 58252
27 Ga0068864_100084952 3300005618 Bacteria 2782
28 Ga0068863_100000009 3300005841 Bacteria 250538
29 Ga0068863_100000157 3300005841 Bacteria 72136
30 Ga0068863_100000735 3300005841 Bacteria 32827
31 Ga0068863_100007976 3300005841 Bacteria 10349
32 Ga0068858_100000020 3300005842 Bacteria 175896
33 Ga0068858_100000147 3300005842 Bacteria 74022
34 Ga0068858_100008659 3300005842 Bacteria 9770
35 Ga0068860_100000382 3300005843 Bacteria 58081
36 Ga0068860_100002533 3300005843 Bacteria 19135
37 Ga0068860_100521594 3300005843 Bacteria 1188
38 Ga0068862_100006008 3300005844 Bacteria 10110
39 Ga0068862_100059597 3300005844 Bacteria 3278
40 Ga0068862_100440988 3300005844 Bacteria 1226
41 Ga0068862_100533033 3300005844 Bacteria 1119
42 Ga0075365_10052425 3300006038 Bacteria 2698
43 Ga0075364_10000934 3300006051 Bacteria 15423
44 Ga0075364_10025127 3300006051 Bacteria 3789
45 Ga0075364_10045116 3300006051 Bacteria 2869
46 Ga0075367_10008751 3300006178 Bacteria 5260
47 Ga0075366_10023939 3300006195 Bacteria 3558
48 Ga0097620_100014210 3300006931 Bacteria 7984
49 Ga0105250_10031208 3300009092 Bacteria 2140
50 Ga0105240_10021836 3300009093 Bacteria 8505
51 Ga0105240_10023517 3300009093 Bacteria 8145
52 Ga0105240_10076192 3300009093 Bacteria 4135
53 Ga0105247_10013752 3300009101 Bacteria 4853
54 Ga0105248_10000305 3300009177 Bacteria 58472
55 Ga0105248_10007865 3300009177 Bacteria 11712
56 Ga0105248_10034848 3300009177 Bacteria 5632
57 Ga0105248_10355694 3300009177 Bacteria 1649
58 Ga0105248_10882870 3300009177 Bacteria 1009
59 Ga0105238_10060267 3300009551 Bacteria 3800
60 Ga0105249_10104988 3300009553 Bacteria 2663
61 Ga0105249_10736976 3300009553 Bacteria 1047
62 Ga0105249_11226134 3300009553 Bacteria 821
63 Ga0105239_10094428 3300010375 Bacteria 3304
64 Ga0157370_10000604 3300013104 Bacteria 44766
65 Ga0157370_10107910 3300013104 Bacteria 2604
66 Ga0157369_10492480 3300013105 Bacteria 1268
67 Ga0157374_10544458 3300013296 Bacteria 1168
68 Ga0163163_10227212 3300014325 Bacteria 1915
69 Ga0157380_10026650 3300014326 Bacteria 4390
70 Ga0157379_10028142 3300014968 Bacteria 5003
71 Ga0209676_1000038 3300025292 Bacteria 449305
72 Ga0209050_1012302 3300025298 Bacteria 3940
73 Ga0209257_1000433 3300025304 Bacteria 80612
74 Ga0207696_1026174 3300025711 Bacteria 1807
75 Ga0207713_1001701 3300025735 Bacteria 16986
76 Ga0207710_10019634 3300025900 Bacteria 2883
77 Ga0207707_10008016 3300025912 Bacteria 9172
78 Ga0207707_10010982 3300025912 Bacteria 7879
79 Ga0207695_10001235 3300025913 Bacteria 43771
80 Ga0207695_10056624 3300025913 Bacteria 4078
81 Ga0207660_10027938 3300025917 Bacteria 3856
82 Ga0207660_10210135 3300025917 Bacteria 1523
83 Ga0207652_10002237 3300025921 Bacteria 16484
84 Ga0207652_10319549 3300025921 Bacteria 1401
85 Ga0207681_10026206 3300025923 Bacteria 3758
86 Ga0207694_10035568 3300025924 Bacteria 3822
87 Ga0207650_10014732 3300025925 Bacteria 5434
88 Ga0207650_10346188 3300025925 Bacteria 1222
89 Ga0207644_10591179 3300025931 Bacteria 921
90 Ga0207706_10585421 3300025933 Bacteria 959
91 Ga0207711_10000160 3300025941 Bacteria 72317
92 Ga0207711_10002573 3300025941 Bacteria 16140
93 Ga0207711_10018591 3300025941 Bacteria 5778
94 Ga0207711_10030125 3300025941 Bacteria 4577
95 Ga0207711_10374365 3300025941 Bacteria 1321
96 Ga0207711_10496907 3300025941 Bacteria 1137
97 Ga0207667_10006652 3300025949 Bacteria 13971
98 Ga0207667_10054567 3300025949 Bacteria 4203
99 Ga0207640_10263739 3300025981 Bacteria 1344
100 Ga0207658_10000190 3300025986 Bacteria 65777
101 Ga0207658_10104639 3300025986 Bacteria 2224
102 Ga0207703_10000050 3300026035 Bacteria 145849
103 Ga0207703_10000082 3300026035 Bacteria 110579
104 Ga0207703_10007271 3300026035 Bacteria 8807
105 Ga0207703_10249794 3300026035 Bacteria 1598
106 Ga0207678_10288214 3300026067 Bacteria 1410
107 Ga0207641_10000007 3300026088 Bacteria 441443
108 Ga0207641_10000017 3300026088 Bacteria 299119
109 Ga0207641_10000118 3300026088 Bacteria 117721
110 Ga0207641_10011767 3300026088 Bacteria 7184
111 Ga0207641_10676882 3300026088 Bacteria 1015
112 Ga0207676_10000191 3300026095 Bacteria 53466
113 Ga0207676_10000196 3300026095 Bacteria 52852
114 Ga0209981_1000970 3300027378 Bacteria 3613
115 Ga0209999_1023537 3300027543 Bacteria 1135
116 Ga0209983_1016612 3300027665 Bacteria 1521
117 Ga0209813_10007929 3300027866 Bacteria 2664
118 Ga0268265_10004510 3300028380 Bacteria 9638
119 Ga0268265_10016229 3300028380 Bacteria 5112
120 Ga0268265_10065693 3300028380 Bacteria 2801
121 Ga0268265_10227804 3300028380 Bacteria 1636
122 Ga0268264_10012980 3300028381 Bacteria 6849
123 Ga0268264_10502455 3300028381 Bacteria 1183
124 Ga0307517_10051860 3300028786 Bacteria 4127
125 Ga0265331_10034695 3300031250 Bacteria 2486
126 Ga0265327_10001677 3300031251 Bacteria 26559
127 Ga0307513_10024938 3300031456 Bacteria 6944
128 Ga0307513_10302060 3300031456 Bacteria 1367
129 Ga0265313_10079094 3300031595 Bacteria 1497
130 Ga0307508_10325853 3300031616 Bacteria 1128
131 Ga0316576_10160712 3300031727 Bacteria 1694
132 Ga0316578_10044314 3300031728 Bacteria 2587
133 Ga0316578_10235873 3300031728 Bacteria 1098
134 Ga0307405_10010784 3300031731 Bacteria 4753
135 Ga0316577_10153621 3300031733 Bacteria 1297
136 Ga0307406_10003315 3300031901 Bacteria 8780
137 Ga0307412_10064181 3300031911 Bacteria 2480
138 Ga0307414_10086356 3300032004 Bacteria 2314
139 Ga0316586_1002652 3300033527 Bacteria 2258
140 Ga0316587_1010685 3300033529 Bacteria 1471
141 Ga0316596_1010933 3300033541 Bacteria 2208
142 Ga0316574_0008392 3300035398 Bacteria 5734
143 Ga0316574_0068666 3300035398 Bacteria 2235
144 Ga0316574_0074290 3300035398 Bacteria 2151
145 Ga0316574_0141754 3300035398 Bacteria 1549
146 Ga0316574_0400329 3300035398 Bacteria 864
147 Ga0373937_0001990 3300036401 Bacteria 17075
148 Ga0373937_0287633 3300036401 Bacteria 1553
149 Ga0316584_0033598 3300036712 Bacteria 3800
150 Ga0395899_0190074 3300037312 Bacteria 1437
151 Ga0395900_0012117 3300037418 Bacteria 8810
152 Ga0395898_0032523 3300037466 Bacteria 5207
153 Ga0395905_0052091 3300037471 Bacteria 3833
154 Ga0436364_0427465 3300037853 Bacteria 2788
155 Ga0395901_0064366 3300038443 Bacteria 3817
156 Ga0395901_0272832 3300038443 Bacteria 1759
157 Ga0436365_0662118 3300039437 Bacteria 1258
158 Ga0439436_0035775 3300041404 Bacteria 1434
159 Ga0439449_0034548 3300042007 Bacteria 1883
160 Ga0439446_0142788 3300042156 Bacteria 783
161 Ga0450901_001167 3300042533 Bacteria 3048
162 Ga0495638_0090916 3300046460 Bacteria 1839
163 Ga0495585_0186339 3300046492 Bacteria 1064
164 Ga0495606_0154981 3300046507 Bacteria 1341
165 Ga0495610_0116886 3300046512 Bacteria 1174
166 Ga0495631_0181492 3300046518 Bacteria 902
167 Ga0495632_0079980 3300046519 Bacteria 1560
168 Ga0495643_0000073 3300046522 Bacteria 168344
169 Ga0495644_0051250 3300046523 Bacteria 1550
170 Ga0495648_0244991 3300046524 Bacteria 868
171 Ga0495642_0012845 3300046528 Bacteria 3232
172 Ga0495609_0026381 3300046538 Bacteria 2661
173 Ga0495597_0000492 3300046542 Bacteria 33012
174 Ga0495597_0002564 3300046542 Bacteria 11369
175 Ga0495597_0057113 3300046542 Bacteria 1708
176 Ga0495622_0001136 3300046557 Bacteria 13893
177 Ga0495622_0002526 3300046557 Bacteria 8834
178 Ga0495668_0131929 3300046616 Bacteria 1367
179 Ga0495625_0021085 3300046660 Bacteria 5022
180 Ga0495659_0163931 3300046664 Bacteria 899
181 Ga0495623_0095100 3300046679 Bacteria 1822
182 Ga0495669_0058392 3300046684 Bacteria 1741
183 Ga0495669_0125738 3300046684 Bacteria 1204
184 Ga0495672_0056051 3300047320 Bacteria 2296
185 Ga0495687_016317 3300047443 Bacteria 3737
186 Ga0495677_0012096 3300047445 Bacteria 3149
187 Ga0495685_020214 3300047447 Bacteria 2288
188 Ga0495686_0122131 3300047472 Bacteria 1551
189 Ga0496103_0063951 3300048906 Bacteria 2293
190 Ga0496106_0094075 3300048909 Bacteria 2317
191 Ga0496106_0144927 3300048909 Bacteria 1870
192 Ga0496107_0370579 3300048910 Bacteria 1065
193 Ga0496107_0582160 3300048910 Bacteria 828
194 Ga0496109_0314061 3300048912 Bacteria 1479
195 Ga0496110_0356437 3300048913 Bacteria 1333
196 Ga0496112_0371589 3300048915 Bacteria 1371
197 Ga0496115_0037334 3300048918 Bacteria 3850
198 Ga0496115_0146945 3300048918 Bacteria 1946
199 Ga0496117_0005556 3300048920 Bacteria 13198
200 Ga0496118_0000556 3300048921 Bacteria 61502
201 Ga0496118_0034662 3300048921 Bacteria 4113
202 Ga0496119_0031913 3300048922 Bacteria 3520
203 Ga0496120_0113258 3300048923 Bacteria 1414
204 Ga0496121_0000035 3300048924 Bacteria 374316
205 Ga0496121_0000122 3300048924 Bacteria 172465
206 Ga0496121_0000272 3300048924 Bacteria 108051
207 Ga0501047_0652517 3300049581 Bacteria 872
208 Ga0501069_0108896 3300049585 Bacteria 1577
209 Ga0501070_0244619 3300049586 Bacteria 1468
210 Ga0501070_0574653 3300049586 Bacteria 900
211 Ga0501074_0270708 3300049590 Bacteria 1208
212 Ga0501257_029283 3300049686 Bacteria 1323
213 Ga0501080_0244663 3300049742 Bacteria 1637
214 Ga0501044_0011677 3300049823 Bacteria 9519
215 Ga0501044_0074351 3300049823 Bacteria 3453
216 nmdc:mga00v17_53955_c1 3300050491 Bacteria 2452
217 nmdc:mga00v17_7522_c1 3300050491 Bacteria 5814
218 nmdc:mga0k408_116482_c1 3300050493 Bacteria 1581
219 nmdc:mga06z11_24409_c1 3300050494 Bacteria 2852
220 nmdc:mga04h51_1292_c1 3300050495 Bacteria 5782
221 nmdc:mga07m45_6207_c1 3300050496 Bacteria 6031
222 nmdc:mga0sz30_29442_c1 3300050516 Bacteria 2264
223 Ga0500635_0000133 3300053080 Bacteria 42884
224 Ga0500635_0003436 3300053080 Bacteria 3985
225 Ga0500644_0009944 3300053088 Bacteria 2560
226 Ga0500583_0070654 3300053092 Bacteria 1669
227 Ga0500651_0025229 3300053093 Bacteria 3729
228 Ga0500651_0053053 3300053093 Bacteria 2542
229 Ga0500650_0182578 3300053098 Bacteria 961
230 Ga0500555_006302 3300053103 Bacteria 3367
231 Ga0500562_000090 3300053108 Bacteria 37346
232 Ga0500569_000529 3300053109 Bacteria 6363
233 Ga0500569_003807 3300053109 Bacteria 3122
234 Ga0500572_110554 3300053111 Bacteria 884
235 Ga0500595_001494 3300053119 Bacteria 12428
236 Ga0500595_004824 3300053119 Bacteria 5968
237 Ga0500595_042410 3300053119 Bacteria 1456
238 Ga0500607_021108 3300053121 Bacteria 3672
239 Ga0500607_069941 3300053121 Bacteria 1815
240 Ga0500608_002428 3300053122 Bacteria 6776
241 Ga0500608_005000 3300053122 Bacteria 5208
242 Ga0500642_0018906 3300053130 Bacteria 2676
243 Ga0500559_0008155 3300053136 Bacteria 4607
244 Ga0500559_0037395 3300053136 Bacteria 2104
245 Ga0500573_0010150 3300053140 Bacteria 5248
246 Ga0500573_0115855 3300053140 Bacteria 1496
247 Ga0500590_022577 3300053148 Bacteria 3269
248 Ga0500590_092259 3300053148 Bacteria 1468
249 Ga0500603_043080 3300053150 Bacteria 1211
250 Ga0500604_0004437 3300053151 Bacteria 3726
251 Ga0500620_101249 3300053155 Bacteria 1008
252 Ga0500622_0005351 3300053156 Bacteria 7728
253 Ga0500624_000002 3300053157 Bacteria 257900
254 Ga0500638_062264 3300053162 Bacteria 1792
255 Ga0500636_0001180 3300053177 Bacteria 14107
256 Ga0500636_0049750 3300053177 Bacteria 2465
257 Ga0500637_0007759 3300053178 Bacteria 5382
258 Ga0500637_0009963 3300053178 Bacteria 4859
259 Ga0500637_0015685 3300053178 Bacteria 4024
260 Ga0500576_151866 3300053725 Bacteria 864
261 Ga0500596_003261 3300053735 Bacteria 3114
262 Ga0500596_003841 3300053735 Bacteria 2812

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032004 Ga0307414_10086356 Ga0307414_100863563 199
2 3300046507 Ga0495606_0154981 Ga0495606_0154981_637_1308 207
3 3300046684 Ga0495669_0125738 Ga0495669_0125738_74_718 207
4 3300025981 Ga0207640_10263739 Ga0207640_102637392 209
5 3300048910 Ga0496107_0582160 Ga0496107_0582160_31_711 210
6 3300009177 Ga0105248_10882870 Ga0105248_108828702 211
7 3300041404 Ga0439436_0035775 Ga0439436_0035775_214_882 211
8 3300042007 Ga0439449_0034548 Ga0439449_0034548_1004_1672 211
9 3300009553 Ga0105249_10736976 Ga0105249_107369762 216
10 3300046523 Ga0495644_0051250 Ga0495644_0051250_765_1475 217
11 3300048910 Ga0496107_0370579 Ga0496107_0370579_33_743 217
12 3300048918 Ga0496115_0146945 Ga0496115_0146945_72_782 217
13 3300010375 Ga0105239_10094428 Ga0105239_100944283 220
14 3300049586 Ga0501070_0574653 Ga0501070_0574653_48_770 220
15 3300006038 Ga0075365_10052425 Ga0075365_100524253 221
16 3300009553 Ga0105249_11226134 Ga0105249_112261341 221
17 3300026067 Ga0207678_10288214 Ga0207678_102882142 222
18 3300028786 Ga0307517_10051860 Ga0307517_100518602 222
19 3300046557 Ga0495622_0001136 Ga0495622_0001136_8767_9483 222
20 3300049823 Ga0501044_0074351 Ga0501044_0074351_874_1599 222
21 3300053148 Ga0500590_092259 Ga0500590_092259_439_1155 222
22 3300005455 Ga0070663_100520753 Ga0070663_1005207531 223
23 3300006051 Ga0075364_10025127 Ga0075364_100251272 224
24 3300006178 Ga0075367_10008751 Ga0075367_100087512 224
25 3300006195 Ga0075366_10023939 Ga0075366_100239392 224
26 3300027866 Ga0209813_10007929 Ga0209813_100079292 224
27 3300046679 Ga0495623_0095100 Ga0495623_0095100_129_854 224
28 3300046684 Ga0495669_0058392 Ga0495669_0058392_534_1334 224
29 3300047443 Ga0495687_016317 Ga0495687_016317_824_1549 224
30 3300048921 Ga0496118_0034662 Ga0496118_0034662_2977_3702 224
31 3300048922 Ga0496119_0031913 Ga0496119_0031913_1987_2712 224
32 3300048924 Ga0496121_0000272 Ga0496121_0000272_50155_50880 224
33 3300050491 nmdc:mga00v17_53955_c1 nmdc:mga00v17_53955_c1_815_1537 224
34 3300050493 nmdc:mga0k408_116482_c1 nmdc:mga0k408_116482_c1_39_761 224
35 3300050494 nmdc:mga06z11_24409_c1 nmdc:mga06z11_24409_c1_860_1582 224
36 3300050495 nmdc:mga04h51_1292_c1 nmdc:mga04h51_1292_c1_4165_4887 224
37 3300050496 nmdc:mga07m45_6207_c1 nmdc:mga07m45_6207_c1_519_1241 224
38 3300050516 nmdc:mga0sz30_29442_c1 nmdc:mga0sz30_29442_c1_993_1715 224
39 3300053119 Ga0500595_042410 Ga0500595_042410_541_1341 224
40 3300005355 Ga0070671_100259467 Ga0070671_1002594673 225
41 3300005843 Ga0068860_100521594 Ga0068860_1005215942 225
42 3300009553 Ga0105249_10104988 Ga0105249_101049885 225
43 3300027378 Ga0209981_1000970 Ga0209981_10009702 225
44 3300027543 Ga0209999_1023537 Ga0209999_10235372 225
45 3300027665 Ga0209983_1016612 Ga0209983_10166122 225
46 3300028381 Ga0268264_10502455 Ga0268264_105024552 225
47 3300031456 Ga0307513_10024938 Ga0307513_100249387 225
48 3300035398 Ga0316574_0141754 Ga0316574_0141754_506_1243 225
49 3300046512 Ga0495610_0116886 Ga0495610_0116886_342_1067 225
50 3300046519 Ga0495632_0079980 Ga0495632_0079980_674_1399 225
51 3300046538 Ga0495609_0026381 Ga0495609_0026381_289_1014 225
52 3300046542 Ga0495597_0000492 Ga0495597_0000492_14377_15102 225
53 3300046616 Ga0495668_0131929 Ga0495668_0131929_195_920 225
54 3300048924 Ga0496121_0000035 Ga0496121_0000035_39112_39837 225
55 3300048924 Ga0496121_0000122 Ga0496121_0000122_24207_24932 225
56 3300053092 Ga0500583_0070654 Ga0500583_0070654_563_1288 225
57 3300053109 Ga0500569_003807 Ga0500569_003807_1803_2528 225
58 3300053111 Ga0500572_110554 Ga0500572_110554_59_784 225
59 3300053119 Ga0500595_001494 Ga0500595_001494_4540_5265 225
60 3300053122 Ga0500608_002428 Ga0500608_002428_4514_5239 225
61 3300053130 Ga0500642_0018906 Ga0500642_0018906_468_1193 225
62 3300053136 Ga0500559_0008155 Ga0500559_0008155_1198_2007 225
63 3300053140 Ga0500573_0010150 Ga0500573_0010150_2271_2996 225
64 3300053140 Ga0500573_0115855 Ga0500573_0115855_211_936 225
65 3300053155 Ga0500620_101249 Ga0500620_101249_21_746 225
66 3300053725 Ga0500576_151866 Ga0500576_151866_22_747 225
67 3300053735 Ga0500596_003261 Ga0500596_003261_2255_2980 225
68 3300005327 Ga0070658_10533797 Ga0070658_105337971 226
69 3300005331 Ga0070670_100022148 Ga0070670_1000221483 226
70 3300005347 Ga0070668_100000397 Ga0070668_1000003974 226
71 3300005353 Ga0070669_100015301 Ga0070669_1000153014 226
72 3300005367 Ga0070667_100002003 Ga0070667_10000200310 226
73 3300005614 Ga0068856_100464995 Ga0068856_1004649952 226
74 3300005617 Ga0068859_100014209 Ga0068859_1000142096 226
75 3300005618 Ga0068864_100000067 Ga0068864_10000006734 226
76 3300005618 Ga0068864_100084952 Ga0068864_1000849523 226
77 3300005841 Ga0068863_100000735 Ga0068863_10000073513 226
78 3300005841 Ga0068863_100007976 Ga0068863_1000079765 226
79 3300005842 Ga0068858_100000020 Ga0068858_10000002083 226
80 3300005843 Ga0068860_100002533 Ga0068860_10000253313 226
81 3300005844 Ga0068862_100006008 Ga0068862_1000060083 226
82 3300006931 Ga0097620_100014210 Ga0097620_1000142106 226
83 3300009093 Ga0105240_10021836 Ga0105240_100218363 226
84 3300009177 Ga0105248_10034848 Ga0105248_100348484 226
85 3300025923 Ga0207681_10026206 Ga0207681_100262061 226
86 3300025925 Ga0207650_10014732 Ga0207650_100147325 226
87 3300025925 Ga0207650_10346188 Ga0207650_103461881 226
88 3300025941 Ga0207711_10002573 Ga0207711_1000257315 226
89 3300025941 Ga0207711_10030125 Ga0207711_100301252 226
90 3300025986 Ga0207658_10104639 Ga0207658_101046392 226
91 3300026035 Ga0207703_10000082 Ga0207703_1000008223 226
92 3300026035 Ga0207703_10249794 Ga0207703_102497942 226
93 3300026088 Ga0207641_10000007 Ga0207641_1000000780 226
94 3300026088 Ga0207641_10011767 Ga0207641_100117672 226
95 3300026088 Ga0207641_10676882 Ga0207641_106768821 226
96 3300026095 Ga0207676_10000191 Ga0207676_1000019114 226
97 3300028380 Ga0268265_10016229 Ga0268265_100162293 226
98 3300028381 Ga0268264_10012980 Ga0268264_100129804 226
99 3300037312 Ga0395899_0190074 Ga0395899_0190074_305_1030 226
100 3300037418 Ga0395900_0012117 Ga0395900_0012117_7448_8173 226
101 3300037466 Ga0395898_0032523 Ga0395898_0032523_2611_3336 226
102 3300037471 Ga0395905_0052091 Ga0395905_0052091_349_1074 226
103 3300038443 Ga0395901_0064366 Ga0395901_0064366_2344_3069 226
104 3300038443 Ga0395901_0272832 Ga0395901_0272832_54_785 226
105 3300042156 Ga0439446_0142788 Ga0439446_0142788_35_760 226
106 3300046542 Ga0495597_0002564 Ga0495597_0002564_5185_5994 226
107 3300046557 Ga0495622_0002526 Ga0495622_0002526_5448_6257 226
108 3300046664 Ga0495659_0163931 Ga0495659_0163931_46_855 226
109 3300047472 Ga0495686_0122131 Ga0495686_0122131_73_882 226
110 3300048909 Ga0496106_0144927 Ga0496106_0144927_545_1270 226
111 3300048918 Ga0496115_0037334 Ga0496115_0037334_1734_2459 226
112 3300048923 Ga0496120_0113258 Ga0496120_0113258_124_849 226
113 3300053080 Ga0500635_0000133 Ga0500635_0000133_23029_23754 226
114 3300053093 Ga0500651_0025229 Ga0500651_0025229_1953_2762 226
115 3300053109 Ga0500569_000529 Ga0500569_000529_4220_5029 226
116 3300053119 Ga0500595_004824 Ga0500595_004824_4779_5588 226
117 3300053121 Ga0500607_069941 Ga0500607_069941_574_1299 226
118 3300053122 Ga0500608_005000 Ga0500608_005000_2720_3529 226
119 3300053136 Ga0500559_0037395 Ga0500559_0037395_417_1142 226
120 3300053148 Ga0500590_022577 Ga0500590_022577_2065_2874 226
121 3300053150 Ga0500603_043080 Ga0500603_043080_21_746 226
122 3300053162 Ga0500638_062264 Ga0500638_062264_661_1386 226
123 3300053177 Ga0500636_0049750 Ga0500636_0049750_882_1607 226
124 3300053178 Ga0500637_0007759 Ga0500637_0007759_3807_4532 226
125 3300053178 Ga0500637_0015685 Ga0500637_0015685_826_1635 226
126 3300053735 Ga0500596_003841 Ga0500596_003841_137_946 226
127 3300005336 Ga0070680_100107404 Ga0070680_1001074042 227
128 3300005341 Ga0070691_10004606 Ga0070691_100046068 227
129 3300005458 Ga0070681_10062380 Ga0070681_100623802 227
130 3300005530 Ga0070679_100007487 Ga0070679_10000748712 227
131 3300005563 Ga0068855_100029515 Ga0068855_1000295152 227
132 3300005843 Ga0068860_100000382 Ga0068860_10000038234 227
133 3300005844 Ga0068862_100533033 Ga0068862_1005330332 227
134 3300009093 Ga0105240_10023517 Ga0105240_100235178 227
135 3300009101 Ga0105247_10013752 Ga0105247_100137522 227
136 3300009177 Ga0105248_10007865 Ga0105248_1000786510 227
137 3300009551 Ga0105238_10060267 Ga0105238_100602674 227
138 3300013104 Ga0157370_10107910 Ga0157370_101079104 227
139 3300013105 Ga0157369_10492480 Ga0157369_104924802 227
140 3300025900 Ga0207710_10019634 Ga0207710_100196342 227
141 3300025912 Ga0207707_10010982 Ga0207707_100109828 227
142 3300025913 Ga0207695_10001235 Ga0207695_1000123513 227
143 3300025917 Ga0207660_10210135 Ga0207660_102101352 227
144 3300025921 Ga0207652_10319549 Ga0207652_103195492 227
145 3300025924 Ga0207694_10035568 Ga0207694_100355684 227
146 3300025941 Ga0207711_10018591 Ga0207711_100185914 227
147 3300025941 Ga0207711_10496907 Ga0207711_104969071 227
148 3300025949 Ga0207667_10006652 Ga0207667_1000665210 227
149 3300028380 Ga0268265_10227804 Ga0268265_102278042 227
150 3300046460 Ga0495638_0090916 Ga0495638_0090916_988_1710 227
151 3300046660 Ga0495625_0021085 Ga0495625_0021085_1714_2436 227
152 3300053156 Ga0500622_0005351 Ga0500622_0005351_5521_6243 227
153 3300005355 Ga0070671_100291497 Ga0070671_1002914972 228
154 3300009177 Ga0105248_10000305 Ga0105248_1000030532 228
155 3300025941 Ga0207711_10000160 Ga0207711_1000016044 228
156 3300025949 Ga0207667_10054567 Ga0207667_100545674 228
157 3300031250 Ga0265331_10034695 Ga0265331_100346954 228
158 3300031595 Ga0265313_10079094 Ga0265313_100790942 228
159 3300031616 Ga0307508_10325853 Ga0307508_103258532 228
160 3300037853 Ga0436364_0427465 Ga0436364_0427465_1376_2101 228
161 3300039437 Ga0436365_0662118 Ga0436365_0662118_22_747 228
162 3300046542 Ga0495597_0057113 Ga0495597_0057113_134_859 228
163 3300049823 Ga0501044_0011677 Ga0501044_0011677_3688_4413 228
164 3300053098 Ga0500650_0182578 Ga0500650_0182578_123_848 228
165 3300036401 Ga0373937_0287633 Ga0373937_0287633_570_1295 229
166 3300046518 Ga0495631_0181492 Ga0495631_0181492_50_775 229
167 3300048913 Ga0496110_0356437 Ga0496110_0356437_126_851 229
168 3300053103 Ga0500555_006302 Ga0500555_006302_406_1131 229
169 iso_pu_bacteria 2513237086 2513583678 229
170 iso_pu_bacteria 2513237091 2513615752 229
171 iso_pu_bacteria 2513237140 2513884952 229
172 iso_pu_bacteria 2513237143 2513905162 229
173 iso_pu_bacteria 2515154107 2515611091 229
174 iso_pu_bacteria 2516653046 2516894797 229
175 iso_pu_bacteria 2524023207 2524450392 229
176 iso_pu_bacteria 2551306084 2551676651 229
177 iso_pu_bacteria 2551306084 2551680275 229
178 iso_pu_bacteria 2551306085 2551685105 229
179 iso_pu_bacteria 2551306086 2551694051 229
180 iso_pu_bacteria 2551306087 2551703840 229
181 iso_pu_bacteria 2551306089 2551715342 229
182 iso_pu_bacteria 2551306090 2551717519 229
183 iso_pu_bacteria 2551306091 2551727398 229
184 iso_pu_bacteria 2551306092 2551734989 229
185 iso_pu_bacteria 2551306093 2551742041 229
186 iso_pu_bacteria 2585428106 2587918954 229
187 iso_pu_bacteria 2791355048 2792458866 229
188 iso_pu_bacteria 2843744320 2843745801 229
189 iso_pu_bacteria 2849560528 2849562286 229
190 iso_pu_bacteria 2851153111 2851153193 229
191 iso_pu_bacteria 2855825444 2855827428 229
192 iso_pu_bacteria 2855839649 2855842804 229
193 iso_pu_bacteria 2858800743 2858802142 229
194 iso_pu_bacteria 2898329390 2898330390 229
195 iso_pu_bacteria 2915986958 2915988793 229
196 iso_pu_bacteria 2915993759 2915999365 229
197 iso_pu_bacteria 2916000859 2916003814 229
198 iso_pu_bacteria 2916007675 2916009032 229
199 iso_pu_bacteria 2916014648 2916018184 229
200 iso_pu_bacteria 2916021584 2916023860 229
201 iso_pu_bacteria 2916028427 2916031033 229
202 iso_pu_bacteria 2916035215 2916040427 229
203 iso_pu_bacteria 2916041962 2916045377 229
204 iso_pu_bacteria 2916048683 2916050713 229
205 iso_pu_bacteria 2916055098 2916056790 229
206 iso_pu_bacteria 2916068649 2916075885 229
207 iso_pu_bacteria 2916076590 2916080576 229
208 iso_pu_bacteria 2921201388 2921207966 229
209 iso_pu_bacteria 2921208531 2921209876 229
210 iso_pu_bacteria 2921237296 2921239779 229
211 iso_pu_bacteria 2921244191 2921249068 229
212 iso_pu_bacteria 2921257292 2921260200 229
213 iso_pu_bacteria 2921263974 2921266309 229
214 iso_pu_bacteria 2921282425 2921286964 229
215 iso_pu_bacteria 2921289301 2921295936 229
216 iso_pu_bacteria 2921296804 2921303867 229
217 iso_pu_bacteria 2924144063 2924149509 229
218 iso_pu_bacteria 2924150972 2924157590 229
219 iso_pu_bacteria 2924158325 2924163200 229
220 iso_pu_bacteria 2924165586 2924169896 229
221 iso_pu_bacteria 2924172951 2924174237 229
222 iso_pu_bacteria 2924179722 2924181886 229
223 iso_pu_bacteria 2924186466 2924187813 229
224 iso_pu_bacteria 2924193448 2924193555 229
225 iso_pu_bacteria 2924200457 2924201739 229
226 iso_pu_bacteria 2924207177 2924207720 229
227 iso_pu_bacteria 2924214083 2924219366 229
228 iso_pu_bacteria 2924221636 2924223470 229
229 iso_pu_bacteria 2924228884 2924234106 229
230 iso_pu_bacteria 2936996657 2936998923 229
231 iso_pu_bacteria 2937002841 2937006653 229
232 iso_pu_bacteria 2937009748 2937010291 229
233 iso_pu_bacteria 2937016420 2937017792 229
234 iso_pu_bacteria 2937023124 2937023248 229
235 iso_pu_bacteria 2937042894 2937048399 229
236 iso_pu_bacteria 2937049772 2937053410 229
237 iso_pu_bacteria 2937056579 2937059823 229
238 iso_pu_bacteria 2937063883 2937068178 229
239 iso_pu_bacteria 2937071275 2937075462 229
240 iso_pu_bacteria 2937091812 2937097127 229
241 iso_pu_bacteria 2937098957 2937101308 229
242 iso_pu_bacteria 2937106411 2937112570 229
243 iso_pu_bacteria 2937113482 2937114173 229
244 iso_pu_bacteria 2937119839 2937120173 229
245 iso_pu_bacteria 2937126314 2937128611 229
246 iso_pu_bacteria 2957382221 2957384559 229
247 iso_pu_bacteria 2957388812 2957395265 229
248 iso_pu_bacteria 2957395598 2957398094 229
249 iso_pu_bacteria 2957402308 2957405163 229
250 iso_pu_bacteria 2957408893 2957411782 229
251 iso_pu_bacteria 2957415311 2957417539 229
252 iso_pu_bacteria 2957422303 2957425562 229
253 iso_pu_bacteria 2957430029 2957431985 229
254 iso_pu_bacteria 2957443900 2957450335 229
255 iso_pu_bacteria 2957450854 2957454559 229
256 iso_pu_bacteria 2957457609 2957460930 229
257 iso_pu_bacteria 2957464669 2957470962 229
258 iso_pu_bacteria 2957471148 2957471342 229
259 iso_pu_bacteria 2957478035 2957479398 229
260 iso_pu_bacteria 2957484790 2957489698 229
261 iso_pu_bacteria 2957491536 2957494505 229
262 iso_pu_bacteria 2957498199 2957504999 229
263 iso_pu_bacteria 2957505466 2957512251 229
264 iso_pu_bacteria 2960584000 2960584882 229
265 iso_pu_bacteria 2960597568 2960597967 229
266 iso_pu_bacteria 2960603979 2960606563 229
267 iso_pu_bacteria 2960610863 2960613346 229
268 iso_pu_bacteria 2960617483 2960618346 229
269 iso_pu_bacteria 2960624210 2960629405 229
270 iso_pu_bacteria 2960637947 2960643751 229
271 iso_pu_bacteria 2960645483 2960647529 229
272 iso_pu_bacteria 2960652885 2960654643 229
273 iso_pu_bacteria 2960660292 2960666873 229
274 iso_pu_bacteria 2960667422 2960673220 229
275 iso_pu_bacteria 2960674078 2960674578 229
276 iso_pu_bacteria 2960687367 2960693276 229
277 iso_pu_bacteria 2964607997 2964612455 229
278 iso_pu_bacteria 2964615318 2964617037 229
279 iso_pu_bacteria 2964621998 2964623562 229
280 iso_pu_bacteria 2964628898 2964633275 229
281 iso_pu_bacteria 2964636051 2964641568 229
282 iso_pu_bacteria 2964643177 2964643679 229
283 iso_pu_bacteria 2964649959 2964655281 229
284 iso_pu_bacteria 2964656573 2964659631 229
285 iso_pu_bacteria 2964663802 2964669331 229
286 iso_pu_bacteria 2964670856 2964675399 229
287 iso_pu_bacteria 2964678106 2964679151 229
288 iso_pu_bacteria 2964685014 2964691735 229
289 iso_pu_bacteria 2964691889 2964695073 229
290 iso_pu_bacteria 2964698721 2964702473 229
291 iso_pu_bacteria 2964705432 2964705956 229
292 iso_pu_bacteria 2964712639 2964712730 229
293 iso_pu_bacteria 2964719344 2964719510 229
294 iso_pu_bacteria 2967664464 2967664792 229
295 iso_pu_bacteria 2967671571 2967672291 229
296 iso_pu_bacteria 2967678726 2967681754 229
297 iso_pu_bacteria 2967693043 2967699330 229
298 iso_pu_bacteria 2967699805 2967700889 229
299 iso_pu_bacteria 2967706974 2967713264 229
300 iso_pu_bacteria 2967714385 2967719019 229
301 iso_pu_bacteria 2967721400 2967723862 229
302 iso_pu_bacteria 2967735183 2967738394 229
303 iso_pu_bacteria 2967742019 2967748594 229
304 iso_pu_bacteria 2967748971 2967753989 229
305 iso_pu_bacteria 2967755722 2967757467 229
306 iso_pu_bacteria 2967762386 2967767874 229
307 iso_pu_bacteria 2967769361 2967775147 229
308 iso_pu_bacteria 2967775926 2967776986 229
309 iso_pu_bacteria 2970019648 2970023594 229
310 iso_pu_bacteria 2970033650 2970036629 229
311 iso_pu_bacteria 2970040964 2970044949 229
312 iso_pu_bacteria 2970047711 2970051154 229
313 iso_pu_bacteria 2970054988 2970058906 229
314 iso_pu_bacteria 2970061556 2970068452 229
315 iso_pu_bacteria 2970068827 2970070290 229
316 iso_pu_bacteria 2970076120 2970076789 229
317 iso_pu_bacteria 2970082768 2970084043 229
318 iso_pu_bacteria 2970088815 2970092813 229
319 iso_pu_bacteria 2970095765 2970099906 229
320 iso_pu_bacteria 2970102677 2970106988 229
321 iso_pu_bacteria 2970109326 2970111132 229
322 iso_pu_bacteria 2970116247 2970116869 229
323 iso_pu_bacteria 2970129317 2970133591 229
324 iso_pu_bacteria 2970136068 2970142267 229
325 iso_pu_bacteria 2970149975 2970151681 229
326 iso_pu_bacteria 2970156795 2970163162 229
327 iso_pu_bacteria 2970164137 2970170824 229
328 iso_pu_bacteria 2970170962 2970176093 229
329 iso_pu_bacteria 2970177841 2970181267 229
330 iso_pu_bacteria 2970184632 2970185495 229
331 iso_pu_bacteria 2970191845 2970197984 229
332 iso_pu_bacteria 2977516862 2977519755 229
333 iso_pu_bacteria 2977523885 2977525172 229
334 iso_pu_bacteria 2977537788 2977544540 229
335 iso_pu_bacteria 2977551784 2977553158 229
336 iso_pu_bacteria 2977558990 2977565794 229
337 iso_pu_bacteria 2977565890 2977571241 229
338 iso_pu_bacteria 2977572785 2977573764 229
339 iso_pu_bacteria 2977579622 2977582965 229
340 iso_pu_bacteria 648276728 648737240 229
341 iso_pu_bacteria 8003992118 8003995384 229
342 3300025941 Ga0207711_10374365 Ga0207711_103743652 230
343 3300031456 Ga0307513_10302060 Ga0307513_103020601 230
344 iso_pu_bacteria 2510917020 2511121115 230
345 iso_pu_bacteria 2582581280 2585153940 230
346 iso_pu_bacteria 2582581293 2585194933 230
347 3300014968 Ga0157379_10028142 Ga0157379_100281425 231
348 3300005356 Ga0070674_100138452 Ga0070674_1001384522 232
349 3300042533 Ga0450901_001167 Ga0450901_001167_786_1511 232
350 3300046522 Ga0495643_0000073 Ga0495643_0000073_33835_34554 232
351 3300049686 Ga0501257_029283 Ga0501257_029283_159_884 232
352 3300053088 Ga0500644_0009944 Ga0500644_0009944_1720_2445 232
353 3300053093 Ga0500651_0053053 Ga0500651_0053053_1281_2006 232
354 3300005336 Ga0070680_100173888 Ga0070680_1001738882 233
355 3300005355 Ga0070671_100378059 Ga0070671_1003780592 233
356 3300005367 Ga0070667_100000263 Ga0070667_10000026321 233
357 3300005367 Ga0070667_100012800 Ga0070667_1000128002 233
358 3300005458 Ga0070681_10003075 Ga0070681_1000307510 233
359 3300005530 Ga0070679_100004940 Ga0070679_10000494010 233
360 3300005841 Ga0068863_100000009 Ga0068863_1000000092 233
361 3300005842 Ga0068858_100008659 Ga0068858_10000865911 233
362 3300005844 Ga0068862_100059597 Ga0068862_1000595973 233
363 3300005844 Ga0068862_100440988 Ga0068862_1004409882 233
364 3300006051 Ga0075364_10000934 Ga0075364_100009346 233
365 3300006051 Ga0075364_10045116 Ga0075364_100451164 233
366 3300009093 Ga0105240_10076192 Ga0105240_100761926 233
367 3300009177 Ga0105248_10355694 Ga0105248_103556942 233
368 3300013104 Ga0157370_10000604 Ga0157370_1000060438 233
369 3300013296 Ga0157374_10544458 Ga0157374_105444581 233
370 3300014326 Ga0157380_10026650 Ga0157380_100266504 233
371 3300025735 Ga0207713_1001701 Ga0207713_10017018 233
372 3300025912 Ga0207707_10008016 Ga0207707_1000801610 233
373 3300025913 Ga0207695_10056624 Ga0207695_100566245 233
374 3300025917 Ga0207660_10027938 Ga0207660_100279382 233
375 3300025921 Ga0207652_10002237 Ga0207652_1000223711 233
376 3300025931 Ga0207644_10591179 Ga0207644_105911791 233
377 3300025986 Ga0207658_10000190 Ga0207658_1000019013 233
378 3300026035 Ga0207703_10007271 Ga0207703_100072711 233
379 3300026088 Ga0207641_10000017 Ga0207641_1000001722 233
380 3300028380 Ga0268265_10004510 Ga0268265_100045106 233
381 3300028380 Ga0268265_10065693 Ga0268265_100656933 233
382 3300031727 Ga0316576_10160712 Ga0316576_101607122 233
383 3300031728 Ga0316578_10044314 Ga0316578_100443141 233
384 3300031728 Ga0316578_10235873 Ga0316578_102358731 233
385 3300031731 Ga0307405_10010784 Ga0307405_100107842 233
386 3300031733 Ga0316577_10153621 Ga0316577_101536212 233
387 3300031911 Ga0307412_10064181 Ga0307412_100641812 233
388 3300033527 Ga0316586_1002652 Ga0316586_10026522 233
389 3300033529 Ga0316587_1010685 Ga0316587_10106851 233
390 3300033541 Ga0316596_1010933 Ga0316596_10109331 233
391 3300035398 Ga0316574_0008392 Ga0316574_0008392_1437_2159 233
392 3300035398 Ga0316574_0068666 Ga0316574_0068666_1383_2120 233
393 3300035398 Ga0316574_0074290 Ga0316574_0074290_855_1592 233
394 3300035398 Ga0316574_0400329 Ga0316574_0400329_42_764 233
395 3300036401 Ga0373937_0001990 Ga0373937_0001990_9398_10120 233
396 3300036712 Ga0316584_0033598 Ga0316584_0033598_957_1679 233
397 3300046492 Ga0495585_0186339 Ga0495585_0186339_276_998 233
398 3300046524 Ga0495648_0244991 Ga0495648_0244991_100_822 233
399 3300046528 Ga0495642_0012845 Ga0495642_0012845_2007_2729 233
400 3300047320 Ga0495672_0056051 Ga0495672_0056051_851_1573 233
401 3300047445 Ga0495677_0012096 Ga0495677_0012096_1587_2309 233
402 3300047447 Ga0495685_020214 Ga0495685_020214_1501_2223 233
403 3300048906 Ga0496103_0063951 Ga0496103_0063951_152_892 233
404 3300048912 Ga0496109_0314061 Ga0496109_0314061_440_1180 233
405 3300048915 Ga0496112_0371589 Ga0496112_0371589_632_1354 233
406 3300048920 Ga0496117_0005556 Ga0496117_0005556_164_904 233
407 3300048921 Ga0496118_0000556 Ga0496118_0000556_21208_21948 233
408 3300049581 Ga0501047_0652517 Ga0501047_0652517_122_844 233
409 3300049585 Ga0501069_0108896 Ga0501069_0108896_583_1305 233
410 3300049586 Ga0501070_0244619 Ga0501070_0244619_26_748 233
411 3300049590 Ga0501074_0270708 Ga0501074_0270708_87_809 233
412 3300049742 Ga0501080_0244663 Ga0501080_0244663_52_774 233
413 3300050491 nmdc:mga00v17_7522_c1 nmdc:mga00v17_7522_c1_4868_5590 233
414 3300053108 Ga0500562_000090 Ga0500562_000090_33744_34469 233
415 3300053151 Ga0500604_0004437 Ga0500604_0004437_334_1074 233
416 3300053157 Ga0500624_000002 Ga0500624_000002_144406_145146 233
417 3300003781 Ga0055536_1000251 Ga0055536_100025113 234
418 3300003794 Ga0055531_10012056 Ga0055531_100120563 234
419 3300005618 Ga0068864_100000180 Ga0068864_10000018021 234
420 3300005841 Ga0068863_100000157 Ga0068863_10000015734 234
421 3300005842 Ga0068858_100000147 Ga0068858_10000014736 234
422 3300009092 Ga0105250_10031208 Ga0105250_100312083 234
423 3300014325 Ga0163163_10227212 Ga0163163_102272122 234
424 3300025292 Ga0209676_1000038 Ga0209676_1000038131 234
425 3300025298 Ga0209050_1012302 Ga0209050_10123022 234
426 3300025304 Ga0209257_1000433 Ga0209257_100043361 234
427 3300025711 Ga0207696_1026174 Ga0207696_10261741 234
428 3300025933 Ga0207706_10585421 Ga0207706_105854212 234
429 3300026035 Ga0207703_10000050 Ga0207703_10000050104 234
430 3300026088 Ga0207641_10000118 Ga0207641_1000011842 234
431 3300026095 Ga0207676_10000196 Ga0207676_1000019625 234
432 3300031251 Ga0265327_10001677 Ga0265327_100016772 234
433 3300031901 Ga0307406_10003315 Ga0307406_100033157 234
434 3300048909 Ga0496106_0094075 Ga0496106_0094075_810_1535 234
435 3300053080 Ga0500635_0003436 Ga0500635_0003436_2954_3802 234
436 3300053121 Ga0500607_021108 Ga0500607_021108_336_1184 234
437 3300053177 Ga0500636_0001180 Ga0500636_0001180_1846_2694 234
438 3300053178 Ga0500637_0009963 Ga0500637_0009963_2432_3280 234

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

31

206

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

37

250

0.97

PF08659

KR

KR domain

32

175

0.82

PF13460

NAD_binding_10

NAD(P)H-binding

37

195

0.77

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

33

171

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uzm-assembly1.cif.gz_B-2 maba from mycobacterium tuberculosis 0.9559 1 225
4wk6-assembly1.cif.gz_C crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase (fabg) (g141a) from vibrio cholerae in complex with nadph 0.9516 3 231
1gee-assembly1.cif.gz_A crystal structure of glucose dehydrogenase mutant q252l complexed with nad+ 0.9516 2 225
1gco-assembly1.cif.gz_A crystal structure of glucose dehydrogenase complexed with nad+ 0.9513 2 225
7pcs-assembly1.cif.gz_D structure of the heterotetrameric sdr family member bbscd 0.9512 1 225
ID Description Score Start End Superfamily
4npcA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9485 2 225 3.40.50.720
3ay6A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9479 2 225 3.40.50.720
af_Q0JDU3_1_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.947 74 226 3.40.50.720
4kmsB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9453 1 230 3.40.50.720
2ntnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9452 1 229 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A127QIV9-F1-model_v4 Short chain dehydrogenase family protein 0.9574 1 136
AF-A0A7C1KCZ1-F1-model_v4 Glucose 1-dehydrogenase (EC 1.1.1.47) 0.9569 1 226 GO:0047936
AF-A0A435WSP9-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9526 3 131
AF-A0A371GW42-F1-model_v4 3-oxoacyl-[acyl-carrier-protein] reductase (EC 1.1.1.100) 0.952 2 226 GO:0004316
GO:0006633
GO:0009507
GO:0051287
AF-A0A4D9ALR0-F1-model_v4 deleted 0.9514 2 226

Feature Viewer

pLDDT pTM Quality
90.03 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map