F443863

General Info

Members Datasets Scaffolds Average Seq Length
437 267 874 371

Family's Representative Sequence

Representative Sequence 3300048911|Ga0496108_0155767|Ga0496108_0155767_545_1663
Length 342
Sequence MLVGVPKEIKDNEYRVGLVPATVHELTAKGHGVLVQAGAGLGAGLTDAEYQAAGAKLVATKLLRRGQILFTYLHLAPDPQQTSDLIESGVTAIAYETVTSPHGGLPLLMPMSEVAGRMAPHVGAHCLEKENGGRGVLLGGVPGVPAASVVILGAFIAAGIGADVVVIDRSPEALRRIVAQFGNRVRTLHSTRDAVETACRSADLVIGTVLVPGAAAPKLVSAETVRAMKPGSVIVDVAIDQGGCAETSRPTTHSHPTYVVDDVVHYCVTNMPGAVARTSTFALNNMTMPFVVALADHGLRIALGEDEHLRNGLNVHEGRVTHRAVAGALKLRYAAPQEVLRI

Samples

Sample ID Description Type Environment
1 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
32 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
33 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
63 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
64 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
65 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
69 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
70 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
71 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
108 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
109 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
110 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
111 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
112 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
113 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
114 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
115 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
116 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
119 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
120 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
121 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
128 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
129 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
130 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
131 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
139 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
140 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
141 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
142 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
143 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
144 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
145 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
146 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
147 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
150 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
151 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
152 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
153 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
154 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
155 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
156 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
157 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
158 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
159 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
160 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
161 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
162 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
165 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
166 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
169 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
170 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
171 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
176 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
179 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
183 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
184 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
185 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
186 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
187 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
188 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
195 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
196 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
197 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
198 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
204 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
205 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
206 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
207 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
224 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
228 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
229 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
230 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
231 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
232 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
233 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
234 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
235 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
236 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
241 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
242 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
243 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
251 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
252 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
255 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
256 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
257 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
258 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
259 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
260 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
261 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
264 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
265 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
266 2910245624 Adhaeribacter radiodurans KUDC8001 Isolate Rhizosphere
267 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.08
Metatranscriptomes 0
Isolates 0.92

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.89
Nodule 0
Rhizoplane 10.53
Rhizosphere 82.15
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496108_0155767 3300048911 Bacteria 1973
2 JGI24750J21931_1003643 3300002070 Bacteria 1851
3 Ga0055531_10010394 3300003794 Bacteria 4629
4 Ga0065714_10069458 3300005288 Bacteria 4220
5 Ga0070658_10008716 3300005327 Bacteria 8145
6 Ga0070676_10015337 3300005328 Bacteria 4227
7 Ga0070670_100019634 3300005331 Bacteria 5801
8 Ga0070670_100031342 3300005331 Bacteria 4578
9 Ga0068869_100154353 3300005334 Bacteria 1783
10 Ga0068868_100017520 3300005338 Bacteria 5340
11 Ga0068868_100018655 3300005338 Bacteria 5190
12 Ga0070691_10018416 3300005341 Bacteria 3220
13 Ga0070671_100014937 3300005355 Bacteria 6273
14 Ga0070688_100097148 3300005365 Bacteria 1936
15 Ga0070688_100110089 3300005365 Bacteria 1830
16 Ga0070659_100025537 3300005366 Bacteria 4539
17 Ga0070709_10002320 3300005434 Bacteria 10318
18 Ga0070709_10020459 3300005434 Bacteria 3839
19 Ga0070709_10142725 3300005434 Bacteria 1647
20 Ga0070714_100042525 3300005435 Bacteria 3839
21 Ga0070713_100127989 3300005436 Bacteria 2236
22 Ga0070713_100357851 3300005436 Bacteria 1355
23 Ga0070710_10019882 3300005437 Bacteria 3477
24 Ga0070701_10015532 3300005438 Bacteria 3519
25 Ga0070711_100029234 3300005439 Bacteria 3635
26 Ga0070700_100010594 3300005441 Bacteria 5092
27 Ga0070663_100179908 3300005455 Bacteria 1639
28 Ga0070699_100022843 3300005518 Bacteria 5390
29 Ga0070665_100090478 3300005548 Bacteria 3066
30 Ga0070665_100103809 3300005548 Bacteria 2845
31 Ga0070704_100249148 3300005549 Bacteria 1458
32 Ga0068855_100201439 3300005563 Bacteria 2240
33 Ga0070664_100025457 3300005564 Bacteria 4904
34 Ga0068859_100003463 3300005617 Bacteria 16045
35 Ga0068864_100013785 3300005618 Bacteria 6701
36 Ga0068864_100023798 3300005618 Bacteria 5146
37 Ga0068866_10040747 3300005718 Bacteria 2301
38 Ga0068861_100000036 3300005719 Bacteria 60355
39 Ga0068870_10007615 3300005840 Bacteria 4839
40 Ga0068863_100166067 3300005841 Bacteria 2117
41 Ga0068863_100529759 3300005841 Bacteria 1162
42 Ga0068858_100068011 3300005842 Bacteria 3300
43 Ga0068860_100313542 3300005843 Bacteria 1538
44 Ga0068862_100160951 3300005844 Bacteria 2003
45 Ga0081455_10001093 3300005937 Bacteria 34045
46 Ga0081455_10008132 3300005937 Bacteria 10944
47 Ga0081455_10014635 3300005937 Bacteria 7673
48 Ga0081455_10058351 3300005937 Bacteria 3266
49 Ga0081538_10014704 3300005981 Bacteria 6108
50 Ga0081538_10064428 3300005981 Bacteria 2073
51 Ga0081540_1001486 3300005983 Bacteria 20247
52 Ga0081539_10034110 3300005985 Bacteria 3086
53 Ga0070717_10008135 3300006028 Bacteria 7826
54 Ga0070717_10082767 3300006028 Bacteria 2697
55 Ga0075365_10070782 3300006038 Bacteria 2347
56 Ga0075365_10072523 3300006038 Bacteria 2320
57 Ga0075365_10089618 3300006038 Bacteria 2094
58 Ga0070715_10007822 3300006163 Bacteria 3695
59 Ga0070716_100005600 3300006173 Bacteria 6098
60 Ga0070716_100174403 3300006173 Bacteria 1406
61 Ga0070712_100000242 3300006175 Bacteria 30684
62 Ga0075362_10028524 3300006177 Bacteria 2397
63 Ga0068871_100081819 3300006358 Bacteria 2676
64 Ga0075428_100077346 3300006844 Bacteria 3632
65 Ga0075428_100201971 3300006844 Bacteria 2148
66 Ga0075428_100344657 3300006844 Bacteria 1599
67 Ga0075430_100000514 3300006846 Bacteria 29035
68 Ga0075431_100031466 3300006847 Bacteria 5465
69 Ga0075431_100035601 3300006847 Bacteria 5126
70 Ga0075431_100189572 3300006847 Bacteria 2107
71 Ga0075433_10099515 3300006852 Bacteria 2574
72 Ga0075433_10198616 3300006852 Bacteria 1783
73 Ga0075433_10330164 3300006852 Bacteria 1349
74 Ga0075434_100233128 3300006871 Bacteria 1860
75 Ga0075434_100392951 3300006871 Bacteria 1408
76 Ga0075434_100460057 3300006871 Bacteria 1293
77 Ga0097620_100003463 3300006931 Bacteria 16045
78 Ga0075435_100039123 3300007076 Bacteria 3784
79 Ga0111539_10161929 3300009094 Bacteria 2617
80 Ga0111539_10551540 3300009094 Bacteria 1342
81 Ga0105247_10007123 3300009101 Bacteria 6868
82 Ga0114129_10000908 3300009147 Bacteria 38524
83 Ga0114129_10039350 3300009147 Bacteria 6666
84 Ga0114129_10405695 3300009147 Bacteria 1795
85 Ga0105243_10080592 3300009148 Bacteria 2656
86 Ga0105248_10001524 3300009177 Bacteria 25789
87 Ga0105248_10022767 3300009177 Bacteria 6953
88 Ga0105248_10258214 3300009177 Bacteria 1961
89 Ga0105239_10002479 3300010375 Bacteria 23531
90 Ga0105246_10049816 3300011119 Bacteria 2870
91 Ga0163162_10151879 3300013306 Bacteria 2434
92 Ga0163163_10182476 3300014325 Bacteria 2146
93 Ga0157380_10009855 3300014326 Bacteria 6859
94 Ga0157379_10051895 3300014968 Bacteria 3661
95 Ga0157379_10229793 3300014968 Bacteria 1681
96 Ga0157376_10022637 3300014969 Bacteria 4902
97 Ga0213876_10047905 3300021384 Bacteria 2259
98 Ga0213875_10000116 3300021388 Bacteria 90170
99 Ga0228598_1005944 3300024227 Bacteria 2537
100 Ga0209758_1000061 3300025297 Bacteria 320172
101 Ga0207426_1009360 3300025302 Bacteria 3881
102 Ga0209257_1000553 3300025304 Bacteria 64251
103 Ga0207692_10003003 3300025898 Bacteria 6537
104 Ga0207692_10029524 3300025898 Bacteria 2607
105 Ga0207710_10005797 3300025900 Bacteria 5301
106 Ga0207688_10001814 3300025901 Bacteria 11369
107 Ga0207699_10009172 3300025906 Bacteria 4915
108 Ga0207699_10151396 3300025906 Bacteria 1535
109 Ga0207645_10007457 3300025907 Bacteria 7725
110 Ga0207643_10004469 3300025908 Bacteria 7516
111 Ga0207693_10002219 3300025915 Bacteria 16908
112 Ga0207693_10010142 3300025915 Bacteria 7653
113 Ga0207693_10012163 3300025915 Bacteria 6953
114 Ga0207663_10058610 3300025916 Bacteria 2431
115 Ga0207649_10081428 3300025920 Bacteria 2096
116 Ga0207681_10091718 3300025923 Bacteria 2171
117 Ga0207650_10035525 3300025925 Bacteria 3620
118 Ga0207687_10020649 3300025927 Bacteria 4371
119 Ga0207700_10043357 3300025928 Bacteria 3304
120 Ga0207700_10121301 3300025928 Bacteria 2120
121 Ga0207664_10001863 3300025929 Bacteria 13890
122 Ga0207644_10131951 3300025931 Bacteria 1913
123 Ga0207709_10120410 3300025935 Bacteria 1771
124 Ga0207670_10334984 3300025936 Bacteria 1194
125 Ga0207665_10000206 3300025939 Bacteria 39664
126 Ga0207665_10031000 3300025939 Bacteria 3537
127 Ga0207711_10000983 3300025941 Bacteria 27325
128 Ga0207711_10025757 3300025941 Bacteria 4932
129 Ga0207689_10028382 3300025942 Bacteria 4682
130 Ga0207679_10008925 3300025945 Bacteria 6400
131 Ga0207651_10022839 3300025960 Bacteria 3835
132 Ga0207668_10153556 3300025972 Bacteria 1785
133 Ga0207658_10126939 3300025986 Bacteria 2043
134 Ga0207677_10073761 3300026023 Bacteria 2418
135 Ga0207703_10071002 3300026035 Bacteria 2875
136 Ga0207641_10104786 3300026088 Bacteria 2497
137 Ga0207641_10388920 3300026088 Bacteria 1337
138 Ga0207641_10511458 3300026088 Bacteria 1167
139 Ga0207648_10005942 3300026089 Bacteria 12210
140 Ga0207676_10029192 3300026095 Bacteria 4127
141 Ga0207676_10065968 3300026095 Bacteria 2884
142 Ga0207674_10049763 3300026116 Bacteria 4284
143 Ga0207675_100000154 3300026118 Bacteria 60483
144 Ga0207675_100000915 3300026118 Bacteria 29452
145 Ga0207683_10007238 3300026121 Bacteria 9509
146 Ga0207698_10154959 3300026142 Bacteria 1994
147 Ga0268266_10159991 3300028379 Bacteria 2036
148 Ga0268265_10187891 3300028380 Bacteria 1781
149 Ga0265332_10027103 3300031238 Bacteria 2511
150 Ga0265329_10016274 3300031242 Bacteria 2581
151 Ga0265340_10024590 3300031247 Bacteria 3058
152 Ga0265339_10031166 3300031249 Bacteria 3015
153 Ga0265331_10037601 3300031250 Bacteria 2369
154 Ga0265316_10143532 3300031344 Bacteria 1792
155 Ga0307513_10328662 3300031456 Bacteria 1284
156 Ga0316578_10001884 3300031728 Bacteria 8850
157 Ga0373944_0002469 3300035089 Bacteria 4697
158 Ga0373953_0053968 3300035117 Bacteria 1630
159 Ga0373954_0019799 3300035118 Bacteria 3038
160 Ga0373954_0069825 3300035118 Bacteria 1668
161 Ga0373943_0016779 3300035170 Bacteria 3345
162 Ga0373943_0086670 3300035170 Bacteria 1615
163 Ga0373946_0019017 3300035171 Bacteria 2642
164 Ga0373955_0022295 3300035172 Bacteria 3211
165 Ga0373955_0031784 3300035172 Bacteria 2767
166 Ga0316574_0007944 3300035398 Bacteria 5858
167 Ga0373935_0038045 3300035692 Bacteria 3011
168 Ga0373935_0252350 3300035692 Bacteria 1235
169 Ga0373927_0083019 3300035695 Bacteria 2078
170 Ga0373933_0041194 3300035724 Bacteria 2725
171 Ga0373947_0010021 3300035725 Bacteria 5441
172 Ga0373947_0012500 3300035725 Bacteria 4868
173 Ga0373937_0004437 3300036401 Bacteria 11926
174 Ga0373937_0026707 3300036401 Bacteria 5217
175 Ga0316582_0000046 3300036647 Bacteria 29572
176 Ga0316584_0001452 3300036712 Bacteria 14203
177 Ga0316584_0045479 3300036712 Bacteria 3277
178 Ga0373925_0014674 3300037068 Bacteria 5661
179 Ga0373925_0034168 3300037068 Bacteria 3748
180 Ga0373925_0051697 3300037068 Bacteria 3068
181 Ga0395900_0094391 3300037418 Bacteria 3073
182 Ga0395900_0120204 3300037418 Bacteria 2696
183 Ga0316581_0000090 3300037588 Bacteria 11792
184 Ga0436364_0526930 3300037853 Bacteria 2098
185 Ga0436364_1018697 3300037853 Bacteria 38110
186 Ga0395901_0149452 3300038443 Bacteria 2455
187 Ga0400483_197669 3300039062 Bacteria 22898
188 Ga0436365_0514423 3300039437 Bacteria 2602
189 Ga0436365_0757108 3300039437 Bacteria 2381
190 Ga0436361_0260315 3300039447 Bacteria 3943
191 Ga0436363_0008889 3300039450 Bacteria 1967
192 Ga0436363_0916549 3300039450 Bacteria 2318
193 Ga0436363_1295064 3300039450 Bacteria 1623
194 Ga0466966_0068278 3300044684 Bacteria 2232
195 Ga0466963_0079521 3300044694 Bacteria 2218
196 Ga0466957_0008459 3300044842 Bacteria 5853
197 Ga0466960_0117787 3300044901 Bacteria 1388
198 Ga0466958_0026576 3300045836 Bacteria 3422
199 Ga0495592_0069988 3300046454 Bacteria 2557
200 Ga0495603_0005268 3300046455 Bacteria 7716
201 Ga0495603_0005681 3300046455 Bacteria 7453
202 Ga0495629_0010926 3300046459 Bacteria 6604
203 Ga0495629_0033873 3300046459 Bacteria 3612
204 Ga0495629_0080397 3300046459 Bacteria 2276
205 Ga0495629_0180415 3300046459 Bacteria 1463
206 Ga0495651_0093245 3300046462 Bacteria 2254
207 Ga0495651_0130357 3300046462 Bacteria 1836
208 Ga0495653_0050210 3300046463 Bacteria 3209
209 Ga0495580_0012125 3300046472 Bacteria 6631
210 Ga0495582_0012417 3300046473 Bacteria 4693
211 Ga0495582_0025796 3300046473 Bacteria 3220
212 Ga0495582_0163633 3300046473 Bacteria 1266
213 Ga0495639_0045156 3300046475 Bacteria 1993
214 Ga0495662_0018210 3300046476 Bacteria 3399
215 Ga0495662_0023708 3300046476 Bacteria 2963
216 Ga0495662_0027588 3300046476 Bacteria 2743
217 Ga0495662_0040083 3300046476 Bacteria 2262
218 Ga0495584_0003114 3300046491 Bacteria 9216
219 Ga0495594_0009133 3300046499 Bacteria 5117
220 Ga0495594_0011942 3300046499 Bacteria 4517
221 Ga0495607_0067674 3300046501 Bacteria 2006
222 Ga0495608_0094521 3300046511 Bacteria 1931
223 Ga0495618_0047213 3300046514 Bacteria 2718
224 Ga0495628_0013726 3300046516 Bacteria 6809
225 Ga0495630_0055688 3300046517 Bacteria 2964
226 Ga0495630_0170294 3300046517 Bacteria 1659
227 Ga0495631_0107910 3300046518 Bacteria 1197
228 Ga0495644_0042391 3300046523 Bacteria 1713
229 Ga0495666_0057261 3300046526 Bacteria 1866
230 Ga0495665_0021854 3300046531 Bacteria 3441
231 Ga0495665_0023517 3300046531 Bacteria 3310
232 Ga0495640_0067118 3300046533 Bacteria 2417
233 Ga0495640_0073652 3300046533 Bacteria 2286
234 Ga0495640_0088023 3300046533 Bacteria 2053
235 Ga0495587_0060435 3300046536 Bacteria 2222
236 Ga0495587_0113992 3300046536 Bacteria 1551
237 Ga0495598_0010763 3300046537 Bacteria 2199
238 Ga0495609_0042235 3300046538 Bacteria 2048
239 Ga0495667_0023611 3300046559 Bacteria 4141
240 Ga0495667_0035638 3300046559 Bacteria 3324
241 Ga0495656_0038377 3300046615 Bacteria 1983
242 Ga0495656_0070311 3300046615 Bacteria 1553
243 Ga0495634_0020450 3300046642 Bacteria 4694
244 Ga0495611_0069488 3300046648 Bacteria 1609
245 Ga0495661_0103994 3300046665 Bacteria 1593
246 Ga0495588_0005463 3300046674 Bacteria 5657
247 Ga0495599_0026694 3300046678 Bacteria 3620
248 Ga0495623_0123810 3300046679 Bacteria 1554
249 Ga0495647_0060507 3300046681 Bacteria 1493
250 Ga0495658_0005157 3300046683 Bacteria 6423
251 Ga0495658_0010269 3300046683 Bacteria 4683
252 Ga0495658_0012074 3300046683 Bacteria 4363
253 Ga0495613_0001434 3300046689 Bacteria 18195
254 Ga0495613_0032249 3300046689 Bacteria 3891
255 Ga0495613_0180270 3300046689 Bacteria 1496
256 Ga0495624_0045692 3300046690 Bacteria 2786
257 Ga0495670_0073206 3300046691 Bacteria 1736
258 Ga0495600_0081949 3300046809 Bacteria 2105
259 Ga0495581_0036879 3300047315 Bacteria 2828
260 Ga0495581_0049297 3300047315 Bacteria 2431
261 Ga0495604_0121524 3300047317 Bacteria 1890
262 Ga0495604_0133706 3300047317 Bacteria 1780
263 Ga0495604_0148969 3300047317 Bacteria 1665
264 Ga0495674_0189286 3300047319 Bacteria 1711
265 Ga0495672_0066345 3300047320 Bacteria 2060
266 Ga0495676_0014118 3300047321 Bacteria 7152
267 Ga0495680_0007941 3300047322 Bacteria 9681
268 Ga0495680_0109247 3300047322 Bacteria 2051
269 Ga0495680_0197936 3300047322 Bacteria 1443
270 Ga0495675_0019843 3300047444 Bacteria 4271
271 Ga0495684_0019455 3300047471 Bacteria 5229
272 Ga0495593_0000507 3300047673 Bacteria 22002
273 Ga0495602_0014492 3300048088 Bacteria 8002
274 Ga0495602_0096242 3300048088 Bacteria 2442
275 Ga0496100_0006319 3300048903 Bacteria 6455
276 Ga0496101_0001371 3300048904 Bacteria 14598
277 Ga0496101_0048458 3300048904 Bacteria 3054
278 Ga0496101_0164369 3300048904 Bacteria 1703
279 Ga0496102_0076181 3300048905 Bacteria 3085
280 Ga0496102_0123369 3300048905 Bacteria 2420
281 Ga0496102_0144899 3300048905 Bacteria 2229
282 Ga0496103_0027225 3300048906 Bacteria 3462
283 Ga0496103_0070955 3300048906 Bacteria 2179
284 Ga0496104_0002541 3300048907 Bacteria 15713
285 Ga0496104_0012218 3300048907 Bacteria 7716
286 Ga0496104_0036176 3300048907 Bacteria 4614
287 Ga0496105_0010862 3300048908 Bacteria 7171
288 Ga0496105_0024476 3300048908 Bacteria 4905
289 Ga0496106_0086054 3300048909 Bacteria 2420
290 Ga0496106_0120682 3300048909 Bacteria 2049
291 Ga0496106_0249455 3300048909 Bacteria 1419
292 Ga0496107_0009465 3300048910 Bacteria 6758
293 Ga0496107_0094222 3300048910 Bacteria 2191
294 Ga0496107_0100033 3300048910 Bacteria 2125
295 Ga0496108_0000400 3300048911 Bacteria 35840
296 Ga0496108_0177061 3300048911 Bacteria 1846
297 Ga0496108_0247509 3300048911 Bacteria 1550
298 Ga0496108_0255014 3300048911 Bacteria 1526
299 Ga0496108_0429488 3300048911 Bacteria 1154
300 Ga0496109_0006999 3300048912 Bacteria 9515
301 Ga0496109_0025942 3300048912 Bacteria 5222
302 Ga0496109_0087803 3300048912 Bacteria 2873
303 Ga0496109_0167733 3300048912 Bacteria 2059
304 Ga0496110_0057513 3300048913 Bacteria 3423
305 Ga0496110_0098667 3300048913 Bacteria 2618
306 Ga0496110_0171670 3300048913 Bacteria 1967
307 Ga0496111_0006934 3300048914 Bacteria 7393
308 Ga0496111_0074747 3300048914 Bacteria 2468
309 Ga0496111_0090445 3300048914 Bacteria 2242
310 Ga0496112_0046527 3300048915 Bacteria 4255
311 Ga0496112_0051740 3300048915 Bacteria 4029
312 Ga0496113_0001227 3300048916 Bacteria 14080
313 Ga0496113_0022160 3300048916 Bacteria 4488
314 Ga0496114_0011955 3300048917 Bacteria 6944
315 Ga0496114_0083065 3300048917 Bacteria 2709
316 Ga0496114_0084365 3300048917 Bacteria 2690
317 Ga0496115_0021831 3300048918 Bacteria 4950
318 Ga0496115_0036691 3300048918 Bacteria 3882
319 Ga0496115_0091684 3300048918 Bacteria 2483
320 Ga0496117_0070408 3300048920 Bacteria 2349
321 Ga0496118_0001954 3300048921 Bacteria 29211
322 Ga0501031_0147361 3300049568 Bacteria 1538
323 Ga0501032_0001595 3300049569 Bacteria 18073
324 Ga0501033_0002285 3300049570 Bacteria 16380
325 Ga0501034_0117864 3300049571 Bacteria 2642
326 Ga0501036_0053874 3300049572 Bacteria 3405
327 Ga0501036_0150328 3300049572 Bacteria 1964
328 Ga0501037_0002019 3300049573 Bacteria 14709
329 Ga0501037_0094434 3300049573 Bacteria 2163
330 Ga0501037_0175271 3300049573 Bacteria 1523
331 Ga0501038_0001316 3300049574 Bacteria 22600
332 Ga0501039_0010528 3300049575 Bacteria 7047
333 Ga0501039_0011662 3300049575 Bacteria 6694
334 Ga0501039_0019878 3300049575 Bacteria 5147
335 Ga0501040_0265646 3300049576 Bacteria 1225
336 Ga0501040_0268312 3300049576 Bacteria 1218
337 Ga0501041_0005434 3300049577 Bacteria 7463
338 Ga0501042_0022802 3300049578 Bacteria 4375
339 Ga0501043_0002212 3300049579 Bacteria 16592
340 Ga0501046_0003360 3300049580 Bacteria 14699
341 Ga0501047_0032565 3300049581 Bacteria 5032
342 Ga0501047_0040611 3300049581 Bacteria 4498
343 Ga0501048_0042524 3300049582 Bacteria 3253
344 Ga0501067_0172715 3300049583 Bacteria 1204
345 Ga0501068_0023767 3300049584 Bacteria 3594
346 Ga0501068_0092573 3300049584 Bacteria 1866
347 Ga0501068_0101893 3300049584 Bacteria 1780
348 Ga0501069_0000546 3300049585 Bacteria 17246
349 Ga0501070_0001849 3300049586 Bacteria 18687
350 Ga0501070_0177072 3300049586 Bacteria 1756
351 Ga0501071_0019714 3300049587 Bacteria 4681
352 Ga0501072_0023344 3300049588 Bacteria 4804
353 Ga0501072_0051883 3300049588 Bacteria 3229
354 Ga0501073_0066221 3300049589 Bacteria 2518
355 Ga0501073_0127923 3300049589 Bacteria 1761
356 Ga0501073_0207922 3300049589 Bacteria 1352
357 Ga0501074_0001364 3300049590 Bacteria 16201
358 Ga0501074_0147042 3300049590 Bacteria 1685
359 Ga0501075_0008099 3300049591 Bacteria 7309
360 Ga0501075_0081024 3300049591 Bacteria 2457
361 Ga0501075_0143421 3300049591 Bacteria 1820
362 Ga0501076_0013521 3300049592 Bacteria 6119
363 Ga0501076_0023223 3300049592 Bacteria 4779
364 Ga0501076_0024096 3300049592 Bacteria 4701
365 Ga0501076_0075557 3300049592 Bacteria 2701
366 Ga0501076_0124170 3300049592 Bacteria 2091
367 Ga0501077_0013022 3300049593 Bacteria 5211
368 Ga0501077_0042283 3300049593 Bacteria 2898
369 Ga0501077_0050309 3300049593 Bacteria 2649
370 Ga0501077_0069520 3300049593 Bacteria 2232
371 Ga0501079_0032489 3300049741 Bacteria 4012
372 Ga0501079_0059507 3300049741 Bacteria 2946
373 Ga0501079_0079826 3300049741 Bacteria 2530
374 Ga0501079_0082529 3300049741 Bacteria 2486
375 Ga0501079_0291020 3300049741 Bacteria 1277
376 Ga0501080_0043994 3300049742 Bacteria 4157
377 Ga0501080_0145914 3300049742 Bacteria 2187
378 Ga0501080_0186976 3300049742 Bacteria 1904
379 Ga0501081_0003208 3300049743 Bacteria 10393
380 Ga0501081_0123367 3300049743 Bacteria 1847
381 Ga0501081_0341073 3300049743 Bacteria 1103
382 Ga0501083_0001580 3300049744 Bacteria 15555
383 Ga0501035_0011320 3300049822 Bacteria 8268
384 Ga0501044_0006679 3300049823 Bacteria 12720
385 Ga0501044_0007561 3300049823 Bacteria 11945
386 Ga0501045_0004385 3300049824 Bacteria 9727
387 Ga0501045_0020997 3300049824 Bacteria 4668
388 Ga0501045_0104761 3300049824 Bacteria 2096
389 nmdc:mga0yw44_107275_c1 3300050492 Bacteria 1786
390 nmdc:mga0yw44_109880_c1 3300050492 Bacteria 1766
391 nmdc:mga0yw44_58815_c1 3300050492 Bacteria 2349
392 nmdc:mga05p37_20526_c1 3300050507 Bacteria 7993
393 nmdc:mga05p37_227294_c1 3300050507 Bacteria 2249
394 nmdc:mga05p37_2380_c1 3300050507 Bacteria 21888
395 nmdc:mga05p37_365632_c1 3300050507 Bacteria 1694
396 nmdc:mga09592_193505_c1 3300050508 Bacteria 1760
397 nmdc:mga09592_83883_c1 3300050508 Bacteria 2716
398 nmdc:mga0qj67_237580_c1 3300050509 Bacteria 1478
399 nmdc:mga0qj67_7_c1 3300050509 Bacteria 146944
400 nmdc:mga06r32_15113_c1 3300050510 Bacteria 7009
401 nmdc:mga06r32_25821_c1 3300050510 Bacteria 5468
402 nmdc:mga08y16_40487_c1 3300050511 Bacteria 4885
403 nmdc:mga08y16_89603_c1 3300050511 Bacteria 3205
404 nmdc:mga0n895_239812_c1 3300050512 Bacteria 1840
405 nmdc:mga0n895_39599_c1 3300050512 Bacteria 4574
406 nmdc:mga0n895_52147_c1 3300050512 Bacteria 4014
407 nmdc:mga0rr50_182705_c1 3300050513 Bacteria 1715
408 nmdc:mga0a205_361842_c1 3300050515 Bacteria 1317
409 nmdc:mga0a205_88843_c1 3300050515 Bacteria 2987
410 Ga0495601_0042712 3300053077 Bacteria 2845
411 Ga0495612_0019679 3300053078 Bacteria 2704
412 Ga0495612_0065156 3300053078 Bacteria 1513
413 Ga0495655_0000868 3300053083 Bacteria 4720
414 Ga0495655_0006147 3300053083 Bacteria 2166
415 Ga0495595_0017048 3300053084 Bacteria 3119
416 Ga0495595_0069019 3300053084 Bacteria 1668
417 Ga0495619_0002745 3300053085 Bacteria 11493
418 Ga0495619_0019823 3300053085 Bacteria 4280
419 Ga0495619_0181200 3300053085 Bacteria 1457
420 Ga0500578_0017731 3300053086 Bacteria 4574
421 Ga0500595_000920 3300053119 Bacteria 16713
422 Ga0500608_000418 3300053122 Bacteria 16153
423 Ga0500604_0006233 3300053151 Bacteria 3150
424 Ga0500616_0003182 3300053153 Bacteria 12779
425 Ga0500622_0031809 3300053156 Bacteria 2769
426 Ga0501084_0041083 3300054114 Bacteria 3869
427 Ga0501084_0083900 3300054114 Bacteria 2675
428 Ga0501082_0021526 3300060353 Bacteria 5561
429 Ga0501082_0130000 3300060353 Bacteria 2185
430 Ga0501082_0204691 3300060353 Bacteria 1717
431 Ga0501082_0230785 3300060353 Bacteria 1611
432 Ga0501082_0435537 3300060353 Bacteria 1145
433 Ga0530510_0036012 3300061734 Bacteria 3567
434 2523466285 2523231067 Bacteria 5230452
435 2566035030 2565956521 Bacteria 4468993
436 2910248553 2910245624 Bacteria 6935613
437 2919500126 2919497567 Bacteria 4408621
438 Ga0496108_0155767
439 JGI24750J21931_1003643
440 Ga0055531_10010394
441 Ga0065714_10069458
442 Ga0070658_10008716
443 Ga0070676_10015337
444 Ga0070670_100019634
445 Ga0070670_100031342
446 Ga0068869_100154353
447 Ga0068868_100017520
448 Ga0068868_100018655
449 Ga0070691_10018416
450 Ga0070671_100014937
451 Ga0070688_100097148
452 Ga0070688_100110089
453 Ga0070659_100025537
454 Ga0070709_10002320
455 Ga0070709_10020459
456 Ga0070709_10142725
457 Ga0070714_100042525
458 Ga0070713_100127989
459 Ga0070713_100357851
460 Ga0070710_10019882
461 Ga0070701_10015532
462 Ga0070711_100029234
463 Ga0070700_100010594
464 Ga0070663_100179908
465 Ga0070699_100022843
466 Ga0070665_100090478
467 Ga0070665_100103809
468 Ga0070704_100249148
469 Ga0068855_100201439
470 Ga0070664_100025457
471 Ga0068859_100003463
472 Ga0068864_100013785
473 Ga0068864_100023798
474 Ga0068866_10040747
475 Ga0068861_100000036
476 Ga0068870_10007615
477 Ga0068863_100166067
478 Ga0068863_100529759
479 Ga0068858_100068011
480 Ga0068860_100313542
481 Ga0068862_100160951
482 Ga0081455_10001093
483 Ga0081455_10008132
484 Ga0081455_10014635
485 Ga0081455_10058351
486 Ga0081538_10014704
487 Ga0081538_10064428
488 Ga0081540_1001486
489 Ga0081539_10034110
490 Ga0070717_10008135
491 Ga0070717_10082767
492 Ga0075365_10070782
493 Ga0075365_10072523
494 Ga0075365_10089618
495 Ga0070715_10007822
496 Ga0070716_100005600
497 Ga0070716_100174403
498 Ga0070712_100000242
499 Ga0075362_10028524
500 Ga0068871_100081819
501 Ga0075428_100077346
502 Ga0075428_100201971
503 Ga0075428_100344657
504 Ga0075430_100000514
505 Ga0075431_100031466
506 Ga0075431_100035601
507 Ga0075431_100189572
508 Ga0075433_10099515
509 Ga0075433_10198616
510 Ga0075433_10330164
511 Ga0075434_100233128
512 Ga0075434_100392951
513 Ga0075434_100460057
514 Ga0097620_100003463
515 Ga0075435_100039123
516 Ga0111539_10161929
517 Ga0111539_10551540
518 Ga0105247_10007123
519 Ga0114129_10000908
520 Ga0114129_10039350
521 Ga0114129_10405695
522 Ga0105243_10080592
523 Ga0105248_10001524
524 Ga0105248_10022767
525 Ga0105248_10258214
526 Ga0105239_10002479
527 Ga0105246_10049816
528 Ga0163162_10151879
529 Ga0163163_10182476
530 Ga0157380_10009855
531 Ga0157379_10051895
532 Ga0157379_10229793
533 Ga0157376_10022637
534 Ga0213876_10047905
535 Ga0213875_10000116
536 Ga0228598_1005944
537 Ga0209758_1000061
538 Ga0207426_1009360
539 Ga0209257_1000553
540 Ga0207692_10003003
541 Ga0207692_10029524
542 Ga0207710_10005797
543 Ga0207688_10001814
544 Ga0207699_10009172
545 Ga0207699_10151396
546 Ga0207645_10007457
547 Ga0207643_10004469
548 Ga0207693_10002219
549 Ga0207693_10010142
550 Ga0207693_10012163
551 Ga0207663_10058610
552 Ga0207649_10081428
553 Ga0207681_10091718
554 Ga0207650_10035525
555 Ga0207687_10020649
556 Ga0207700_10043357
557 Ga0207700_10121301
558 Ga0207664_10001863
559 Ga0207644_10131951
560 Ga0207709_10120410
561 Ga0207670_10334984
562 Ga0207665_10000206
563 Ga0207665_10031000
564 Ga0207711_10000983
565 Ga0207711_10025757
566 Ga0207689_10028382
567 Ga0207679_10008925
568 Ga0207651_10022839
569 Ga0207668_10153556
570 Ga0207658_10126939
571 Ga0207677_10073761
572 Ga0207703_10071002
573 Ga0207641_10104786
574 Ga0207641_10388920
575 Ga0207641_10511458
576 Ga0207648_10005942
577 Ga0207676_10029192
578 Ga0207676_10065968
579 Ga0207674_10049763
580 Ga0207675_100000154
581 Ga0207675_100000915
582 Ga0207683_10007238
583 Ga0207698_10154959
584 Ga0268266_10159991
585 Ga0268265_10187891
586 Ga0265332_10027103
587 Ga0265329_10016274
588 Ga0265340_10024590
589 Ga0265339_10031166
590 Ga0265331_10037601
591 Ga0265316_10143532
592 Ga0307513_10328662
593 Ga0316578_10001884
594 Ga0373944_0002469
595 Ga0373953_0053968
596 Ga0373954_0019799
597 Ga0373954_0069825
598 Ga0373943_0016779
599 Ga0373943_0086670
600 Ga0373946_0019017
601 Ga0373955_0022295
602 Ga0373955_0031784
603 Ga0316574_0007944
604 Ga0373935_0038045
605 Ga0373935_0252350
606 Ga0373927_0083019
607 Ga0373933_0041194
608 Ga0373947_0010021
609 Ga0373947_0012500
610 Ga0373937_0004437
611 Ga0373937_0026707
612 Ga0316582_0000046
613 Ga0316584_0001452
614 Ga0316584_0045479
615 Ga0373925_0014674
616 Ga0373925_0034168
617 Ga0373925_0051697
618 Ga0395900_0094391
619 Ga0395900_0120204
620 Ga0316581_0000090
621 Ga0436364_0526930
622 Ga0436364_1018697
623 Ga0395901_0149452
624 Ga0400483_197669
625 Ga0436365_0514423
626 Ga0436365_0757108
627 Ga0436361_0260315
628 Ga0436363_0008889
629 Ga0436363_0916549
630 Ga0436363_1295064
631 Ga0466966_0068278
632 Ga0466963_0079521
633 Ga0466957_0008459
634 Ga0466960_0117787
635 Ga0466958_0026576
636 Ga0495592_0069988
637 Ga0495603_0005268
638 Ga0495603_0005681
639 Ga0495629_0010926
640 Ga0495629_0033873
641 Ga0495629_0080397
642 Ga0495629_0180415
643 Ga0495651_0093245
644 Ga0495651_0130357
645 Ga0495653_0050210
646 Ga0495580_0012125
647 Ga0495582_0012417
648 Ga0495582_0025796
649 Ga0495582_0163633
650 Ga0495639_0045156
651 Ga0495662_0018210
652 Ga0495662_0023708
653 Ga0495662_0027588
654 Ga0495662_0040083
655 Ga0495584_0003114
656 Ga0495594_0009133
657 Ga0495594_0011942
658 Ga0495607_0067674
659 Ga0495608_0094521
660 Ga0495618_0047213
661 Ga0495628_0013726
662 Ga0495630_0055688
663 Ga0495630_0170294
664 Ga0495631_0107910
665 Ga0495644_0042391
666 Ga0495666_0057261
667 Ga0495665_0021854
668 Ga0495665_0023517
669 Ga0495640_0067118
670 Ga0495640_0073652
671 Ga0495640_0088023
672 Ga0495587_0060435
673 Ga0495587_0113992
674 Ga0495598_0010763
675 Ga0495609_0042235
676 Ga0495667_0023611
677 Ga0495667_0035638
678 Ga0495656_0038377
679 Ga0495656_0070311
680 Ga0495634_0020450
681 Ga0495611_0069488
682 Ga0495661_0103994
683 Ga0495588_0005463
684 Ga0495599_0026694
685 Ga0495623_0123810
686 Ga0495647_0060507
687 Ga0495658_0005157
688 Ga0495658_0010269
689 Ga0495658_0012074
690 Ga0495613_0001434
691 Ga0495613_0032249
692 Ga0495613_0180270
693 Ga0495624_0045692
694 Ga0495670_0073206
695 Ga0495600_0081949
696 Ga0495581_0036879
697 Ga0495581_0049297
698 Ga0495604_0121524
699 Ga0495604_0133706
700 Ga0495604_0148969
701 Ga0495674_0189286
702 Ga0495672_0066345
703 Ga0495676_0014118
704 Ga0495680_0007941
705 Ga0495680_0109247
706 Ga0495680_0197936
707 Ga0495675_0019843
708 Ga0495684_0019455
709 Ga0495593_0000507
710 Ga0495602_0014492
711 Ga0495602_0096242
712 Ga0496100_0006319
713 Ga0496101_0001371
714 Ga0496101_0048458
715 Ga0496101_0164369
716 Ga0496102_0076181
717 Ga0496102_0123369
718 Ga0496102_0144899
719 Ga0496103_0027225
720 Ga0496103_0070955
721 Ga0496104_0002541
722 Ga0496104_0012218
723 Ga0496104_0036176
724 Ga0496105_0010862
725 Ga0496105_0024476
726 Ga0496106_0086054
727 Ga0496106_0120682
728 Ga0496106_0249455
729 Ga0496107_0009465
730 Ga0496107_0094222
731 Ga0496107_0100033
732 Ga0496108_0000400
733 Ga0496108_0177061
734 Ga0496108_0247509
735 Ga0496108_0255014
736 Ga0496108_0429488
737 Ga0496109_0006999
738 Ga0496109_0025942
739 Ga0496109_0087803
740 Ga0496109_0167733
741 Ga0496110_0057513
742 Ga0496110_0098667
743 Ga0496110_0171670
744 Ga0496111_0006934
745 Ga0496111_0074747
746 Ga0496111_0090445
747 Ga0496112_0046527
748 Ga0496112_0051740
749 Ga0496113_0001227
750 Ga0496113_0022160
751 Ga0496114_0011955
752 Ga0496114_0083065
753 Ga0496114_0084365
754 Ga0496115_0021831
755 Ga0496115_0036691
756 Ga0496115_0091684
757 Ga0496117_0070408
758 Ga0496118_0001954
759 Ga0501031_0147361
760 Ga0501032_0001595
761 Ga0501033_0002285
762 Ga0501034_0117864
763 Ga0501036_0053874
764 Ga0501036_0150328
765 Ga0501037_0002019
766 Ga0501037_0094434
767 Ga0501037_0175271
768 Ga0501038_0001316
769 Ga0501039_0010528
770 Ga0501039_0011662
771 Ga0501039_0019878
772 Ga0501040_0265646
773 Ga0501040_0268312
774 Ga0501041_0005434
775 Ga0501042_0022802
776 Ga0501043_0002212
777 Ga0501046_0003360
778 Ga0501047_0032565
779 Ga0501047_0040611
780 Ga0501048_0042524
781 Ga0501067_0172715
782 Ga0501068_0023767
783 Ga0501068_0092573
784 Ga0501068_0101893
785 Ga0501069_0000546
786 Ga0501070_0001849
787 Ga0501070_0177072
788 Ga0501071_0019714
789 Ga0501072_0023344
790 Ga0501072_0051883
791 Ga0501073_0066221
792 Ga0501073_0127923
793 Ga0501073_0207922
794 Ga0501074_0001364
795 Ga0501074_0147042
796 Ga0501075_0008099
797 Ga0501075_0081024
798 Ga0501075_0143421
799 Ga0501076_0013521
800 Ga0501076_0023223
801 Ga0501076_0024096
802 Ga0501076_0075557
803 Ga0501076_0124170
804 Ga0501077_0013022
805 Ga0501077_0042283
806 Ga0501077_0050309
807 Ga0501077_0069520
808 Ga0501079_0032489
809 Ga0501079_0059507
810 Ga0501079_0079826
811 Ga0501079_0082529
812 Ga0501079_0291020
813 Ga0501080_0043994
814 Ga0501080_0145914
815 Ga0501080_0186976
816 Ga0501081_0003208
817 Ga0501081_0123367
818 Ga0501081_0341073
819 Ga0501083_0001580
820 Ga0501035_0011320
821 Ga0501044_0006679
822 Ga0501044_0007561
823 Ga0501045_0004385
824 Ga0501045_0020997
825 Ga0501045_0104761
826 nmdc:mga0yw44_107275_c1
827 nmdc:mga0yw44_109880_c1
828 nmdc:mga0yw44_58815_c1
829 nmdc:mga05p37_20526_c1
830 nmdc:mga05p37_227294_c1
831 nmdc:mga05p37_2380_c1
832 nmdc:mga05p37_365632_c1
833 nmdc:mga09592_193505_c1
834 nmdc:mga09592_83883_c1
835 nmdc:mga0qj67_237580_c1
836 nmdc:mga0qj67_7_c1
837 nmdc:mga06r32_15113_c1
838 nmdc:mga06r32_25821_c1
839 nmdc:mga08y16_40487_c1
840 nmdc:mga08y16_89603_c1
841 nmdc:mga0n895_239812_c1
842 nmdc:mga0n895_39599_c1
843 nmdc:mga0n895_52147_c1
844 nmdc:mga0rr50_182705_c1
845 nmdc:mga0a205_361842_c1
846 nmdc:mga0a205_88843_c1
847 Ga0495601_0042712
848 Ga0495612_0019679
849 Ga0495612_0065156
850 Ga0495655_0000868
851 Ga0495655_0006147
852 Ga0495595_0017048
853 Ga0495595_0069019
854 Ga0495619_0002745
855 Ga0495619_0019823
856 Ga0495619_0181200
857 Ga0500578_0017731
858 Ga0500595_000920
859 Ga0500608_000418
860 Ga0500604_0006233
861 Ga0500616_0003182
862 Ga0500622_0031809
863 Ga0501084_0041083
864 Ga0501084_0083900
865 Ga0501082_0021526
866 Ga0501082_0130000
867 Ga0501082_0204691
868 Ga0501082_0230785
869 Ga0501082_0435537
870 Ga0530510_0036012
871 2523466285
872 2566035030
873 2910248553
874 2919500126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01262

AlaDh_PNT_C

Alanine dehydrogenase/PNT, C-terminal domain

119

323

0.98

PF05222

AlaDh_PNT_N

Alanine dehydrogenase/PNT, N-terminal domain

4

115

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vhx-assembly1.cif.gz_A crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate 0.9846 1 370
2vhx-assembly1.cif.gz_D crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate 0.9813 1 368
2vhx-assembly1.cif.gz_A crystal structure of the ternary complex of l-alanine dehydrogenase from mycobacterium tuberculosis with nad+ and pyruvate 0.9793 1 370
2eez-assembly1.cif.gz_F crystal structure of alanine dehydrogenase from themus thermophilus 0.974 1 372
2vhv-assembly1.cif.gz_A crystal structure of the d270a mutant of l-alanine dehydrogenase from mycobacterium tuberculosis in complex with nadh. 0.9739 1 370
ID Description Score Start End Superfamily
af_P9WQB1_2_113_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.993 3 112 3.40.50.720
af_Q2FXL7_2_109_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.986 3 109 3.40.50.720
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9858 169 201 3.50.50.60
2vhxC02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9842 130 304 3.40.50.720
2eezG01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9816 1 372 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q6F4U4-F1-model_v4 deleted 1.002 1 94
AF-A0A1V1RFU7-F1-model_v4 Alanine dehydrogenase 1.001 1 120 GO:0000286
GO:0005886
GO:0006524
AF-A0A0L0EMH6-F1-model_v4 Alanine dehydrogenase 1 1 111 GO:0000286
GO:0005886
GO:0006524
AF-A0A2N7HR28-F1-model_v4 Alanine dehydrogenase/pyridine nucleotide transhydrogenase N-terminal domain-containing protein 1 1 95 GO:0000286
GO:0005886
GO:0006524
AF-A0A7Y7IS93-F1-model_v4 Alanine dehydrogenase 0.9998 1 94 GO:0000286
GO:0005886
GO:0006524

Map