F443443

General Info

Members Datasets Scaffolds Average Seq Length
435 287 380 268

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2984514374|2984517662
Length 292
Sequence DIGANLTHDSFDRDRDAVLARARDAGVVQMVLTGASREHSPMALDLARQHPGFLYATAGVHPHHAVEYTDECDAEMRALHAHAEVVAVGECGLDYFRDFAPRPAQHRAFERQLQLASEVRAAAGQRKPLFLHQRDAHADFMAQMKNFDGRIGAAVVHCFTGERQELFDYLDQDWYIGITGWLCDERRGAHLRELVKHIPAERLMIETDAPYLLPRSLKPMPKDRRNEPMFLAHIVEELARGPRRGCGADRSERHRSDAHVLPPARRALTRPCRVAALVGSHPDRPPIPMGRP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2571042365 Lysobacter oryzae DSM 21044 Isolate Rhizosphere
3 2576861471 Stenotrophomonas rhizophila DSM 14405 Isolate Rhizosphere
4 2643221559 Lysobacter sp. Root559 Isolate Unclassified
5 2643221573 Lysobacter sp. Root604 Isolate Unclassified
6 2643221579 Pseudoxanthomonas sp. Root630 Isolate Unclassified
7 2643221586 Lysobacter sp. Root667 Isolate Unclassified
8 2643221593 Lysobacter sp. Root690 Isolate Unclassified
9 2643221612 Lysobacter sp. Root76 Isolate Unclassified
10 2643221695 Lysobacter sp. Root494 Isolate Unclassified
11 2643221720 Lysobacter sp. Root916 Isolate Unclassified
12 2643221727 Lysobacter sp. Root96 Isolate Unclassified
13 2643221728 Lysobacter sp. Root983 Isolate Unclassified
14 2747842428 Stenotrophomonas sp. WCS2014-113 Isolate Unclassified
15 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
16 2765235840 Stenotrophomonas maltophilia AA1 Isolate Unclassified
17 2816332141 Stenotrophomonas muris 1190 (v2) (version 2) Isolate Unclassified
18 2818991457 Xanthomonas translucens 569 Isolate Unclassified
19 2842391507 Stenotrophomonas maltophilia SEMIA 4027 Isolate Nodule
20 2842757796 Stenotrophomonas sp. R-72406 Isolate Unclassified
21 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified
22 2852649853 Stenotrophomonas sp. JAI102 Isolate Rhizosphere
23 2852684882 Xanthomonas sp. JAI131 Isolate Rhizosphere
24 2857442823 Stenotrophomonas sp. R-74235 Isolate Unclassified
25 2874220319 Stenotrophomonas maltophilia PS5 Isolate Unclassified
26 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
27 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
28 2894414249 Luteimonas sp. LNNU 24178 Isolate Rhizosphere
29 2895498888 Pseudoxanthomonas sp. SGD-10 Isolate Rhizosphere
30 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
31 2895522137 Pseudoxanthomonas sp. SGNA-20 Isolate Rhizosphere
32 2895525241 Pseudoxanthomonas sp. SGT-18 Isolate Rhizosphere
33 2919089067 Stenotrophomonas sp. 1337 Isolate Rhizosphere
34 2919134579 Stenotrophomonas geniculata 1733 Isolate Rhizosphere
35 2919513703 Luteimonas sp. 3794 Isolate Unclassified
36 2928496128 Stenotrophomonas indicatrix 1163 Isolate Unclassified
37 2931380184 Stenotrophomonas sp. DR822 Isolate Rhizosphere
38 2937610967 Stenotrophomonas maltophilia EP20 Isolate Unclassified
39 2939589442 Stenotrophomonas rhizophila 716 Isolate Rhizosphere
40 2939622612 Stenotrophomonas sp. 2619 Isolate Rhizosphere
41 2939626828 Stenotrophomonas sp. 2694 Isolate Rhizosphere
42 2941475908 Stenotrophomonas rhizophila 2680 Isolate Rhizosphere
43 2961047084 Stenotrophomonas maltophilia EP5 Isolate Unclassified
44 2961064222 Stenotrophomonas maltophilia EP13 Isolate Unclassified
45 2974307012 Stenotrophomonas sp. SORGH_AS_0282 Isolate Unclassified
46 2977247770 Stenotrophomonas rhizophila SORGH_AS 457 Isolate Unclassified
47 2984514374 Stenotrophomonas sp. SORGH_AS282 Isolate Aerial Root
48 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
49 2995948881 Lysobacter enzymogenes B25 Isolate Unclassified
50 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
51 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
52 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
53 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
54 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
55 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
56 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
57 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
58 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
59 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
60 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
61 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
62 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
63 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
64 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
65 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
66 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
67 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
68 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
69 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
70 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
71 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
72 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
73 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
77 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
78 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
79 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
80 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
81 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
82 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
83 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
84 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
85 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
86 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
87 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
88 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
89 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
90 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
91 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
99 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
126 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
128 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
171 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
184 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
185 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
186 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
187 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
188 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
189 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
190 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
191 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
192 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
193 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
194 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
195 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
196 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
197 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
198 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
199 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
200 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
201 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
202 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
203 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
204 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
205 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
206 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
209 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
213 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
214 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
215 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
218 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
219 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
220 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
221 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
228 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
229 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
230 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
231 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
232 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
233 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
234 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
235 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
236 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
237 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
238 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
239 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
240 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
257 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
258 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
259 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
260 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
261 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
266 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
275 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
276 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
277 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
281 8002869464 Pseudoxanthomonas helianthi 110414 Isolate Unclassified
282 8003014200 Lysobacter changpingensis Cm-3-T8 Isolate Rhizosphere
283 8004592986 Serratia sp. S119 Isolate Unclassified
284 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
285 8021622325 Xanthomonas sp. LMG12462 Isolate Rhizosphere
286 8021626552 Xanthomonas sp. LMG12460 Isolate Rhizosphere
287 8021648035 Xanthomonas sp. LMG 12461 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.36
Metatranscriptomes 0
Isolates 12.64

Biome Distribution

Category Percentage (%)
Aerial Root 0.23
Bulb 0
Endosphere 10.8
Nodule 0.23
Rhizoplane 2.07
Rhizosphere 68.74
Stem 0
Stem Tuber 0
Unclassified 17.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2618184 2162886007 Bacteria 2735
2 Ga0055526_1001691 3300003771 Bacteria 15416
3 Ga0055537_1001178 3300003773 Bacteria 11171
4 Ga0055524_1004528 3300003775 Bacteria 6401
5 Ga0055524_1018755 3300003775 Bacteria 2391
6 Ga0055536_1004855 3300003781 Bacteria 6714
7 Ga0055536_1039561 3300003781 Bacteria 1131
8 Ga0055534_1000209 3300003784 Bacteria 43174
9 Ga0055528_1000205 3300003790 Bacteria 50027
10 Ga0055530_10000466 3300003791 Bacteria 35440
11 Ga0055530_10000918 3300003791 Bacteria 24170
12 Ga0055531_10003214 3300003794 Bacteria 10489
13 Ga0058692_1000004 3300003856 Bacteria 431119
14 Ga0065704_10000910 3300005289 Bacteria 11133
15 Ga0065704_10083162 3300005289 Bacteria 3500
16 Ga0065704_10226434 3300005289 Bacteria 1057
17 Ga0065715_10105119 3300005293 Bacteria 2914
18 Ga0070676_10032125 3300005328 Bacteria 3005
19 Ga0070690_100088489 3300005330 Bacteria 2036
20 Ga0070670_100000521 3300005331 Bacteria 30818
21 Ga0070670_100226863 3300005331 Bacteria 1625
22 Ga0070666_10063885 3300005335 Unclassified 2496
23 Ga0070680_100054879 3300005336 Bacteria 3255
24 Ga0070661_100037920 3300005344 Bacteria 3507
25 Ga0070668_100126104 3300005347 Bacteria 2051
26 Ga0070671_100000643 3300005355 Bacteria 25018
27 Ga0070671_100016581 3300005355 Bacteria 5955
28 Ga0070671_100115682 3300005355 Bacteria 2255
29 Ga0070659_100319844 3300005366 Bacteria 1297
30 Ga0070700_100024036 3300005441 Bacteria 3573
31 Ga0070694_100154940 3300005444 Bacteria 1676
32 Ga0070678_100067242 3300005456 Bacteria 2666
33 Ga0070662_100207812 3300005457 Bacteria 1556
34 Ga0068853_100008620 3300005539 Bacteria 8198
35 Ga0068853_100353738 3300005539 Bacteria 1367
36 Ga0070672_100012079 3300005543 Bacteria 6044
37 Ga0070696_100444191 3300005546 Unclassified 1022
38 Ga0070665_100045918 3300005548 Bacteria 4387
39 Ga0070665_100157502 3300005548 Bacteria 2273
40 Ga0070665_100425987 3300005548 Bacteria 1336
41 Ga0070704_100004579 3300005549 Bacteria 7994
42 Ga0068855_100016857 3300005563 Bacteria 8787
43 Ga0068854_100015747 3300005578 Bacteria 5020
44 Ga0068854_100127911 3300005578 Bacteria 1937
45 Ga0068856_100005100 3300005614 Bacteria 12981
46 Ga0068856_100084078 3300005614 Bacteria 3161
47 Ga0068852_100035790 3300005616 Bacteria 4145
48 Ga0068852_100095327 3300005616 Bacteria 2672
49 Ga0068859_100033012 3300005617 Bacteria 5199
50 Ga0068859_100394569 3300005617 Bacteria 1479
51 Ga0068861_100034912 3300005719 Bacteria 3721
52 Ga0068870_10023040 3300005840 Bacteria 3066
53 Ga0068863_100155199 3300005841 Bacteria 2191
54 Ga0068858_100126514 3300005842 Bacteria 2393
55 Ga0068862_100020321 3300005844 Bacteria 5546
56 Ga0075365_10232296 3300006038 Bacteria 1295
57 Ga0075363_100088709 3300006048 Bacteria 1700
58 Ga0075364_10005832 3300006051 Bacteria 7189
59 Ga0075364_10213926 3300006051 Bacteria 1307
60 Ga0097621_100042831 3300006237 Bacteria 3647
61 Ga0068871_100055339 3300006358 Bacteria 3221
62 Ga0075428_100002661 3300006844 Bacteria 19398
63 Ga0075428_100041153 3300006844 Bacteria 5083
64 Ga0075431_100028730 3300006847 Bacteria 5718
65 Ga0075431_100112298 3300006847 Bacteria 2812
66 Ga0075431_100211370 3300006847 Bacteria 1981
67 Ga0075431_100373287 3300006847 Bacteria 1431
68 Ga0075429_100000358 3300006880 Bacteria 33554
69 Ga0097620_100033012 3300006931 Bacteria 5199
70 Ga0097620_100394560 3300006931 Bacteria 1479
71 Ga0105251_10000017 3300009011 Bacteria 145921
72 Ga0105251_10004152 3300009011 Bacteria 10085
73 Ga0105244_10012689 3300009036 Bacteria 4968
74 Ga0105240_10020191 3300009093 Bacteria 8892
75 Ga0111539_10389912 3300009094 Bacteria 1622
76 Ga0105247_10004858 3300009101 Bacteria 8550
77 Ga0114129_10067170 3300009147 Bacteria 5001
78 Ga0114129_10779943 3300009147 Bacteria 1221
79 Ga0105243_10001543 3300009148 Bacteria 20124
80 Ga0105241_10039806 3300009174 Bacteria 3546
81 Ga0105241_10217131 3300009174 Bacteria 1605
82 Ga0105242_10118820 3300009176 Bacteria 2265
83 Ga0105248_10085737 3300009177 Bacteria 3544
84 Ga0105248_10266070 3300009177 Bacteria 1930
85 Ga0105248_10779939 3300009177 Bacteria 1079
86 Ga0105237_10130902 3300009545 Bacteria 2503
87 Ga0105238_10000893 3300009551 Bacteria 30700
88 Ga0105238_10013033 3300009551 Bacteria 8390
89 Ga0105249_10055368 3300009553 Unclassified 3628
90 Ga0105249_10222890 3300009553 Bacteria 1856
91 Ga0105239_10002208 3300010375 Bacteria 24996
92 Ga0105239_10019743 3300010375 Bacteria 7438
93 Ga0105239_10035996 3300010375 Bacteria 5434
94 Ga0105239_10144256 3300010375 Bacteria 2654
95 Ga0105239_10448016 3300010375 Bacteria 1464
96 Ga0105246_10226322 3300011119 Bacteria 1470
97 Ga0105246_10253272 3300011119 Bacteria 1398
98 Ga0157373_10036271 3300013100 Bacteria 3540
99 Ga0157373_10060440 3300013100 Bacteria 2685
100 Ga0157373_10066857 3300013100 Bacteria 2542
101 Ga0157373_10067455 3300013100 Bacteria 2530
102 Ga0157371_10000158 3300013102 Bacteria 99529
103 Ga0157371_10009111 3300013102 Bacteria 7842
104 Ga0157371_10051932 3300013102 Bacteria 2912
105 Ga0157371_10232344 3300013102 Bacteria 1326
106 Ga0157370_10019904 3300013104 Bacteria 6714
107 Ga0157370_10022280 3300013104 Bacteria 6305
108 Ga0157369_10068091 3300013105 Bacteria 3825
109 Ga0157374_10005738 3300013296 Bacteria 10474
110 Ga0157374_10108010 3300013296 Bacteria 2674
111 Ga0157374_10467125 3300013296 Bacteria 1264
112 Ga0157378_10082436 3300013297 Bacteria 2908
113 Ga0157372_10011925 3300013307 Bacteria 9261
114 Ga0157372_10952928 3300013307 Bacteria 995
115 Ga0163163_10015307 3300014325 Bacteria 7088
116 Ga0182008_10000063 3300014497 Bacteria 89315
117 Ga0157376_10005297 3300014969 Bacteria 9010
118 Ga0157376_10229373 3300014969 Bacteria 1724
119 Ga0182006_1007487 3300015261 Bacteria 4994
120 Ga0163161_10019733 3300017792 Bacteria 4729
121 Ga0163161_10078221 3300017792 Bacteria 2431
122 Ga0163161_10093543 3300017792 Bacteria 2227
123 Ga0163161_10116826 3300017792 Bacteria 2000
124 Ga0209565_1000051 3300025263 Bacteria 212284
125 Ga0209673_1000581 3300025273 Bacteria 57816
126 Ga0209130_1001972 3300025284 Bacteria 11320
127 Ga0209130_1010817 3300025284 Bacteria 2485
128 Ga0209675_1000007 3300025291 Bacteria 683430
129 Ga0209676_1000018 3300025292 Bacteria 631385
130 Ga0209676_1000143 3300025292 Bacteria 175267
131 Ga0209676_1007271 3300025292 Bacteria 5249
132 Ga0209676_1007366 3300025292 Bacteria 5181
133 Ga0209676_1032083 3300025292 Bacteria 1584
134 Ga0209025_1007372 3300025294 Bacteria 8229
135 Ga0209564_1016997 3300025295 Bacteria 2862
136 Ga0209050_1000109 3300025298 Bacteria 219706
137 Ga0209050_1000448 3300025298 Bacteria 74673
138 Ga0209050_1004386 3300025298 Bacteria 9576
139 Ga0209050_1049746 3300025298 Bacteria 1071
140 Ga0209256_1004587 3300025299 Bacteria 8555
141 Ga0209256_1006264 3300025299 Bacteria 6388
142 Ga0209051_1001121 3300025303 Bacteria 24474
143 Ga0209051_1013026 3300025303 Bacteria 3980
144 Ga0209257_1000035 3300025304 Bacteria 631463
145 Ga0209257_1000291 3300025304 Bacteria 110720
146 Ga0209257_1001986 3300025304 Bacteria 22000
147 Ga0209257_1003791 3300025304 Bacteria 12453
148 Ga0207713_1000350 3300025735 Bacteria 50507
149 Ga0207713_1017020 3300025735 Bacteria 3665
150 Ga0207710_10025471 3300025900 Bacteria 2552
151 Ga0207645_10002504 3300025907 Bacteria 14412
152 Ga0207643_10016449 3300025908 Bacteria 4035
153 Ga0207671_10303982 3300025914 Bacteria 1260
154 Ga0207649_10007406 3300025920 Bacteria 5972
155 Ga0207646_10145712 3300025922 Bacteria 2134
156 Ga0207694_10021458 3300025924 Bacteria 4895
157 Ga0207650_10001772 3300025925 Bacteria 15273
158 Ga0207644_10254366 3300025931 Bacteria 1402
159 Ga0207709_10001736 3300025935 Bacteria 14677
160 Ga0207669_10091461 3300025937 Bacteria 1982
161 Ga0207711_10054252 3300025941 Bacteria 3439
162 Ga0207667_10003198 3300025949 Bacteria 20239
163 Ga0207712_10173619 3300025961 Bacteria 1687
164 Ga0207668_10035178 3300025972 Bacteria 3333
165 Ga0207658_10116342 3300025986 Bacteria 2123
166 Ga0207703_10000852 3300026035 Bacteria 29895
167 Ga0207639_10001558 3300026041 Bacteria 15368
168 Ga0207702_10003381 3300026078 Bacteria 14620
169 Ga0207702_10034544 3300026078 Bacteria 4228
170 Ga0207641_10063693 3300026088 Bacteria 3150
171 Ga0207648_10004463 3300026089 Bacteria 14353
172 Ga0207675_100001367 3300026118 Bacteria 24451
173 Ga0207675_100272432 3300026118 Bacteria 1643
174 Ga0207683_10092576 3300026121 Bacteria 2693
175 Ga0207698_10046707 3300026142 Bacteria 3273
176 Ga0209371_1000018 3300027312 Bacteria 614700
177 Ga0209969_1019162 3300027360 Bacteria 1014
178 Ga0209999_1029229 3300027543 Bacteria 1023
179 Ga0210002_1000349 3300027617 Bacteria 6303
180 Ga0209983_1007359 3300027665 Bacteria 2256
181 Ga0209971_1001920 3300027682 Bacteria 5079
182 Ga0209971_1003131 3300027682 Bacteria 3949
183 Ga0209998_10008362 3300027717 Bacteria 2144
184 Ga0209974_10001592 3300027876 Bacteria 8214
185 Ga0268265_10203592 3300028380 Bacteria 1719
186 Ga0268256_1000016 3300030500 Bacteria 614700
187 Ga0314311_1054717 3300030733 Bacteria 3231
188 Ga0307408_100315369 3300031548 Bacteria 1315
189 Ga0316575_10006497 3300031665 Bacteria 4208
190 Ga0307413_10000205 3300031824 Bacteria 17234
191 Ga0307413_10219567 3300031824 Bacteria 1387
192 Ga0307406_10139487 3300031901 Bacteria 1714
193 Ga0307412_10001110 3300031911 Bacteria 15423
194 Ga0307412_10147767 3300031911 Bacteria 1730
195 Ga0307409_100131472 3300031995 Bacteria 2140
196 Ga0307414_10000556 3300032004 Bacteria 19466
197 Ga0307414_10006401 3300032004 Bacteria 6564
198 Ga0307414_10010764 3300032004 Bacteria 5330
199 Ga0307414_10022331 3300032004 Bacteria 3989
200 Ga0307414_10040755 3300032004 Bacteria 3139
201 Ga0307414_10293598 3300032004 Bacteria 1371
202 Ga0373939_0059716 3300035114 Bacteria 1210
203 Ga0373937_0067824 3300036401 Bacteria 3288
204 Ga0395898_0048957 3300037466 Bacteria 4143
205 Ga0395905_0051934 3300037471 Bacteria 3839
206 Ga0395905_0590780 3300037471 Bacteria 1012
207 Ga0395901_0166612 3300038443 Bacteria 2313
208 Ga0237819_01754 3300038705 Bacteria 5115
209 Ga0237819_04077 3300038705 Bacteria 2465
210 Ga0439436_0006539 3300041404 Bacteria 3579
211 Ga0439436_0008728 3300041404 Bacteria 3115
212 Ga0439436_0021598 3300041404 Bacteria 1911
213 Ga0439436_0034218 3300041404 Bacteria 1469
214 Ga0439439_0000944 3300041406 Bacteria 5408
215 Ga0439465_0004426 3300041413 Bacteria 4547
216 Ga0439465_0005064 3300041413 Bacteria 4229
217 Ga0439465_0041324 3300041413 Bacteria 1492
218 Ga0451791_1621637 3300041451 Bacteria 1132
219 Ga0451793_1076600 3300041452 Bacteria 2576
220 Ga0451800_1474571 3300041459 Bacteria 2447
221 Ga0451802_0471752 3300041460 Bacteria 1157
222 Ga0451807_2030523 3300041486 Bacteria 1450
223 Ga0451837_1838787 3300041494 Bacteria 1181
224 Ga0451841_0637662 3300041498 Bacteria 1080
225 Ga0439433_0021231 3300041999 Bacteria 1452
226 Ga0439445_0010327 3300042004 Bacteria 2208
227 Ga0439432_005649 3300042006 Bacteria 4498
228 Ga0439432_026015 3300042006 Bacteria 1916
229 Ga0439449_0000128 3300042007 Bacteria 25525
230 Ga0439449_0002865 3300042007 Bacteria 6705
231 Ga0439449_0004770 3300042007 Bacteria 5234
232 Ga0439449_0058314 3300042007 Bacteria 1425
233 Ga0439449_0069690 3300042007 Bacteria 1296
234 Ga0439452_052680 3300042010 Bacteria 928
235 Ga0450911_000408 3300042115 Bacteria 14198
236 Ga0450901_002848 3300042533 Bacteria 1835
237 Ga0451577_0007606 3300042876 Bacteria 10627
238 Ga0451576_0140619 3300045051 Bacteria 2517
239 Ga0466967_0466908 3300045976 Bacteria 1235
240 Ga0495627_018906 3300046453 Bacteria 2316
241 Ga0495638_0001147 3300046460 Bacteria 25579
242 Ga0495638_0153079 3300046460 Bacteria 1336
243 Ga0495607_0106625 3300046501 Bacteria 1491
244 Ga0495610_0006633 3300046512 Bacteria 7902
245 Ga0495610_0048259 3300046512 Bacteria 2091
246 Ga0495616_0031063 3300046513 Bacteria 2801
247 Ga0495616_0071175 3300046513 Bacteria 1682
248 Ga0495631_0001424 3300046518 Bacteria 14532
249 Ga0495632_0010431 3300046519 Bacteria 5505
250 Ga0495643_0000431 3300046522 Bacteria 54537
251 Ga0495663_0001401 3300046525 Bacteria 7605
252 Ga0495663_0001814 3300046525 Bacteria 6599
253 Ga0495663_0005192 3300046525 Bacteria 3625
254 Ga0495586_0232459 3300046535 Bacteria 1049
255 Ga0495633_0000416 3300046558 Bacteria 44195
256 Ga0495634_0229840 3300046642 Bacteria 1142
257 Ga0495658_0151681 3300046683 Unclassified 1424
258 Ga0495660_0031599 3300046810 Bacteria 2976
259 Ga0495672_0000069 3300047320 Bacteria 189627
260 Ga0495672_0035178 3300047320 Bacteria 3087
261 Ga0495687_046808 3300047443 Bacteria 1865
262 Ga0495681_0039474 3300047470 Bacteria 2305
263 Ga0495686_0004593 3300047472 Bacteria 11262
264 Ga0495686_0009193 3300047472 Bacteria 7153
265 Ga0496105_0053467 3300048908 Bacteria 3335
266 Ga0496112_0094595 3300048915 Bacteria 2958
267 Ga0496113_0097149 3300048916 Bacteria 2278
268 Ga0496115_0000037 3300048918 Bacteria 126108
269 Ga0496116_0001076 3300048919 Bacteria 32848
270 Ga0496117_0000176 3300048920 Bacteria 131822
271 Ga0496117_0002092 3300048920 Bacteria 26276
272 Ga0496117_0002761 3300048920 Bacteria 21506
273 Ga0496117_0004497 3300048920 Bacteria 15331
274 Ga0496117_0004512 3300048920 Bacteria 15295
275 Ga0496118_0000108 3300048921 Bacteria 153902
276 Ga0496118_0003829 3300048921 Bacteria 18513
277 Ga0496118_0004971 3300048921 Bacteria 15379
278 Ga0496118_0007513 3300048921 Bacteria 11525
279 Ga0496118_0050809 3300048921 Bacteria 3177
280 Ga0496118_0098281 3300048921 Bacteria 1988
281 Ga0496118_0151425 3300048921 Bacteria 1451
282 Ga0496119_0008943 3300048922 Bacteria 8698
283 Ga0496119_0014100 3300048922 Bacteria 6289
284 Ga0496120_0000758 3300048923 Bacteria 46757
285 Ga0496120_0001206 3300048923 Bacteria 32741
286 Ga0496120_0002793 3300048923 Bacteria 16925
287 Ga0496121_0003767 3300048924 Bacteria 21194
288 Ga0496121_0004576 3300048924 Bacteria 18444
289 Ga0496121_0057908 3300048924 Bacteria 3208
290 Ga0496121_0311622 3300048924 Bacteria 1063
291 Ga0496122_0000081 3300048925 Bacteria 211119
292 Ga0496122_0017195 3300048925 Bacteria 6777
293 Ga0496122_0022475 3300048925 Bacteria 5604
294 Ga0496123_0001058 3300048926 Bacteria 41642
295 Ga0496123_0007499 3300048926 Bacteria 10250
296 Ga0496123_0009088 3300048926 Bacteria 8998
297 Ga0496124_0000022 3300048927 Bacteria 421020
298 Ga0496124_0000304 3300048927 Bacteria 90806
299 Ga0496124_0000486 3300048927 Bacteria 68189
300 Ga0496124_0004337 3300048927 Bacteria 16621
301 Ga0496124_0005022 3300048927 Bacteria 15128
302 Ga0496124_0018340 3300048927 Bacteria 6554
303 Ga0496124_0031528 3300048927 Bacteria 4691
304 Ga0496124_0038138 3300048927 Bacteria 4173
305 Ga0496125_0000854 3300048928 Bacteria 48916
306 Ga0496125_0017587 3300048928 Bacteria 6811
307 Ga0496125_0063442 3300048928 Bacteria 2946
308 Ga0496125_0082438 3300048928 Bacteria 2451
309 Ga0496125_0143729 3300048928 Bacteria 1653
310 Ga0496126_0000112 3300048929 Bacteria 192755
311 Ga0496126_0001975 3300048929 Bacteria 29049
312 Ga0496126_0223866 3300048929 Bacteria 1579
313 Ga0495678_076094 3300049459 Bacteria 1217
314 Ga0501290_001093 3300049513 Bacteria 3856
315 Ga0501300_001540 3300049523 Bacteria 3460
316 Ga0501031_0000495 3300049568 Bacteria 22983
317 Ga0501033_0032965 3300049570 Bacteria 3889
318 Ga0501034_0008645 3300049571 Bacteria 10740
319 Ga0501034_0026742 3300049571 Bacteria 5871
320 Ga0501036_0018411 3300049572 Bacteria 5851
321 Ga0501037_0036547 3300049573 Bacteria 3620
322 Ga0501037_0071221 3300049573 Bacteria 2529
323 Ga0501038_0003363 3300049574 Bacteria 14915
324 Ga0501038_0011515 3300049574 Bacteria 8071
325 Ga0501039_0004389 3300049575 Bacteria 10633
326 Ga0501039_0081669 3300049575 Bacteria 2516
327 Ga0501040_0001655 3300049576 Bacteria 14238
328 Ga0501040_0026776 3300049576 Bacteria 3878
329 Ga0501040_0210051 3300049576 Bacteria 1384
330 Ga0501041_0194129 3300049577 Bacteria 1272
331 Ga0501042_0001772 3300049578 Bacteria 12908
332 Ga0501042_0021120 3300049578 Bacteria 4533
333 Ga0501043_0005077 3300049579 Bacteria 10651
334 Ga0501047_0138380 3300049581 Bacteria 2314
335 Ga0501068_0003032 3300049584 Bacteria 8966
336 Ga0501071_0000474 3300049587 Bacteria 20299
337 Ga0501071_0014050 3300049587 Bacteria 5471
338 Ga0501072_0000801 3300049588 Bacteria 23154
339 Ga0501072_0004520 3300049588 Bacteria 10577
340 Ga0501074_0015457 3300049590 Bacteria 5549
341 Ga0501074_0076670 3300049590 Bacteria 2399
342 Ga0501075_0019728 3300049591 Bacteria 4894
343 Ga0501076_0002157 3300049592 Bacteria 13487
344 Ga0501076_0003370 3300049592 Bacteria 11215
345 Ga0501077_0002929 3300049593 Bacteria 10243
346 Ga0501206_038031 3300049653 Bacteria 735
347 Ga0501225_0005020 3300049705 Bacteria 3909
348 Ga0501079_0000141 3300049741 Bacteria 39561
349 Ga0501079_0088167 3300049741 Bacteria 2402
350 Ga0501080_0001589 3300049742 Bacteria 19270
351 Ga0501080_0012651 3300049742 Bacteria 7738
352 Ga0501081_0001707 3300049743 Bacteria 13637
353 Ga0501081_0008426 3300049743 Bacteria 6696
354 Ga0501265_001371 3300049762 Bacteria 2756
355 Ga0501275_000394 3300049772 Bacteria 4989
356 Ga0501035_0013629 3300049822 Bacteria 7500
357 Ga0501035_0083460 3300049822 Bacteria 2819
358 Ga0501045_0001076 3300049824 Bacteria 18044
359 Ga0501045_0003938 3300049824 Bacteria 10227
360 nmdc:mga03n38_85842_c1 3300050490 Bacteria 1488
361 nmdc:mga00v17_148_c1 3300050491 Bacteria 40605
362 nmdc:mga00v17_56981_c1 3300050491 Bacteria 2390
363 nmdc:mga00v17_8299_c1 3300050491 Bacteria 5587
364 nmdc:mga05p37_421_c1 3300050507 Bacteria 45929
365 nmdc:mga05p37_663455_c1 3300050507 Bacteria 1165
366 nmdc:mga09592_224615_c1 3300050508 Bacteria 1627
367 nmdc:mga09592_44_c1 3300050508 Bacteria 69981
368 nmdc:mga06r32_203033_c1 3300050510 Bacteria 1970
369 nmdc:mga06r32_208711_c1 3300050510 Bacteria 1941
370 nmdc:mga06r32_34824_c1 3300050510 Bacteria 4750
371 Ga0500651_0000358 3300053093 Bacteria 25307
372 Ga0500626_009348 3300053128 Bacteria 4074
373 Ga0500622_0142786 3300053156 Bacteria 1140
374 Ga0500634_0000299 3300053161 Bacteria 15725
375 Ga0501084_0001657 3300054114 Bacteria 17724
376 Ga0501084_0085720 3300054114 Bacteria 2644
377 Ga0501082_0047490 3300060353 Bacteria 3700
378 Ga0501082_0088135 3300060353 Bacteria 2678
379 Ga0501082_0124944 3300060353 Bacteria 2231
380 Ga0530510_0004190 3300061734 Bacteria 9963

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041498 Ga0451841_0637662 Ga0451841_0637662_334_1050 232
2 3300049653 Ga0501206_038031 Ga0501206_038031_18_716 232
3 3300005366 Ga0070659_100319844 Ga0070659_1003198441 236
4 3300005617 Ga0068859_100394569 Ga0068859_1003945692 236
5 3300006931 Ga0097620_100394560 Ga0097620_1003945602 236
6 3300005616 Ga0068852_100095327 Ga0068852_1000953272 238
7 3300026142 Ga0207698_10046707 Ga0207698_100467072 238
8 3300009177 Ga0105248_10779939 Ga0105248_107799392 245
9 3300031824 Ga0307413_10219567 Ga0307413_102195672 245
10 3300041451 Ga0451791_1621637 Ga0451791_1621637_75_872 245
11 3300042876 Ga0451577_0007606 Ga0451577_0007606_5787_6593 245
12 3300005578 Ga0068854_100015747 Ga0068854_1000157473 247
13 3300009545 Ga0105237_10130902 Ga0105237_101309022 247
14 3300049576 Ga0501040_0210051 Ga0501040_0210051_528_1370 247
15 3300060353 Ga0501082_0088135 Ga0501082_0088135_1025_1867 247
16 3300005344 Ga0070661_100037920 Ga0070661_1000379204 248
17 3300005563 Ga0068855_100016857 Ga0068855_1000168575 248
18 3300005614 Ga0068856_100084078 Ga0068856_1000840781 248
19 3300005616 Ga0068852_100035790 Ga0068852_1000357903 248
20 3300009093 Ga0105240_10020191 Ga0105240_100201917 248
21 3300009174 Ga0105241_10039806 Ga0105241_100398063 248
22 3300009551 Ga0105238_10013033 Ga0105238_100130333 248
23 3300010375 Ga0105239_10019743 Ga0105239_100197434 248
24 3300013104 Ga0157370_10022280 Ga0157370_100222803 248
25 3300025920 Ga0207649_10007406 Ga0207649_100074064 248
26 3300025949 Ga0207667_10003198 Ga0207667_1000319816 248
27 3300026078 Ga0207702_10034544 Ga0207702_100345442 248
28 3300005539 Ga0068853_100008620 Ga0068853_1000086208 249
29 3300006051 Ga0075364_10005832 Ga0075364_100058324 249
30 3300013307 Ga0157372_10011925 Ga0157372_100119253 249
31 3300026041 Ga0207639_10001558 Ga0207639_100015585 249
32 3300041404 Ga0439436_0008728 Ga0439436_0008728_697_1491 249
33 3300049571 Ga0501034_0008645 Ga0501034_0008645_435_1250 249
34 3300050491 nmdc:mga00v17_148_c1 nmdc:mga00v17_148_c1_19139_19951 249
35 3300005355 Ga0070671_100016581 Ga0070671_1000165812 250
36 3300017792 Ga0163161_10078221 Ga0163161_100782213 250
37 3300025931 Ga0207644_10254366 Ga0207644_102543662 250
38 3300048915 Ga0496112_0094595 Ga0496112_0094595_1519_2325 250
39 3300048916 Ga0496113_0097149 Ga0496113_0097149_1430_2236 250
40 3300005293 Ga0065715_10105119 Ga0065715_101051192 251
41 3300006051 Ga0075364_10213926 Ga0075364_102139262 252
42 3300031901 Ga0307406_10139487 Ga0307406_101394872 252
43 3300049570 Ga0501033_0032965 Ga0501033_0032965_1275_2081 252
44 3300050491 nmdc:mga00v17_56981_c1 nmdc:mga00v17_56981_c1_716_1552 252
45 3300050491 nmdc:mga00v17_8299_c1 nmdc:mga00v17_8299_c1_4537_5373 252
46 3300025304 Ga0209257_1000291 Ga0209257_100029193 254
47 3300049568 Ga0501031_0000495 Ga0501031_0000495_5067_6053 254
48 3300046558 Ga0495633_0000416 Ga0495633_0000416_41074_41889 255
49 3300025298 Ga0209050_1049746 Ga0209050_10497462 256
50 iso_pu_bacteria 2888366609 2888366843 256
51 iso_pu_bacteria 2888373701 2888375502 256
52 iso_pu_bacteria 8004592986 8004593580 256
53 iso_pu_bacteria 8015394850 8015398360 256
54 3300031548 Ga0307408_100315369 Ga0307408_1003153692 257
55 3300041452 Ga0451793_1076600 Ga0451793_1076600_156_968 257
56 iso_pu_bacteria 2571042365 2572255651 258
57 iso_pu_bacteria 2842780639 2842784068 258
58 iso_pu_bacteria 2919513703 2919513849 258
59 iso_pu_bacteria 2842757796 2842761304 259
60 iso_pu_bacteria 2895498888 2895503311 259
61 iso_pu_bacteria 2895511927 2895513154 259
62 iso_pu_bacteria 2895522137 2895523149 259
63 iso_pu_bacteria 2895525241 2895527053 259
64 iso_pu_bacteria 2987605356 2987606853 259
65 3300030733 Ga0314311_1054717 Ga0314311_10547173 260
66 3300048922 Ga0496119_0014100 Ga0496119_0014100_3967_4749 260
67 3300048923 Ga0496120_0001206 Ga0496120_0001206_14222_15004 260
68 3300048927 Ga0496124_0000304 Ga0496124_0000304_14222_15004 260
69 3300048928 Ga0496125_0017587 Ga0496125_0017587_3776_4579 260
70 iso_pu_bacteria 2643221559 2643817358 260
71 iso_pu_bacteria 2643221573 2643879983 260
72 iso_pu_bacteria 2643221586 2643938071 260
73 iso_pu_bacteria 2643221593 2643974768 260
74 iso_pu_bacteria 2643221612 2644078386 260
75 iso_pu_bacteria 2643221720 2644662466 260
76 iso_pu_bacteria 2643221727 2644696832 260
77 iso_pu_bacteria 2643221728 2644701386 260
78 iso_pu_bacteria 2894414249 2894418115 260
79 iso_pu_bacteria 2995948881 2995954112 260
80 3300009094 Ga0111539_10389912 Ga0111539_103899122 261
81 3300010375 Ga0105239_10002208 Ga0105239_1000220815 261
82 3300041999 Ga0439433_0021231 Ga0439433_0021231_582_1382 261
83 3300045976 Ga0466967_0466908 Ga0466967_0466908_260_1045 261
84 3300048918 Ga0496115_0000037 Ga0496115_0000037_1868_2653 261
85 3300048921 Ga0496118_0004971 Ga0496118_0004971_10761_11546 261
86 3300048929 Ga0496126_0000112 Ga0496126_0000112_156405_157190 261
87 iso_pu_bacteria 2576861471 2578456484 261
88 iso_pu_bacteria 2643221579 2643907384 261
89 iso_pu_bacteria 2643221695 2644530752 261
90 iso_pu_bacteria 2747842501 2748018613 261
91 iso_pu_bacteria 2818991457 2819663388 261
92 iso_pu_bacteria 2852649853 2852651724 261
93 iso_pu_bacteria 2852684882 2852689403 261
94 iso_pu_bacteria 2857442823 2857444534 261
95 iso_pu_bacteria 2874220319 2874223673 261
96 iso_pu_bacteria 2919089067 2919089220 261
97 iso_pu_bacteria 2919134579 2919136536 261
98 iso_pu_bacteria 2928496128 2928499394 261
99 iso_pu_bacteria 2931380184 2931382924 261
100 iso_pu_bacteria 2937610967 2937613857 261
101 iso_pu_bacteria 2939589442 2939590281 261
102 iso_pu_bacteria 2939622612 2939623901 261
103 iso_pu_bacteria 2939626828 2939628564 261
104 iso_pu_bacteria 2941475908 2941479444 261
105 iso_pu_bacteria 2961047084 2961050437 261
106 iso_pu_bacteria 2961064222 2961064418 261
107 iso_pu_bacteria 2974307012 2974307137 261
108 iso_pu_bacteria 2977247770 2977247882 261
109 iso_pu_bacteria 2984514374 2984517662 261
110 iso_pu_bacteria 8002869464 8002870668 261
111 iso_pu_bacteria 8021622325 8021626186 261
112 iso_pu_bacteria 8021626552 8021628862 261
113 iso_pu_bacteria 8021648035 8021651422 261
114 3300005444 Ga0070694_100154940 Ga0070694_1001549402 262
115 3300005549 Ga0070704_100004579 Ga0070704_1000045796 262
116 3300006844 Ga0075428_100041153 Ga0075428_1000411536 262
117 3300006847 Ga0075431_100112298 Ga0075431_1001122985 262
118 3300006847 Ga0075431_100211370 Ga0075431_1002113702 262
119 3300006880 Ga0075429_100000358 Ga0075429_10000035824 262
120 3300009011 Ga0105251_10004152 Ga0105251_1000415210 262
121 3300009147 Ga0114129_10067170 Ga0114129_100671704 262
122 3300013296 Ga0157374_10005738 Ga0157374_100057387 262
123 3300013296 Ga0157374_10108010 Ga0157374_101080102 262
124 3300014969 Ga0157376_10005297 Ga0157376_100052973 262
125 3300025735 Ga0207713_1017020 Ga0207713_10170201 262
126 3300025922 Ga0207646_10145712 Ga0207646_101457122 262
127 3300035114 Ga0373939_0059716 Ga0373939_0059716_157_945 262
128 3300041460 Ga0451802_0471752 Ga0451802_0471752_218_1006 262
129 3300045051 Ga0451576_0140619 Ga0451576_0140619_19_807 262
130 3300046501 Ga0495607_0106625 Ga0495607_0106625_242_1030 262
131 3300046512 Ga0495610_0048259 Ga0495610_0048259_901_1689 262
132 3300046513 Ga0495616_0031063 Ga0495616_0031063_866_1654 262
133 3300048923 Ga0496120_0000758 Ga0496120_0000758_31864_32658 262
134 3300048927 Ga0496124_0000022 Ga0496124_0000022_372091_372879 262
135 3300049459 Ga0495678_076094 Ga0495678_076094_83_871 262
136 3300050507 nmdc:mga05p37_421_c1 nmdc:mga05p37_421_c1_35093_35881 262
137 3300050508 nmdc:mga09592_44_c1 nmdc:mga09592_44_c1_3667_4455 262
138 3300050510 nmdc:mga06r32_208711_c1 nmdc:mga06r32_208711_c1_964_1752 262
139 3300050510 nmdc:mga06r32_34824_c1 nmdc:mga06r32_34824_c1_510_1298 262
140 3300003775 Ga0055524_1004528 Ga0055524_10045284 263
141 3300003781 Ga0055536_1039561 Ga0055536_10395611 263
142 3300003794 Ga0055531_10003214 Ga0055531_100032148 263
143 3300003856 Ga0058692_1000004 Ga0058692_1000004298 263
144 3300005539 Ga0068853_100353738 Ga0068853_1003537382 263
145 3300006237 Ga0097621_100042831 Ga0097621_1000428312 263
146 3300006358 Ga0068871_100055339 Ga0068871_1000553392 263
147 3300010375 Ga0105239_10035996 Ga0105239_100359964 263
148 3300010375 Ga0105239_10448016 Ga0105239_104480162 263
149 3300013297 Ga0157378_10082436 Ga0157378_100824363 263
150 3300025284 Ga0209130_1001972 Ga0209130_10019725 263
151 3300025292 Ga0209676_1007271 Ga0209676_10072714 263
152 3300025292 Ga0209676_1007366 Ga0209676_10073664 263
153 3300025292 Ga0209676_1032083 Ga0209676_10320832 263
154 3300025294 Ga0209025_1007372 Ga0209025_10073726 263
155 3300025295 Ga0209564_1016997 Ga0209564_10169973 263
156 3300025298 Ga0209050_1004386 Ga0209050_10043867 263
157 3300025299 Ga0209256_1004587 Ga0209256_10045871 263
158 3300025303 Ga0209051_1013026 Ga0209051_10130262 263
159 3300025304 Ga0209257_1001986 Ga0209257_100198613 263
160 3300025924 Ga0207694_10021458 Ga0207694_100214581 263
161 3300027312 Ga0209371_1000018 Ga0209371_1000018103 263
162 3300027360 Ga0209969_1019162 Ga0209969_10191622 263
163 3300027543 Ga0209999_1029229 Ga0209999_10292291 263
164 3300027665 Ga0209983_1007359 Ga0209983_10073592 263
165 3300027682 Ga0209971_1003131 Ga0209971_10031312 263
166 3300030500 Ga0268256_1000016 Ga0268256_1000016103 263
167 3300038705 Ga0237819_01754 Ga0237819_01754_1394_2200 263
168 3300042533 Ga0450901_002848 Ga0450901_002848_476_1291 263
169 3300046525 Ga0495663_0005192 Ga0495663_0005192_568_1383 263
170 3300047472 Ga0495686_0004593 Ga0495686_0004593_7697_8503 263
171 3300049572 Ga0501036_0018411 Ga0501036_0018411_1156_1968 263
172 3300049573 Ga0501037_0071221 Ga0501037_0071221_1399_2211 263
173 3300049574 Ga0501038_0011515 Ga0501038_0011515_202_1014 263
174 3300049575 Ga0501039_0081669 Ga0501039_0081669_1283_2095 263
175 3300049576 Ga0501040_0026776 Ga0501040_0026776_1284_2096 263
176 3300049578 Ga0501042_0021120 Ga0501042_0021120_2127_2939 263
177 3300049587 Ga0501071_0014050 Ga0501071_0014050_690_1502 263
178 3300049588 Ga0501072_0004520 Ga0501072_0004520_7898_8710 263
179 3300049590 Ga0501074_0076670 Ga0501074_0076670_1097_1909 263
180 3300049591 Ga0501075_0019728 Ga0501075_0019728_2784_3596 263
181 3300049592 Ga0501076_0003370 Ga0501076_0003370_6530_7342 263
182 3300049741 Ga0501079_0088167 Ga0501079_0088167_998_1810 263
183 3300049742 Ga0501080_0012651 Ga0501080_0012651_6486_7298 263
184 3300049743 Ga0501081_0008426 Ga0501081_0008426_1434_2246 263
185 3300049822 Ga0501035_0083460 Ga0501035_0083460_334_1146 263
186 3300049824 Ga0501045_0003938 Ga0501045_0003938_7842_8654 263
187 3300054114 Ga0501084_0085720 Ga0501084_0085720_763_1575 263
188 3300060353 Ga0501082_0124944 Ga0501082_0124944_371_1183 263
189 iso_pu_bacteria 8003014200 8003017203 263
190 3300003791 Ga0055530_10000466 Ga0055530_1000046618 264
191 3300003791 Ga0055530_10000918 Ga0055530_100009185 264
192 3300005355 Ga0070671_100115682 Ga0070671_1001156822 264
193 3300005546 Ga0070696_100444191 Ga0070696_1004441911 264
194 3300005548 Ga0070665_100157502 Ga0070665_1001575022 264
195 3300005614 Ga0068856_100005100 Ga0068856_1000051003 264
196 3300005841 Ga0068863_100155199 Ga0068863_1001551992 264
197 3300009177 Ga0105248_10085737 Ga0105248_100857372 264
198 3300014325 Ga0163163_10015307 Ga0163163_100153073 264
199 3300025292 Ga0209676_1000018 Ga0209676_1000018430 264
200 3300025298 Ga0209050_1000109 Ga0209050_1000109141 264
201 3300025298 Ga0209050_1000448 Ga0209050_100044812 264
202 3300025303 Ga0209051_1001121 Ga0209051_100112116 264
203 3300025304 Ga0209257_1000035 Ga0209257_1000035430 264
204 3300025941 Ga0207711_10054252 Ga0207711_100542522 264
205 3300026078 Ga0207702_10003381 Ga0207702_100033818 264
206 3300026088 Ga0207641_10063693 Ga0207641_100636932 264
207 3300026118 Ga0207675_100272432 Ga0207675_1002724322 264
208 3300031665 Ga0316575_10006497 Ga0316575_100064972 264
209 3300031911 Ga0307412_10147767 Ga0307412_101477671 264
210 3300032004 Ga0307414_10010764 Ga0307414_100107644 264
211 3300032004 Ga0307414_10293598 Ga0307414_102935981 264
212 3300036401 Ga0373937_0067824 Ga0373937_0067824_1783_2592 264
213 3300037466 Ga0395898_0048957 Ga0395898_0048957_2820_3629 264
214 3300037471 Ga0395905_0051934 Ga0395905_0051934_1141_1950 264
215 3300038443 Ga0395901_0166612 Ga0395901_0166612_1435_2244 264
216 3300041404 Ga0439436_0021598 Ga0439436_0021598_1042_1851 264
217 3300041406 Ga0439439_0000944 Ga0439439_0000944_1121_1915 264
218 3300041413 Ga0439465_0004426 Ga0439465_0004426_3418_4227 264
219 3300042010 Ga0439452_052680 Ga0439452_052680_104_913 264
220 3300049577 Ga0501041_0194129 Ga0501041_0194129_343_1173 264
221 3300049579 Ga0501043_0005077 Ga0501043_0005077_7401_8210 264
222 3300049581 Ga0501047_0138380 Ga0501047_0138380_153_1064 264
223 2162886007 SwRhRL2b_contig_2618184 SwRhRL2b_0264.00004100 265
224 3300003771 Ga0055526_1001691 Ga0055526_100169110 265
225 3300003773 Ga0055537_1001178 Ga0055537_10011782 265
226 3300003775 Ga0055524_1018755 Ga0055524_10187551 265
227 3300003781 Ga0055536_1004855 Ga0055536_10048555 265
228 3300003784 Ga0055534_1000209 Ga0055534_100020939 265
229 3300003790 Ga0055528_1000205 Ga0055528_100020515 265
230 3300005289 Ga0065704_10000910 Ga0065704_100009107 265
231 3300005289 Ga0065704_10083162 Ga0065704_100831623 265
232 3300005289 Ga0065704_10226434 Ga0065704_102264341 265
233 3300005328 Ga0070676_10032125 Ga0070676_100321253 265
234 3300005330 Ga0070690_100088489 Ga0070690_1000884892 265
235 3300005331 Ga0070670_100000521 Ga0070670_1000005213 265
236 3300005331 Ga0070670_100226863 Ga0070670_1002268633 265
237 3300005335 Ga0070666_10063885 Ga0070666_100638852 265
238 3300005336 Ga0070680_100054879 Ga0070680_1000548792 265
239 3300005347 Ga0070668_100126104 Ga0070668_1001261042 265
240 3300005355 Ga0070671_100000643 Ga0070671_1000006436 265
241 3300005441 Ga0070700_100024036 Ga0070700_1000240362 265
242 3300005456 Ga0070678_100067242 Ga0070678_1000672421 265
243 3300005457 Ga0070662_100207812 Ga0070662_1002078122 265
244 3300005543 Ga0070672_100012079 Ga0070672_1000120793 265
245 3300005548 Ga0070665_100045918 Ga0070665_1000459185 265
246 3300005548 Ga0070665_100425987 Ga0070665_1004259871 265
247 3300005578 Ga0068854_100127911 Ga0068854_1001279112 265
248 3300005617 Ga0068859_100033012 Ga0068859_1000330122 265
249 3300005719 Ga0068861_100034912 Ga0068861_1000349122 265
250 3300005840 Ga0068870_10023040 Ga0068870_100230402 265
251 3300005842 Ga0068858_100126514 Ga0068858_1001265143 265
252 3300005844 Ga0068862_100020321 Ga0068862_1000203212 265
253 3300006038 Ga0075365_10232296 Ga0075365_102322962 265
254 3300006048 Ga0075363_100088709 Ga0075363_1000887092 265
255 3300006844 Ga0075428_100002661 Ga0075428_1000026612 265
256 3300006847 Ga0075431_100028730 Ga0075431_1000287302 265
257 3300006847 Ga0075431_100373287 Ga0075431_1003732872 265
258 3300006931 Ga0097620_100033012 Ga0097620_1000330122 265
259 3300009011 Ga0105251_10000017 Ga0105251_10000017119 265
260 3300009036 Ga0105244_10012689 Ga0105244_100126895 265
261 3300009101 Ga0105247_10004858 Ga0105247_100048583 265
262 3300009147 Ga0114129_10779943 Ga0114129_107799432 265
263 3300009148 Ga0105243_10001543 Ga0105243_100015438 265
264 3300009174 Ga0105241_10217131 Ga0105241_102171312 265
265 3300009176 Ga0105242_10118820 Ga0105242_101188202 265
266 3300009177 Ga0105248_10266070 Ga0105248_102660702 265
267 3300009551 Ga0105238_10000893 Ga0105238_100008931 265
268 3300009553 Ga0105249_10055368 Ga0105249_100553683 265
269 3300009553 Ga0105249_10222890 Ga0105249_102228902 265
270 3300010375 Ga0105239_10144256 Ga0105239_101442562 265
271 3300011119 Ga0105246_10226322 Ga0105246_102263222 265
272 3300011119 Ga0105246_10253272 Ga0105246_102532722 265
273 3300013100 Ga0157373_10036271 Ga0157373_100362712 265
274 3300013100 Ga0157373_10060440 Ga0157373_100604403 265
275 3300013100 Ga0157373_10066857 Ga0157373_100668573 265
276 3300013100 Ga0157373_10067455 Ga0157373_100674553 265
277 3300013102 Ga0157371_10000158 Ga0157371_1000015862 265
278 3300013102 Ga0157371_10009111 Ga0157371_100091114 265
279 3300013102 Ga0157371_10051932 Ga0157371_100519322 265
280 3300013102 Ga0157371_10232344 Ga0157371_102323441 265
281 3300013104 Ga0157370_10019904 Ga0157370_100199043 265
282 3300013105 Ga0157369_10068091 Ga0157369_100680913 265
283 3300013296 Ga0157374_10467125 Ga0157374_104671252 265
284 3300013307 Ga0157372_10952928 Ga0157372_109529282 265
285 3300014497 Ga0182008_10000063 Ga0182008_1000006334 265
286 3300014969 Ga0157376_10229373 Ga0157376_102293732 265
287 3300015261 Ga0182006_1007487 Ga0182006_10074872 265
288 3300017792 Ga0163161_10019733 Ga0163161_100197335 265
289 3300017792 Ga0163161_10093543 Ga0163161_100935431 265
290 3300017792 Ga0163161_10116826 Ga0163161_101168262 265
291 3300025263 Ga0209565_1000051 Ga0209565_100005115 265
292 3300025273 Ga0209673_1000581 Ga0209673_10005817 265
293 3300025284 Ga0209130_1010817 Ga0209130_10108172 265
294 3300025291 Ga0209675_1000007 Ga0209675_1000007115 265
295 3300025292 Ga0209676_1000143 Ga0209676_100014374 265
296 3300025299 Ga0209256_1006264 Ga0209256_10062642 265
297 3300025304 Ga0209257_1003791 Ga0209257_100379110 265
298 3300025735 Ga0207713_1000350 Ga0207713_100035026 265
299 3300025900 Ga0207710_10025471 Ga0207710_100254713 265
300 3300025907 Ga0207645_10002504 Ga0207645_1000250414 265
301 3300025908 Ga0207643_10016449 Ga0207643_100164494 265
302 3300025914 Ga0207671_10303982 Ga0207671_103039821 265
303 3300025925 Ga0207650_10001772 Ga0207650_1000177213 265
304 3300025935 Ga0207709_10001736 Ga0207709_1000173614 265
305 3300025937 Ga0207669_10091461 Ga0207669_100914612 265
306 3300025961 Ga0207712_10173619 Ga0207712_101736192 265
307 3300025972 Ga0207668_10035178 Ga0207668_100351783 265
308 3300025986 Ga0207658_10116342 Ga0207658_101163422 265
309 3300026035 Ga0207703_10000852 Ga0207703_100008526 265
310 3300026089 Ga0207648_10004463 Ga0207648_100044632 265
311 3300026118 Ga0207675_100001367 Ga0207675_10000136710 265
312 3300026121 Ga0207683_10092576 Ga0207683_100925762 265
313 3300027617 Ga0210002_1000349 Ga0210002_10003494 265
314 3300027682 Ga0209971_1001920 Ga0209971_10019202 265
315 3300027717 Ga0209998_10008362 Ga0209998_100083622 265
316 3300027876 Ga0209974_10001592 Ga0209974_100015925 265
317 3300028380 Ga0268265_10203592 Ga0268265_102035922 265
318 3300031824 Ga0307413_10000205 Ga0307413_1000020513 265
319 3300031911 Ga0307412_10001110 Ga0307412_1000111012 265
320 3300031995 Ga0307409_100131472 Ga0307409_1001314721 265
321 3300032004 Ga0307414_10000556 Ga0307414_100005566 265
322 3300032004 Ga0307414_10006401 Ga0307414_100064014 265
323 3300032004 Ga0307414_10022331 Ga0307414_100223312 265
324 3300032004 Ga0307414_10040755 Ga0307414_100407551 265
325 3300037471 Ga0395905_0590780 Ga0395905_0590780_112_939 265
326 3300038705 Ga0237819_04077 Ga0237819_04077_90_917 265
327 3300041404 Ga0439436_0006539 Ga0439436_0006539_2703_3524 265
328 3300041404 Ga0439436_0034218 Ga0439436_0034218_213_1025 265
329 3300041413 Ga0439465_0005064 Ga0439465_0005064_2756_3568 265
330 3300041413 Ga0439465_0041324 Ga0439465_0041324_575_1387 265
331 3300041459 Ga0451800_1474571 Ga0451800_1474571_1464_2261 265
332 3300041486 Ga0451807_2030523 Ga0451807_2030523_201_998 265
333 3300041494 Ga0451837_1838787 Ga0451837_1838787_148_960 265
334 3300042004 Ga0439445_0010327 Ga0439445_0010327_664_1476 265
335 3300042006 Ga0439432_005649 Ga0439432_005649_3250_4065 265
336 3300042006 Ga0439432_026015 Ga0439432_026015_411_1232 265
337 3300042007 Ga0439449_0000128 Ga0439449_0000128_4810_5622 265
338 3300042007 Ga0439449_0002865 Ga0439449_0002865_886_1701 265
339 3300042007 Ga0439449_0004770 Ga0439449_0004770_534_1355 265
340 3300042007 Ga0439449_0058314 Ga0439449_0058314_539_1360 265
341 3300042007 Ga0439449_0069690 Ga0439449_0069690_106_906 265
342 3300042115 Ga0450911_000408 Ga0450911_000408_11301_12098 265
343 3300046453 Ga0495627_018906 Ga0495627_018906_387_1202 265
344 3300046460 Ga0495638_0001147 Ga0495638_0001147_21865_22680 265
345 3300046460 Ga0495638_0153079 Ga0495638_0153079_169_984 265
346 3300046512 Ga0495610_0006633 Ga0495610_0006633_2745_3560 265
347 3300046513 Ga0495616_0071175 Ga0495616_0071175_263_1078 265
348 3300046518 Ga0495631_0001424 Ga0495631_0001424_2636_3451 265
349 3300046519 Ga0495632_0010431 Ga0495632_0010431_3963_4769 265
350 3300046522 Ga0495643_0000431 Ga0495643_0000431_44949_45764 265
351 3300046525 Ga0495663_0001401 Ga0495663_0001401_5510_6325 265
352 3300046525 Ga0495663_0001814 Ga0495663_0001814_1957_2754 265
353 3300046535 Ga0495586_0232459 Ga0495586_0232459_185_1000 265
354 3300046642 Ga0495634_0229840 Ga0495634_0229840_192_1007 265
355 3300046683 Ga0495658_0151681 Ga0495658_0151681_305_1120 265
356 3300046810 Ga0495660_0031599 Ga0495660_0031599_1179_2006 265
357 3300047320 Ga0495672_0000069 Ga0495672_0000069_121854_122669 265
358 3300047320 Ga0495672_0035178 Ga0495672_0035178_367_1182 265
359 3300047443 Ga0495687_046808 Ga0495687_046808_722_1528 265
360 3300047470 Ga0495681_0039474 Ga0495681_0039474_1316_2131 265
361 3300047472 Ga0495686_0009193 Ga0495686_0009193_2543_3358 265
362 3300048908 Ga0496105_0053467 Ga0496105_0053467_587_1384 265
363 3300048919 Ga0496116_0001076 Ga0496116_0001076_2162_2959 265
364 3300048920 Ga0496117_0000176 Ga0496117_0000176_69071_69886 265
365 3300048920 Ga0496117_0002092 Ga0496117_0002092_3585_4400 265
366 3300048920 Ga0496117_0002761 Ga0496117_0002761_14121_14918 265
367 3300048920 Ga0496117_0004497 Ga0496117_0004497_2286_3101 265
368 3300048920 Ga0496117_0004512 Ga0496117_0004512_12191_13006 265
369 3300048921 Ga0496118_0000108 Ga0496118_0000108_26869_27684 265
370 3300048921 Ga0496118_0003829 Ga0496118_0003829_15080_15895 265
371 3300048921 Ga0496118_0007513 Ga0496118_0007513_8684_9499 265
372 3300048921 Ga0496118_0050809 Ga0496118_0050809_1961_2758 265
373 3300048921 Ga0496118_0098281 Ga0496118_0098281_1022_1819 265
374 3300048921 Ga0496118_0151425 Ga0496118_0151425_162_959 265
375 3300048922 Ga0496119_0008943 Ga0496119_0008943_3872_4669 265
376 3300048923 Ga0496120_0002793 Ga0496120_0002793_4290_5087 265
377 3300048924 Ga0496121_0003767 Ga0496121_0003767_2877_3674 265
378 3300048924 Ga0496121_0004576 Ga0496121_0004576_9360_10175 265
379 3300048924 Ga0496121_0057908 Ga0496121_0057908_648_1463 265
380 3300048924 Ga0496121_0311622 Ga0496121_0311622_46_843 265
381 3300048925 Ga0496122_0000081 Ga0496122_0000081_11753_12550 265
382 3300048925 Ga0496122_0017195 Ga0496122_0017195_1648_2463 265
383 3300048925 Ga0496122_0022475 Ga0496122_0022475_1719_2534 265
384 3300048926 Ga0496123_0001058 Ga0496123_0001058_11797_12594 265
385 3300048926 Ga0496123_0007499 Ga0496123_0007499_3116_3931 265
386 3300048926 Ga0496123_0009088 Ga0496123_0009088_4853_5668 265
387 3300048927 Ga0496124_0000486 Ga0496124_0000486_64633_65448 265
388 3300048927 Ga0496124_0004337 Ga0496124_0004337_11626_12423 265
389 3300048927 Ga0496124_0005022 Ga0496124_0005022_11644_12459 265
390 3300048927 Ga0496124_0018340 Ga0496124_0018340_181_996 265
391 3300048927 Ga0496124_0031528 Ga0496124_0031528_1585_2400 265
392 3300048927 Ga0496124_0038138 Ga0496124_0038138_2263_3078 265
393 3300048928 Ga0496125_0000854 Ga0496125_0000854_44005_44820 265
394 3300048928 Ga0496125_0063442 Ga0496125_0063442_2032_2847 265
395 3300048928 Ga0496125_0082438 Ga0496125_0082438_654_1469 265
396 3300048928 Ga0496125_0143729 Ga0496125_0143729_308_1135 265
397 3300048929 Ga0496126_0001975 Ga0496126_0001975_2118_2915 265
398 3300048929 Ga0496126_0223866 Ga0496126_0223866_238_1053 265
399 3300049513 Ga0501290_001093 Ga0501290_001093_583_1434 265
400 3300049523 Ga0501300_001540 Ga0501300_001540_2187_3038 265
401 3300049571 Ga0501034_0026742 Ga0501034_0026742_4507_5322 265
402 3300049573 Ga0501037_0036547 Ga0501037_0036547_758_1600 265
403 3300049574 Ga0501038_0003363 Ga0501038_0003363_7133_7975 265
404 3300049575 Ga0501039_0004389 Ga0501039_0004389_7906_8748 265
405 3300049576 Ga0501040_0001655 Ga0501040_0001655_12391_13233 265
406 3300049578 Ga0501042_0001772 Ga0501042_0001772_8140_8982 265
407 3300049584 Ga0501068_0003032 Ga0501068_0003032_7120_7962 265
408 3300049587 Ga0501071_0000474 Ga0501071_0000474_19444_20286 265
409 3300049588 Ga0501072_0000801 Ga0501072_0000801_7153_7995 265
410 3300049590 Ga0501074_0015457 Ga0501074_0015457_2822_3664 265
411 3300049592 Ga0501076_0002157 Ga0501076_0002157_2406_3248 265
412 3300049593 Ga0501077_0002929 Ga0501077_0002929_2249_3091 265
413 3300049705 Ga0501225_0005020 Ga0501225_0005020_117_929 265
414 3300049741 Ga0501079_0000141 Ga0501079_0000141_10933_11775 265
415 3300049742 Ga0501080_0001589 Ga0501080_0001589_12803_13645 265
416 3300049743 Ga0501081_0001707 Ga0501081_0001707_5643_6485 265
417 3300049762 Ga0501265_001371 Ga0501265_001371_822_1673 265
418 3300049772 Ga0501275_000394 Ga0501275_000394_3218_4069 265
419 3300049822 Ga0501035_0013629 Ga0501035_0013629_6638_7480 265
420 3300049824 Ga0501045_0001076 Ga0501045_0001076_7153_7995 265
421 3300050490 nmdc:mga03n38_85842_c1 nmdc:mga03n38_85842_c1_266_1078 265
422 3300050507 nmdc:mga05p37_663455_c1 nmdc:mga05p37_663455_c1_121_951 265
423 3300050508 nmdc:mga09592_224615_c1 nmdc:mga09592_224615_c1_31_864 265
424 3300050510 nmdc:mga06r32_203033_c1 nmdc:mga06r32_203033_c1_488_1318 265
425 3300053093 Ga0500651_0000358 Ga0500651_0000358_20243_21052 265
426 3300053128 Ga0500626_009348 Ga0500626_009348_352_1167 265
427 3300053156 Ga0500622_0142786 Ga0500622_0142786_292_1101 265
428 3300053161 Ga0500634_0000299 Ga0500634_0000299_13372_14178 265
429 3300054114 Ga0501084_0001657 Ga0501084_0001657_9929_10771 265
430 3300060353 Ga0501082_0047490 Ga0501082_0047490_2168_3010 265
431 3300061734 Ga0530510_0004190 Ga0530510_0004190_7033_7875 265
432 iso_pu_bacteria 2747842428 2747947304 265
433 iso_pu_bacteria 2765235840 2765581020 265
434 iso_pu_bacteria 2816332141 2816517982 265
435 iso_pu_bacteria 2842391507 2842394053 265

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01026

TatD_DNase

TatD related DNase

1

248

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rcm-assembly1.cif.gz_A crystal structure of efi target 500140:tatd family hydrolase from pseudomonas putida 0.9855 1 263
3rcm-assembly1.cif.gz_A crystal structure of efi target 500140:tatd family hydrolase from pseudomonas putida 0.9745 1 263
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.9717 3 262
1xwy-assembly1.cif.gz_A crystal structure of tatd deoxyribonuclease from escherichia coli k12 at 2.0 a resolution 0.9644 3 262
1j6o-assembly1.cif.gz_A crystal structure of tatd-related deoxyribonuclease (tm0667) from thermotoga maritima at 1.8 a resolution 0.9501 2 259
ID Description Score Start End Superfamily
3rcmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9779 2 263 3.20.20.140
1xwyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9717 3 262 3.20.20.140
1xwyA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9644 3 262 3.20.20.140
3rcmA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9633 2 263 3.20.20.140
af_G5EG18_4_286_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9523 1 262 3.20.20.140
ID Description Score Start End GO Terms
AF-V7ZIP7-F1-model_v4 deleted 1 1 265
AF-A0A5C5U9F9-F1-model_v4 Hydrolase TatD 0.9999 1 262 GO:0004518
GO:0046872
AF-Q5GUL6-F1-model_v4 Type V secretory pathway protein 0.9995 1 265 GO:0004518
AF-A0A8B4XAG0-F1-model_v4 deleted 0.9994 1 265
AF-A0A108UAD0-F1-model_v4 Deoxyribonuclease TatD 0.9988 1 262 GO:0004518
GO:0046872

Feature Viewer

pLDDT pTM Quality
96.25 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map