F443430
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 435 | 225 | 435 | 301 |
Family's Representative Sequence
| Representative Sequence | 3300053130|Ga0500642_0000776|Ga0500642_0000776_6052_7128 |
| Length | 358 |
| Sequence | LSPKGVSFALDGPQSRVPTRQYRRTAGFIPGKISYLRANKSGRPRVLARASSRTPREITMTLKIDRRDFARLAGLGGVAFASGLAGPHRFAQAKAATQDFFFLQLSDTHWGFSGPPNPDAANTLKKAVAAVNGLAQQPDFIVFTGDLTHTTDDAAERRKRMAEFRAIVAELKVKALRFMPGEHDAALDRGAAYQEFFGKTHYTFDHKGIHFIALDNVSDPAAAIGAEQLAWLKADLAQLDKETPIVVLAHRPLFDLYPQWDWATADGAAAVELLMPFEYVTVFYGHIHQEHHHMTGHIAHHAAMSLIFPQPAPGSQPKRTPPVAWDPAHPNKGLGWRRIGAKAGADELAVAETPLGPV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 2 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 25 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 44 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 53 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 54 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 55 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 56 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 57 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 58 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 59 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 61 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 119 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 122 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 123 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 124 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 126 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 127 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 128 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 129 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 130 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 131 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 132 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 133 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 134 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 135 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 136 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 137 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 138 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 139 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 140 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 141 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 142 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 143 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 144 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 146 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 147 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 148 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 149 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 150 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 151 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 152 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 153 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 154 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 155 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 157 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 158 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 159 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 160 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 161 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 162 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 163 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 164 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 165 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 166 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 167 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 168 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 169 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 170 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 171 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 172 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 173 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 174 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 175 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 176 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 177 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 209 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 210 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 211 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 212 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 213 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 224 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 225 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.15 |
| Nodule | 0 |
| Rhizoplane | 0.92 |
| Rhizosphere | 97.7 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10077218 | 3300005290 | Bacteria | 3530 |
| 2 | Ga0065712_10079505 | 3300005290 | Bacteria | 3209 |
| 3 | Ga0065715_10119337 | 3300005293 | Bacteria | 2289 |
| 4 | Ga0065715_10176094 | 3300005293 | Bacteria | 1502 |
| 5 | Ga0065707_10031181 | 3300005295 | Bacteria | 1382 |
| 6 | Ga0065707_10110766 | 3300005295 | Bacteria | 2417 |
| 7 | Ga0065707_10200961 | 3300005295 | Bacteria | 1311 |
| 8 | Ga0070658_10087665 | 3300005327 | Bacteria | 2562 |
| 9 | Ga0070690_100136242 | 3300005330 | Bacteria | 1663 |
| 10 | Ga0070670_100001864 | 3300005331 | Bacteria | 17178 |
| 11 | Ga0070670_100035564 | 3300005331 | Bacteria | 4287 |
| 12 | Ga0070670_100488293 | 3300005331 | Bacteria | 1094 |
| 13 | Ga0070666_10002163 | 3300005335 | Bacteria | 11945 |
| 14 | Ga0070666_10008426 | 3300005335 | Bacteria | 6402 |
| 15 | Ga0070666_10268198 | 3300005335 | Bacteria | 1211 |
| 16 | Ga0070680_100082465 | 3300005336 | Bacteria | 2654 |
| 17 | Ga0070680_100339995 | 3300005336 | Bacteria | 1275 |
| 18 | Ga0068868_100001645 | 3300005338 | Bacteria | 15247 |
| 19 | Ga0070689_100001654 | 3300005340 | Bacteria | 14244 |
| 20 | Ga0070687_100006977 | 3300005343 | Bacteria | 4673 |
| 21 | Ga0070687_100025365 | 3300005343 | Bacteria | 2843 |
| 22 | Ga0070669_100112678 | 3300005353 | Bacteria | 2066 |
| 23 | Ga0070675_100095953 | 3300005354 | Bacteria | 2490 |
| 24 | Ga0070671_100009401 | 3300005355 | Bacteria | 7850 |
| 25 | Ga0070671_100029396 | 3300005355 | Bacteria | 4531 |
| 26 | Ga0070673_100009909 | 3300005364 | Bacteria | 6420 |
| 27 | Ga0070673_100149019 | 3300005364 | Bacteria | 1980 |
| 28 | Ga0070688_100000911 | 3300005365 | Bacteria | 14778 |
| 29 | Ga0070688_100104658 | 3300005365 | Bacteria | 1872 |
| 30 | Ga0070667_100023481 | 3300005367 | Bacteria | 5116 |
| 31 | Ga0070667_100591347 | 3300005367 | Bacteria | 1022 |
| 32 | Ga0070714_100177049 | 3300005435 | Bacteria | 1939 |
| 33 | Ga0070701_10007216 | 3300005438 | Bacteria | 4731 |
| 34 | Ga0070701_10010220 | 3300005438 | Bacteria | 4142 |
| 35 | Ga0070701_10047082 | 3300005438 | Bacteria | 2219 |
| 36 | Ga0070711_100000025 | 3300005439 | Bacteria | 111524 |
| 37 | Ga0070705_100053320 | 3300005440 | Bacteria | 2367 |
| 38 | Ga0070694_100248942 | 3300005444 | Bacteria | 1343 |
| 39 | Ga0070708_100003651 | 3300005445 | Bacteria | 12067 |
| 40 | Ga0070708_100074952 | 3300005445 | Bacteria | 3053 |
| 41 | Ga0070708_100184645 | 3300005445 | Bacteria | 1950 |
| 42 | Ga0070708_100271711 | 3300005445 | Bacteria | 1594 |
| 43 | Ga0068867_100390317 | 3300005459 | Bacteria | 1171 |
| 44 | Ga0070685_10001011 | 3300005466 | Bacteria | 15117 |
| 45 | Ga0070706_100011465 | 3300005467 | Bacteria | 8240 |
| 46 | Ga0070706_100070108 | 3300005467 | Bacteria | 3242 |
| 47 | Ga0070706_100083429 | 3300005467 | Bacteria | 2960 |
| 48 | Ga0070706_100189705 | 3300005467 | Bacteria | 1921 |
| 49 | Ga0070706_100374165 | 3300005467 | Bacteria | 1327 |
| 50 | Ga0070707_100000509 | 3300005468 | Bacteria | 38647 |
| 51 | Ga0070707_100017479 | 3300005468 | Bacteria | 6742 |
| 52 | Ga0070707_100026541 | 3300005468 | Bacteria | 5500 |
| 53 | Ga0070707_100137550 | 3300005468 | Bacteria | 2376 |
| 54 | Ga0070698_100000808 | 3300005471 | Bacteria | 34171 |
| 55 | Ga0070698_100005969 | 3300005471 | Bacteria | 13277 |
| 56 | Ga0070699_100005358 | 3300005518 | Bacteria | 11246 |
| 57 | Ga0070699_100121099 | 3300005518 | Bacteria | 2301 |
| 58 | Ga0070699_100169139 | 3300005518 | Bacteria | 1936 |
| 59 | Ga0070699_100248056 | 3300005518 | Bacteria | 1590 |
| 60 | Ga0070684_100026564 | 3300005535 | Bacteria | 4880 |
| 61 | Ga0070684_100175463 | 3300005535 | Bacteria | 1948 |
| 62 | Ga0070697_100388443 | 3300005536 | Bacteria | 1210 |
| 63 | Ga0070672_100004815 | 3300005543 | Bacteria | 8866 |
| 64 | Ga0070672_100025583 | 3300005543 | Bacteria | 4381 |
| 65 | Ga0070672_100168985 | 3300005543 | Bacteria | 1818 |
| 66 | Ga0070686_100001290 | 3300005544 | Bacteria | 14163 |
| 67 | Ga0070686_100012552 | 3300005544 | Bacteria | 4828 |
| 68 | Ga0070686_100035869 | 3300005544 | Bacteria | 3065 |
| 69 | Ga0070686_100059550 | 3300005544 | Bacteria | 2461 |
| 70 | Ga0070695_100083325 | 3300005545 | Bacteria | 2119 |
| 71 | Ga0070695_100150656 | 3300005545 | Bacteria | 1623 |
| 72 | Ga0070696_100105175 | 3300005546 | Bacteria | 2027 |
| 73 | Ga0070665_100052522 | 3300005548 | Bacteria | 4087 |
| 74 | Ga0070704_100037317 | 3300005549 | Plasmid | 3319 |
| 75 | Ga0068855_100007205 | 3300005563 | Bacteria | 13496 |
| 76 | Ga0068855_100102251 | 3300005563 | Bacteria | 3298 |
| 77 | Ga0070664_100003815 | 3300005564 | Bacteria | 12164 |
| 78 | Ga0070664_100051336 | 3300005564 | Bacteria | 3492 |
| 79 | Ga0068857_100215117 | 3300005577 | Bacteria | 1754 |
| 80 | Ga0068857_100218864 | 3300005577 | Unclassified | 1739 |
| 81 | Ga0068856_100087573 | 3300005614 | Bacteria | 3096 |
| 82 | Ga0070702_100014986 | 3300005615 | Bacteria | 3946 |
| 83 | Ga0068852_100052348 | 3300005616 | Bacteria | 3508 |
| 84 | Ga0068859_100002534 | 3300005617 | Bacteria | 18545 |
| 85 | Ga0068859_100037539 | 3300005617 | Bacteria | 4862 |
| 86 | Ga0068859_100139699 | 3300005617 | Bacteria | 2496 |
| 87 | Ga0068859_100216922 | 3300005617 | Bacteria | 2001 |
| 88 | Ga0068864_100002406 | 3300005618 | Bacteria | 15455 |
| 89 | Ga0068864_100003257 | 3300005618 | Bacteria | 13417 |
| 90 | Ga0068864_100009061 | 3300005618 | Bacteria | 8203 |
| 91 | Ga0068864_100113745 | 3300005618 | Bacteria | 2413 |
| 92 | Ga0068864_100203739 | 3300005618 | Unclassified | 1819 |
| 93 | Ga0068863_100001204 | 3300005841 | Bacteria | 25850 |
| 94 | Ga0068863_100018719 | 3300005841 | Bacteria | 6626 |
| 95 | Ga0068863_100024533 | 3300005841 | Bacteria | 5751 |
| 96 | Ga0068863_100029751 | 3300005841 | Bacteria | 5215 |
| 97 | Ga0068863_100132077 | 3300005841 | Bacteria | 2384 |
| 98 | Ga0068863_100419236 | 3300005841 | Unclassified | 1311 |
| 99 | Ga0068858_100007451 | 3300005842 | Bacteria | 10577 |
| 100 | Ga0068858_100035505 | 3300005842 | Bacteria | 4624 |
| 101 | Ga0068860_100073654 | 3300005843 | Bacteria | 3247 |
| 102 | Ga0068860_100559279 | 3300005843 | Bacteria | 1147 |
| 103 | Ga0068862_100082609 | 3300005844 | Bacteria | 2788 |
| 104 | Ga0070716_100000009 | 3300006173 | Bacteria | 173295 |
| 105 | Ga0097621_100003439 | 3300006237 | Bacteria | 10909 |
| 106 | Ga0097621_100091397 | 3300006237 | Bacteria | 2548 |
| 107 | Ga0075370_10092452 | 3300006353 | Bacteria | 1746 |
| 108 | Ga0068871_100000765 | 3300006358 | Bacteria | 21675 |
| 109 | Ga0068871_100026500 | 3300006358 | Bacteria | 4523 |
| 110 | Ga0075428_100044154 | 3300006844 | Unclassified | 4899 |
| 111 | Ga0075428_100057521 | 3300006844 | Bacteria | 4256 |
| 112 | Ga0075428_100295629 | 3300006844 | Bacteria | 1742 |
| 113 | Ga0075433_10070479 | 3300006852 | Bacteria | 3072 |
| 114 | Ga0075433_10081930 | 3300006852 | Bacteria | 2845 |
| 115 | Ga0075433_10166922 | 3300006852 | Bacteria | 1959 |
| 116 | Ga0075433_10385065 | 3300006852 | Bacteria | 1238 |
| 117 | Ga0075434_100002577 | 3300006871 | Bacteria | 16001 |
| 118 | Ga0075434_100022397 | 3300006871 | Bacteria | 6153 |
| 119 | Ga0075434_100103705 | 3300006871 | Bacteria | 2852 |
| 120 | Ga0075434_100261198 | 3300006871 | Bacteria | 1750 |
| 121 | Ga0075434_100627148 | 3300006871 | Bacteria | 1094 |
| 122 | Ga0075429_100042380 | 3300006880 | Bacteria | 3962 |
| 123 | Ga0075429_100077641 | 3300006880 | Bacteria | 2893 |
| 124 | Ga0075429_100080790 | 3300006880 | Bacteria | 2835 |
| 125 | Ga0075429_100279415 | 3300006880 | Unclassified | 1462 |
| 126 | Ga0075436_100006704 | 3300006914 | Bacteria | 7884 |
| 127 | Ga0075436_100053534 | 3300006914 | Bacteria | 2786 |
| 128 | Ga0075436_100054694 | 3300006914 | Bacteria | 2756 |
| 129 | Ga0075436_100128304 | 3300006914 | Unclassified | 1777 |
| 130 | Ga0097620_100002534 | 3300006931 | Bacteria | 18545 |
| 131 | Ga0097620_100037539 | 3300006931 | Bacteria | 4862 |
| 132 | Ga0097620_100139702 | 3300006931 | Bacteria | 2496 |
| 133 | Ga0097620_100216932 | 3300006931 | Bacteria | 2001 |
| 134 | Ga0075435_100014447 | 3300007076 | Bacteria | 5901 |
| 135 | Ga0075435_100076444 | 3300007076 | Bacteria | 2744 |
| 136 | Ga0075435_100185597 | 3300007076 | Bacteria | 1758 |
| 137 | Ga0075435_100192749 | 3300007076 | Bacteria | 1725 |
| 138 | Ga0075435_100292145 | 3300007076 | Bacteria | 1393 |
| 139 | Ga0099794_10050342 | 3300007265 | Bacteria | 2004 |
| 140 | Ga0099794_10079429 | 3300007265 | Bacteria | 1616 |
| 141 | Ga0111539_10030652 | 3300009094 | Bacteria | 6538 |
| 142 | Ga0111539_10096390 | 3300009094 | Bacteria | 3474 |
| 143 | Ga0111539_10247616 | 3300009094 | Bacteria | 2075 |
| 144 | Ga0111539_10368759 | 3300009094 | Bacteria | 1671 |
| 145 | Ga0105247_10147143 | 3300009101 | Bacteria | 1549 |
| 146 | Ga0105247_10221070 | 3300009101 | Unclassified | 1282 |
| 147 | Ga0114129_10004820 | 3300009147 | Bacteria | 19070 |
| 148 | Ga0114129_10054685 | 3300009147 | Bacteria | 5596 |
| 149 | Ga0114129_10106354 | 3300009147 | Unclassified | 3876 |
| 150 | Ga0114129_10120749 | 3300009147 | Bacteria | 3608 |
| 151 | Ga0114129_10521657 | 3300009147 | Bacteria | 1549 |
| 152 | Ga0105242_10000432 | 3300009176 | Bacteria | 33401 |
| 153 | Ga0105248_10001647 | 3300009177 | Bacteria | 24838 |
| 154 | Ga0105248_10023528 | 3300009177 | Bacteria | 6843 |
| 155 | Ga0105248_10034588 | 3300009177 | Bacteria | 5652 |
| 156 | Ga0105248_10237868 | 3300009177 | Unclassified | 2050 |
| 157 | Ga0105248_10238838 | 3300009177 | Unclassified | 2045 |
| 158 | Ga0105249_10006827 | 3300009553 | Bacteria | 9952 |
| 159 | Ga0105239_10124609 | 3300010375 | Bacteria | 2863 |
| 160 | Ga0157374_10071015 | 3300013296 | Bacteria | 3282 |
| 161 | Ga0157374_10071454 | 3300013296 | Unclassified | 3272 |
| 162 | Ga0157374_10195394 | 3300013296 | Bacteria | 1980 |
| 163 | Ga0157378_10110854 | 3300013297 | Bacteria | 2515 |
| 164 | Ga0157378_10566296 | 3300013297 | Bacteria | 1143 |
| 165 | Ga0163162_10006715 | 3300013306 | Bacteria | 11157 |
| 166 | Ga0163162_10008369 | 3300013306 | Bacteria | 10084 |
| 167 | Ga0163162_10035814 | 3300013306 | Bacteria | 4944 |
| 168 | Ga0163162_10095639 | 3300013306 | Bacteria | 3058 |
| 169 | Ga0163162_10223306 | 3300013306 | Bacteria | 2013 |
| 170 | Ga0157375_10005048 | 3300013308 | Bacteria | 11456 |
| 171 | Ga0157375_10182927 | 3300013308 | Bacteria | 2248 |
| 172 | Ga0163163_10016629 | 3300014325 | Bacteria | 6839 |
| 173 | Ga0163163_10029339 | 3300014325 | Bacteria | 5290 |
| 174 | Ga0163163_10033802 | 3300014325 | Bacteria | 4949 |
| 175 | Ga0163163_10034731 | 3300014325 | Bacteria | 4886 |
| 176 | Ga0163163_10222188 | 3300014325 | Unclassified | 1938 |
| 177 | Ga0157377_10005452 | 3300014745 | Bacteria | 5982 |
| 178 | Ga0157377_10029432 | 3300014745 | Bacteria | 2965 |
| 179 | Ga0157379_10001012 | 3300014968 | Bacteria | 22799 |
| 180 | Ga0157379_10082588 | 3300014968 | Bacteria | 2879 |
| 181 | Ga0157379_10094633 | 3300014968 | Bacteria | 2681 |
| 182 | Ga0157379_10096982 | 3300014968 | Bacteria | 2646 |
| 183 | Ga0157376_10041991 | 3300014969 | Bacteria | 3747 |
| 184 | Ga0157376_10052105 | 3300014969 | Bacteria | 3401 |
| 185 | Ga0157376_10089655 | 3300014969 | Unclassified | 2659 |
| 186 | Ga0163161_10020757 | 3300017792 | Bacteria | 4611 |
| 187 | Ga0209051_1032658 | 3300025303 | Bacteria | 1981 |
| 188 | Ga0207647_10183959 | 3300025904 | Bacteria | 1212 |
| 189 | Ga0207685_10000009 | 3300025905 | Bacteria | 242842 |
| 190 | Ga0207685_10000032 | 3300025905 | Bacteria | 69450 |
| 191 | Ga0207705_10306504 | 3300025909 | Bacteria | 1218 |
| 192 | Ga0207684_10017357 | 3300025910 | Bacteria | 6174 |
| 193 | Ga0207684_10058710 | 3300025910 | Bacteria | 3265 |
| 194 | Ga0207684_10110993 | 3300025910 | Bacteria | 2347 |
| 195 | Ga0207684_10237484 | 3300025910 | Bacteria | 1572 |
| 196 | Ga0207695_10361697 | 3300025913 | Bacteria | 1338 |
| 197 | Ga0207663_10000009 | 3300025916 | Bacteria | 196493 |
| 198 | Ga0207660_10318387 | 3300025917 | Bacteria | 1242 |
| 199 | Ga0207662_10005053 | 3300025918 | Bacteria | 6989 |
| 200 | Ga0207662_10032708 | 3300025918 | Bacteria | 3029 |
| 201 | Ga0207662_10038624 | 3300025918 | Bacteria | 2798 |
| 202 | Ga0207662_10148800 | 3300025918 | Bacteria | 1488 |
| 203 | Ga0207657_10261896 | 3300025919 | Bacteria | 1376 |
| 204 | Ga0207646_10000723 | 3300025922 | Bacteria | 42789 |
| 205 | Ga0207646_10002477 | 3300025922 | Bacteria | 21814 |
| 206 | Ga0207646_10005041 | 3300025922 | Bacteria | 14052 |
| 207 | Ga0207646_10034120 | 3300025922 | Bacteria | 4599 |
| 208 | Ga0207646_10101431 | 3300025922 | Bacteria | 2580 |
| 209 | Ga0207681_10085824 | 3300025923 | Bacteria | 2235 |
| 210 | Ga0207694_10161172 | 3300025924 | Bacteria | 1812 |
| 211 | Ga0207650_10005556 | 3300025925 | Bacteria | 8604 |
| 212 | Ga0207659_10004012 | 3300025926 | Bacteria | 8880 |
| 213 | Ga0207659_10042039 | 3300025926 | Bacteria | 3203 |
| 214 | Ga0207659_10109223 | 3300025926 | Bacteria | 2099 |
| 215 | Ga0207664_10203268 | 3300025929 | Bacteria | 1711 |
| 216 | Ga0207644_10012091 | 3300025931 | Bacteria | 5726 |
| 217 | Ga0207690_10192349 | 3300025932 | Bacteria | 1544 |
| 218 | Ga0207670_10009251 | 3300025936 | Bacteria | 5611 |
| 219 | Ga0207704_10135380 | 3300025938 | Unclassified | 1714 |
| 220 | Ga0207665_10080168 | 3300025939 | Bacteria | 2245 |
| 221 | Ga0207665_10331649 | 3300025939 | Bacteria | 1144 |
| 222 | Ga0207691_10012855 | 3300025940 | Bacteria | 8014 |
| 223 | Ga0207691_10032187 | 3300025940 | Bacteria | 4890 |
| 224 | Ga0207691_10074297 | 3300025940 | Unclassified | 3066 |
| 225 | Ga0207711_10004123 | 3300025941 | Bacteria | 12454 |
| 226 | Ga0207711_10025749 | 3300025941 | Bacteria | 4933 |
| 227 | Ga0207711_10101091 | 3300025941 | Bacteria | 2551 |
| 228 | Ga0207679_10048402 | 3300025945 | Bacteria | 3095 |
| 229 | Ga0207679_10088263 | 3300025945 | Bacteria | 2390 |
| 230 | Ga0207667_10181630 | 3300025949 | Bacteria | 2160 |
| 231 | Ga0207651_10004213 | 3300025960 | Bacteria | 7207 |
| 232 | Ga0207651_10034139 | 3300025960 | Bacteria | 3291 |
| 233 | Ga0207651_10200764 | 3300025960 | Bacteria | 1598 |
| 234 | Ga0207712_10005313 | 3300025961 | Bacteria | 8136 |
| 235 | Ga0207658_10005331 | 3300025986 | Bacteria | 8840 |
| 236 | Ga0207658_10016732 | 3300025986 | Bacteria | 5047 |
| 237 | Ga0207658_10043938 | 3300025986 | Bacteria | 3251 |
| 238 | Ga0207658_10380604 | 3300025986 | Bacteria | 1236 |
| 239 | Ga0207658_10502259 | 3300025986 | Bacteria | 1080 |
| 240 | Ga0207677_10010764 | 3300026023 | Bacteria | 5186 |
| 241 | Ga0207703_10066169 | 3300026035 | Bacteria | 2972 |
| 242 | Ga0207703_10080614 | 3300026035 | Bacteria | 2711 |
| 243 | Ga0207678_10129481 | 3300026067 | Unclassified | 2152 |
| 244 | Ga0207678_10261242 | 3300026067 | Bacteria | 1484 |
| 245 | Ga0207708_10244039 | 3300026075 | Bacteria | 1445 |
| 246 | Ga0207702_10064577 | 3300026078 | Bacteria | 3133 |
| 247 | Ga0207702_10190307 | 3300026078 | Bacteria | 1895 |
| 248 | Ga0207641_10000983 | 3300026088 | Bacteria | 29120 |
| 249 | Ga0207641_10016230 | 3300026088 | Bacteria | 6099 |
| 250 | Ga0207641_10082003 | 3300026088 | Bacteria | 2801 |
| 251 | Ga0207641_10393463 | 3300026088 | Bacteria | 1329 |
| 252 | Ga0207648_10450917 | 3300026089 | Bacteria | 1171 |
| 253 | Ga0207676_10006159 | 3300026095 | Bacteria | 8471 |
| 254 | Ga0207676_10063678 | 3300026095 | Bacteria | 2929 |
| 255 | Ga0207676_10065088 | 3300026095 | Unclassified | 2902 |
| 256 | Ga0207676_10104881 | 3300026095 | Bacteria | 2352 |
| 257 | Ga0207676_10232812 | 3300026095 | Unclassified | 1648 |
| 258 | Ga0207676_10374773 | 3300026095 | Bacteria | 1323 |
| 259 | Ga0207674_10109933 | 3300026116 | Bacteria | 2732 |
| 260 | Ga0207683_10260786 | 3300026121 | Bacteria | 1582 |
| 261 | Ga0207698_10035919 | 3300026142 | Bacteria | 3631 |
| 262 | Ga0209588_1011247 | 3300027671 | Bacteria | 2702 |
| 263 | Ga0207428_10016392 | 3300027907 | Bacteria | 6375 |
| 264 | Ga0207428_10215556 | 3300027907 | Bacteria | 1441 |
| 265 | Ga0268265_10036399 | 3300028380 | Unclassified | 3605 |
| 266 | Ga0268264_10002973 | 3300028381 | Bacteria | 14727 |
| 267 | Ga0268264_10013075 | 3300028381 | Bacteria | 6824 |
| 268 | Ga0265323_10010559 | 3300028653 | Bacteria | 3741 |
| 269 | Ga0265322_10011433 | 3300028654 | Bacteria | 2574 |
| 270 | Ga0265338_10028952 | 3300028800 | Bacteria | 5508 |
| 271 | Ga0265338_10080535 | 3300028800 | Unclassified | 2735 |
| 272 | Ga0265324_10000100 | 3300029957 | Bacteria | 67937 |
| 273 | Ga0265330_10010115 | 3300031235 | Bacteria | 4457 |
| 274 | Ga0265332_10034507 | 3300031238 | Bacteria | 2198 |
| 275 | Ga0265328_10002029 | 3300031239 | Bacteria | 9156 |
| 276 | Ga0265329_10005075 | 3300031242 | Bacteria | 5373 |
| 277 | Ga0265340_10000155 | 3300031247 | Bacteria | 34825 |
| 278 | Ga0265339_10000018 | 3300031249 | Bacteria | 181364 |
| 279 | Ga0265331_10018648 | 3300031250 | Bacteria | 3593 |
| 280 | Ga0265316_10129827 | 3300031344 | Bacteria | 1899 |
| 281 | Ga0265313_10132983 | 3300031595 | Bacteria | 1076 |
| 282 | Ga0265314_10000465 | 3300031711 | Bacteria | 53953 |
| 283 | Ga0265314_10154688 | 3300031711 | Bacteria | 1402 |
| 284 | Ga0265342_10009431 | 3300031712 | Bacteria | 6882 |
| 285 | Ga0265342_10011424 | 3300031712 | Bacteria | 6081 |
| 286 | Ga0373950_0006442 | 3300034818 | Bacteria | 1791 |
| 287 | Ga0373958_0003642 | 3300034819 | Bacteria | 2236 |
| 288 | Ga0373926_0002881 | 3300035083 | Bacteria | 5511 |
| 289 | Ga0373929_0002363 | 3300035085 | Bacteria | 3469 |
| 290 | Ga0373944_0007477 | 3300035089 | Bacteria | 2931 |
| 291 | Ga0373949_0002837 | 3300035090 | Bacteria | 4301 |
| 292 | Ga0373952_0002312 | 3300035092 | Bacteria | 3434 |
| 293 | Ga0373939_0002680 | 3300035114 | Bacteria | 4173 |
| 294 | Ga0373953_0031094 | 3300035117 | Bacteria | 2075 |
| 295 | Ga0373956_0071219 | 3300035119 | Bacteria | 1586 |
| 296 | Ga0373957_0034194 | 3300035120 | Bacteria | 1881 |
| 297 | Ga0373960_0042395 | 3300035121 | Bacteria | 1321 |
| 298 | Ga0373943_0022342 | 3300035170 | Bacteria | 2930 |
| 299 | Ga0373946_0002712 | 3300035171 | Bacteria | 6260 |
| 300 | Ga0373946_0131560 | 3300035171 | Bacteria | 1151 |
| 301 | Ga0373955_0009086 | 3300035172 | Bacteria | 4641 |
| 302 | Ga0373955_0037591 | 3300035172 | Bacteria | 2575 |
| 303 | Ga0373955_0163078 | 3300035172 | Bacteria | 1317 |
| 304 | Ga0373955_0200892 | 3300035172 | Bacteria | 1187 |
| 305 | Ga0373942_0022308 | 3300035207 | Bacteria | 1605 |
| 306 | Ga0373942_0057827 | 3300035207 | Bacteria | 1104 |
| 307 | Ga0373961_0005625 | 3300035241 | Bacteria | 3009 |
| 308 | Ga0373961_0022530 | 3300035241 | Bacteria | 1686 |
| 309 | Ga0373924_0015973 | 3300035410 | Bacteria | 2861 |
| 310 | Ga0373924_0019338 | 3300035410 | Bacteria | 2638 |
| 311 | Ga0373924_0020754 | 3300035410 | Bacteria | 2557 |
| 312 | Ga0373931_0000137 | 3300035691 | Bacteria | 33227 |
| 313 | Ga0373931_0042210 | 3300035691 | Bacteria | 2398 |
| 314 | Ga0373931_0163207 | 3300035691 | Bacteria | 1308 |
| 315 | Ga0373931_0270925 | 3300035691 | Bacteria | 1039 |
| 316 | Ga0373935_0003641 | 3300035692 | Bacteria | 8983 |
| 317 | Ga0373935_0029080 | 3300035692 | Bacteria | 3419 |
| 318 | Ga0373927_0047346 | 3300035695 | Bacteria | 2781 |
| 319 | Ga0373927_0192416 | 3300035695 | Bacteria | 1338 |
| 320 | Ga0373933_0004100 | 3300035724 | Bacteria | 8028 |
| 321 | Ga0373947_0007062 | 3300035725 | Bacteria | 6508 |
| 322 | Ga0373947_0111288 | 3300035725 | Bacteria | 1730 |
| 323 | Ga0373947_0142009 | 3300035725 | Bacteria | 1540 |
| 324 | Ga0373937_0030198 | 3300036401 | Bacteria | 4909 |
| 325 | Ga0373937_0036952 | 3300036401 | Bacteria | 4451 |
| 326 | Ga0373937_0062544 | 3300036401 | Bacteria | 3422 |
| 327 | Ga0373937_0129964 | 3300036401 | Unclassified | 2352 |
| 328 | Ga0373925_0024685 | 3300037068 | Bacteria | 4389 |
| 329 | Ga0373925_0032539 | 3300037068 | Bacteria | 3839 |
| 330 | Ga0373925_0071641 | 3300037068 | Bacteria | 2621 |
| 331 | Ga0395899_0010650 | 3300037312 | Bacteria | 7045 |
| 332 | Ga0395899_0140309 | 3300037312 | Bacteria | 1720 |
| 333 | Ga0395900_0026774 | 3300037418 | Bacteria | 5901 |
| 334 | Ga0395900_0033906 | 3300037418 | Bacteria | 5254 |
| 335 | Ga0395898_0033322 | 3300037466 | Bacteria | 5142 |
| 336 | Ga0395905_0000210 | 3300037471 | Bacteria | 90096 |
| 337 | Ga0395905_0009330 | 3300037471 | Bacteria | 9597 |
| 338 | Ga0395901_0019693 | 3300038443 | Bacteria | 6898 |
| 339 | Ga0395901_0064696 | 3300038443 | Bacteria | 3806 |
| 340 | Ga0436365_1502423 | 3300039437 | Bacteria | 2811 |
| 341 | Ga0436360_0420685 | 3300039438 | Bacteria | 6448 |
| 342 | Ga0436360_0881504 | 3300039438 | Bacteria | 2920 |
| 343 | Ga0436360_1367677 | 3300039438 | Bacteria | 1027 |
| 344 | Ga0436361_0351372 | 3300039447 | Bacteria | 183069 |
| 345 | Ga0466969_0006591 | 3300044656 | Bacteria | 6174 |
| 346 | Ga0466961_0025773 | 3300044693 | Bacteria | 3779 |
| 347 | Ga0466964_0016894 | 3300044706 | Bacteria | 2790 |
| 348 | Ga0453684_0152160 | 3300044712 | Bacteria | 2748 |
| 349 | Ga0466971_0007588 | 3300044719 | Bacteria | 4731 |
| 350 | Ga0466957_0081598 | 3300044842 | Bacteria | 2014 |
| 351 | Ga0466959_0060352 | 3300045049 | Bacteria | 2759 |
| 352 | Ga0451576_0001414 | 3300045051 | Bacteria | 41151 |
| 353 | Ga0495592_0025656 | 3300046454 | Bacteria | 4473 |
| 354 | Ga0495592_0037253 | 3300046454 | Bacteria | 3662 |
| 355 | Ga0495592_0060551 | 3300046454 | Bacteria | 2784 |
| 356 | Ga0495603_0150835 | 3300046455 | Bacteria | 1350 |
| 357 | Ga0495629_0029309 | 3300046459 | Bacteria | 3904 |
| 358 | Ga0495580_0015325 | 3300046472 | Bacteria | 5785 |
| 359 | Ga0495580_0105575 | 3300046472 | Bacteria | 1957 |
| 360 | Ga0495582_0091012 | 3300046473 | Bacteria | 1701 |
| 361 | Ga0495639_0010389 | 3300046475 | Bacteria | 4010 |
| 362 | Ga0495594_0179891 | 3300046499 | Bacteria | 1204 |
| 363 | Ga0495608_0036439 | 3300046511 | Bacteria | 3312 |
| 364 | Ga0495618_0007202 | 3300046514 | Bacteria | 6736 |
| 365 | Ga0495618_0036316 | 3300046514 | Bacteria | 3092 |
| 366 | Ga0495628_0125544 | 3300046516 | Bacteria | 1967 |
| 367 | Ga0495630_0021058 | 3300046517 | Bacteria | 4814 |
| 368 | Ga0495630_0157641 | 3300046517 | Bacteria | 1728 |
| 369 | Ga0495630_0353880 | 3300046517 | Bacteria | 1124 |
| 370 | Ga0495652_0160840 | 3300046529 | Bacteria | 1744 |
| 371 | Ga0495652_0204109 | 3300046529 | Bacteria | 1498 |
| 372 | Ga0495640_0008068 | 3300046533 | Bacteria | 8270 |
| 373 | Ga0495640_0151619 | 3300046533 | Bacteria | 1489 |
| 374 | Ga0495586_0010401 | 3300046535 | Bacteria | 4946 |
| 375 | Ga0495586_0054736 | 3300046535 | Bacteria | 2163 |
| 376 | Ga0495586_0160931 | 3300046535 | Bacteria | 1266 |
| 377 | Ga0495621_0040079 | 3300046539 | Bacteria | 1640 |
| 378 | Ga0495667_0033645 | 3300046559 | Bacteria | 3430 |
| 379 | Ga0495667_0036824 | 3300046559 | Bacteria | 3262 |
| 380 | Ga0495634_0025086 | 3300046642 | Bacteria | 4178 |
| 381 | Ga0495634_0188354 | 3300046642 | Bacteria | 1288 |
| 382 | Ga0495588_0009567 | 3300046674 | Bacteria | 4485 |
| 383 | Ga0495657_0046643 | 3300046675 | Bacteria | 2932 |
| 384 | Ga0495647_0003005 | 3300046681 | Bacteria | 5367 |
| 385 | Ga0495647_0138710 | 3300046681 | Unclassified | 1036 |
| 386 | Ga0495658_0004008 | 3300046683 | Bacteria | 7260 |
| 387 | Ga0495658_0006442 | 3300046683 | Bacteria | 5767 |
| 388 | Ga0495669_0018584 | 3300046684 | Bacteria | 2990 |
| 389 | Ga0495613_0009281 | 3300046689 | Bacteria | 7298 |
| 390 | Ga0495613_0010422 | 3300046689 | Bacteria | 6903 |
| 391 | Ga0495613_0029861 | 3300046689 | Bacteria | 4051 |
| 392 | Ga0495600_0049281 | 3300046809 | Bacteria | 2748 |
| 393 | Ga0495600_0174286 | 3300046809 | Unclassified | 1387 |
| 394 | Ga0495581_0072139 | 3300047315 | Bacteria | 1998 |
| 395 | Ga0495674_0084806 | 3300047319 | Bacteria | 2714 |
| 396 | Ga0495672_0200587 | 3300047320 | Bacteria | 998 |
| 397 | Ga0495676_0072455 | 3300047321 | Bacteria | 2645 |
| 398 | Ga0495680_0010940 | 3300047322 | Bacteria | 8063 |
| 399 | Ga0495680_0104991 | 3300047322 | Bacteria | 2101 |
| 400 | Ga0495675_0100141 | 3300047444 | Unclassified | 1814 |
| 401 | Ga0495684_0115975 | 3300047471 | Bacteria | 2019 |
| 402 | Ga0496102_0000215 | 3300048905 | Bacteria | 76113 |
| 403 | Ga0496103_0036429 | 3300048906 | Bacteria | 3013 |
| 404 | Ga0496104_0428781 | 3300048907 | Bacteria | 1234 |
| 405 | Ga0496112_0075319 | 3300048915 | Bacteria | 3338 |
| 406 | nmdc:mga07m45_172601_c1 | 3300050496 | Bacteria | 1257 |
| 407 | nmdc:mga05p37_10705_c1 | 3300050507 | Bacteria | 10887 |
| 408 | nmdc:mga05p37_154167_c1 | 3300050507 | Unclassified | 2808 |
| 409 | nmdc:mga05p37_219007_c1 | 3300050507 | Bacteria | 2298 |
| 410 | nmdc:mga05p37_271605_c1 | 3300050507 | Bacteria | 2025 |
| 411 | nmdc:mga09592_259807_c1 | 3300050508 | Bacteria | 1506 |
| 412 | nmdc:mga06r32_271909_c1 | 3300050510 | Bacteria | 1682 |
| 413 | nmdc:mga08y16_127420_c1 | 3300050511 | Bacteria | 2648 |
| 414 | nmdc:mga08y16_186045_c1 | 3300050511 | Bacteria | 2155 |
| 415 | nmdc:mga0n895_112305_c1 | 3300050512 | Bacteria | 2742 |
| 416 | nmdc:mga0n895_115979_c1 | 3300050512 | Bacteria | 2697 |
| 417 | nmdc:mga0n895_46128_c1 | 3300050512 | Unclassified | 4256 |
| 418 | nmdc:mga0n895_584598_c1 | 3300050512 | Unclassified | 1120 |
| 419 | nmdc:mga0rr50_23721_c1 | 3300050513 | Unclassified | 4237 |
| 420 | nmdc:mga0rr50_267159_c1 | 3300050513 | Bacteria | 1425 |
| 421 | nmdc:mga0rr50_406647_c1 | 3300050513 | Bacteria | 1150 |
| 422 | nmdc:mga08x19_15_c1 | 3300050514 | Bacteria | 354290 |
| 423 | nmdc:mga08x19_16_c1 | 3300050514 | Bacteria | 348119 |
| 424 | nmdc:mga08x19_2531_c1 | 3300050514 | Bacteria | 11107 |
| 425 | nmdc:mga0a205_112681_c1 | 3300050515 | Bacteria | 2619 |
| 426 | nmdc:mga0a205_132150_c1 | 3300050515 | Bacteria | 2397 |
| 427 | nmdc:mga0a205_310908_c1 | 3300050515 | Bacteria | 1448 |
| 428 | nmdc:mga0a205_322739_c1 | 3300050515 | Bacteria | 1415 |
| 429 | nmdc:mga0a205_382270_c1 | 3300050515 | Bacteria | 1273 |
| 430 | nmdc:mga0a205_67360_c1 | 3300050515 | Bacteria | 3458 |
| 431 | Ga0495601_0008949 | 3300053077 | Bacteria | 5909 |
| 432 | Ga0495595_0043993 | 3300053084 | Bacteria | 2050 |
| 433 | Ga0500642_0000776 | 3300053130 | Bacteria | 9346 |
| 434 | Ga0500616_0006139 | 3300053153 | Bacteria | 7947 |
| 435 | Ga0466962_0005055 | 3300061719 | Bacteria | 6345 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009177 | Ga0105248_10238838 | Ga0105248_102388384 | 250 |
| 2 | 3300039437 | Ga0436365_1502423 | Ga0436365_1502423_1310_2191 | 250 |
| 3 | 3300046499 | Ga0495594_0179891 | Ga0495594_0179891_368_1141 | 251 |
| 4 | 3300050512 | nmdc:mga0n895_584598_c1 | nmdc:mga0n895_584598_c1_257_1057 | 258 |
| 5 | 3300005518 | Ga0070699_100169139 | Ga0070699_1001691392 | 268 |
| 6 | 3300035120 | Ga0373957_0034194 | Ga0373957_0034194_53_892 | 273 |
| 7 | 3300046681 | Ga0495647_0138710 | Ga0495647_0138710_32_913 | 277 |
| 8 | 3300050515 | nmdc:mga0a205_310908_c1 | nmdc:mga0a205_310908_c1_345_1196 | 277 |
| 9 | 3300039438 | Ga0436360_0881504 | Ga0436360_0881504_763_1662 | 279 |
| 10 | 3300039438 | Ga0436360_1367677 | Ga0436360_1367677_54_920 | 279 |
| 11 | 3300005535 | Ga0070684_100175463 | Ga0070684_1001754632 | 280 |
| 12 | 3300005563 | Ga0068855_100102251 | Ga0068855_1001022513 | 280 |
| 13 | 3300005616 | Ga0068852_100052348 | Ga0068852_1000523483 | 280 |
| 14 | 3300010375 | Ga0105239_10124609 | Ga0105239_101246093 | 280 |
| 15 | 3300025904 | Ga0207647_10183959 | Ga0207647_101839592 | 280 |
| 16 | 3300025919 | Ga0207657_10261896 | Ga0207657_102618962 | 280 |
| 17 | 3300025932 | Ga0207690_10192349 | Ga0207690_101923493 | 280 |
| 18 | 3300025945 | Ga0207679_10088263 | Ga0207679_100882633 | 280 |
| 19 | 3300026067 | Ga0207678_10261242 | Ga0207678_102612422 | 280 |
| 20 | 3300026078 | Ga0207702_10190307 | Ga0207702_101903073 | 280 |
| 21 | 3300026142 | Ga0207698_10035919 | Ga0207698_100359192 | 280 |
| 22 | 3300037418 | Ga0395900_0033906 | Ga0395900_0033906_3062_3934 | 280 |
| 23 | 3300038443 | Ga0395901_0019693 | Ga0395901_0019693_4580_5452 | 280 |
| 24 | 3300053153 | Ga0500616_0006139 | Ga0500616_0006139_3260_4132 | 281 |
| 25 | 3300026075 | Ga0207708_10244039 | Ga0207708_102440392 | 282 |
| 26 | 3300031239 | Ga0265328_10002029 | Ga0265328_100020298 | 282 |
| 27 | 3300006237 | Ga0097621_100091397 | Ga0097621_1000913975 | 283 |
| 28 | 3300014969 | Ga0157376_10041991 | Ga0157376_100419914 | 283 |
| 29 | 3300039447 | Ga0436361_0351372 | Ga0436361_0351372_123990_124880 | 283 |
| 30 | 3300046517 | Ga0495630_0353880 | Ga0495630_0353880_18_869 | 283 |
| 31 | 3300048905 | Ga0496102_0000215 | Ga0496102_0000215_22540_23418 | 283 |
| 32 | 3300048906 | Ga0496103_0036429 | Ga0496103_0036429_947_1825 | 283 |
| 33 | 3300009176 | Ga0105242_10000432 | Ga0105242_1000043236 | 285 |
| 34 | 3300037312 | Ga0395899_0010650 | Ga0395899_0010650_2066_2947 | 285 |
| 35 | 3300037418 | Ga0395900_0026774 | Ga0395900_0026774_3800_4681 | 285 |
| 36 | 3300037466 | Ga0395898_0033322 | Ga0395898_0033322_412_1293 | 285 |
| 37 | 3300037471 | Ga0395905_0009330 | Ga0395905_0009330_4886_5767 | 285 |
| 38 | 3300038443 | Ga0395901_0064696 | Ga0395901_0064696_2272_3153 | 285 |
| 39 | 3300046539 | Ga0495621_0040079 | Ga0495621_0040079_369_1256 | 285 |
| 40 | 3300046684 | Ga0495669_0018584 | Ga0495669_0018584_1467_2354 | 285 |
| 41 | 3300005295 | Ga0065707_10200961 | Ga0065707_102009611 | 286 |
| 42 | 3300005327 | Ga0070658_10087665 | Ga0070658_100876653 | 286 |
| 43 | 3300005331 | Ga0070670_100001864 | Ga0070670_1000018643 | 286 |
| 44 | 3300005343 | Ga0070687_100025365 | Ga0070687_1000253653 | 286 |
| 45 | 3300005365 | Ga0070688_100104658 | Ga0070688_1001046582 | 286 |
| 46 | 3300005438 | Ga0070701_10047082 | Ga0070701_100470822 | 286 |
| 47 | 3300005444 | Ga0070694_100248942 | Ga0070694_1002489421 | 286 |
| 48 | 3300005535 | Ga0070684_100026564 | Ga0070684_1000265646 | 286 |
| 49 | 3300005544 | Ga0070686_100012552 | Ga0070686_1000125526 | 286 |
| 50 | 3300005544 | Ga0070686_100035869 | Ga0070686_1000358692 | 286 |
| 51 | 3300005545 | Ga0070695_100083325 | Ga0070695_1000833252 | 286 |
| 52 | 3300005546 | Ga0070696_100105175 | Ga0070696_1001051753 | 286 |
| 53 | 3300005615 | Ga0070702_100014986 | Ga0070702_1000149864 | 286 |
| 54 | 3300005618 | Ga0068864_100002406 | Ga0068864_1000024069 | 286 |
| 55 | 3300005841 | Ga0068863_100029751 | Ga0068863_1000297512 | 286 |
| 56 | 3300005843 | Ga0068860_100559279 | Ga0068860_1005592792 | 286 |
| 57 | 3300006237 | Ga0097621_100003439 | Ga0097621_1000034393 | 286 |
| 58 | 3300006358 | Ga0068871_100000765 | Ga0068871_10000076520 | 286 |
| 59 | 3300006852 | Ga0075433_10385065 | Ga0075433_103850652 | 286 |
| 60 | 3300006871 | Ga0075434_100002577 | Ga0075434_1000025778 | 286 |
| 61 | 3300006880 | Ga0075429_100080790 | Ga0075429_1000807901 | 286 |
| 62 | 3300009147 | Ga0114129_10521657 | Ga0114129_105216573 | 286 |
| 63 | 3300025909 | Ga0207705_10306504 | Ga0207705_103065042 | 286 |
| 64 | 3300025918 | Ga0207662_10032708 | Ga0207662_100327083 | 286 |
| 65 | 3300025918 | Ga0207662_10038624 | Ga0207662_100386243 | 286 |
| 66 | 3300026095 | Ga0207676_10063678 | Ga0207676_100636784 | 286 |
| 67 | 3300026095 | Ga0207676_10374773 | Ga0207676_103747732 | 286 |
| 68 | 3300034818 | Ga0373950_0006442 | Ga0373950_0006442_404_1294 | 286 |
| 69 | 3300034819 | Ga0373958_0003642 | Ga0373958_0003642_1022_1912 | 286 |
| 70 | 3300035083 | Ga0373926_0002881 | Ga0373926_0002881_3310_4233 | 286 |
| 71 | 3300035085 | Ga0373929_0002363 | Ga0373929_0002363_1767_2783 | 286 |
| 72 | 3300035089 | Ga0373944_0007477 | Ga0373944_0007477_1627_2550 | 286 |
| 73 | 3300035090 | Ga0373949_0002837 | Ga0373949_0002837_2347_3363 | 286 |
| 74 | 3300035092 | Ga0373952_0002312 | Ga0373952_0002312_1059_2075 | 286 |
| 75 | 3300035114 | Ga0373939_0002680 | Ga0373939_0002680_81_971 | 286 |
| 76 | 3300035117 | Ga0373953_0031094 | Ga0373953_0031094_309_1199 | 286 |
| 77 | 3300035119 | Ga0373956_0071219 | Ga0373956_0071219_597_1487 | 286 |
| 78 | 3300035121 | Ga0373960_0042395 | Ga0373960_0042395_115_1005 | 286 |
| 79 | 3300035170 | Ga0373943_0022342 | Ga0373943_0022342_422_1345 | 286 |
| 80 | 3300035171 | Ga0373946_0002712 | Ga0373946_0002712_5120_6043 | 286 |
| 81 | 3300035171 | Ga0373946_0131560 | Ga0373946_0131560_27_950 | 286 |
| 82 | 3300035172 | Ga0373955_0009086 | Ga0373955_0009086_2868_3758 | 286 |
| 83 | 3300035172 | Ga0373955_0200892 | Ga0373955_0200892_40_927 | 286 |
| 84 | 3300035207 | Ga0373942_0022308 | Ga0373942_0022308_104_994 | 286 |
| 85 | 3300035207 | Ga0373942_0057827 | Ga0373942_0057827_112_1002 | 286 |
| 86 | 3300035241 | Ga0373961_0005625 | Ga0373961_0005625_280_1296 | 286 |
| 87 | 3300035241 | Ga0373961_0022530 | Ga0373961_0022530_609_1499 | 286 |
| 88 | 3300035410 | Ga0373924_0019338 | Ga0373924_0019338_1368_2258 | 286 |
| 89 | 3300035410 | Ga0373924_0020754 | Ga0373924_0020754_543_1466 | 286 |
| 90 | 3300035691 | Ga0373931_0000137 | Ga0373931_0000137_12466_13482 | 286 |
| 91 | 3300035691 | Ga0373931_0042210 | Ga0373931_0042210_1462_2352 | 286 |
| 92 | 3300035691 | Ga0373931_0270925 | Ga0373931_0270925_83_973 | 286 |
| 93 | 3300035692 | Ga0373935_0003641 | Ga0373935_0003641_4093_5016 | 286 |
| 94 | 3300035695 | Ga0373927_0047346 | Ga0373927_0047346_1053_1976 | 286 |
| 95 | 3300035695 | Ga0373927_0192416 | Ga0373927_0192416_256_1179 | 286 |
| 96 | 3300035724 | Ga0373933_0004100 | Ga0373933_0004100_397_1287 | 286 |
| 97 | 3300035725 | Ga0373947_0111288 | Ga0373947_0111288_361_1284 | 286 |
| 98 | 3300035725 | Ga0373947_0142009 | Ga0373947_0142009_447_1370 | 286 |
| 99 | 3300036401 | Ga0373937_0030198 | Ga0373937_0030198_2621_3511 | 286 |
| 100 | 3300037068 | Ga0373925_0024685 | Ga0373925_0024685_50_973 | 286 |
| 101 | 3300037068 | Ga0373925_0071641 | Ga0373925_0071641_893_1816 | 286 |
| 102 | 3300037312 | Ga0395899_0140309 | Ga0395899_0140309_390_1280 | 286 |
| 103 | 3300039438 | Ga0436360_0420685 | Ga0436360_0420685_5260_6150 | 286 |
| 104 | 3300044712 | Ga0453684_0152160 | Ga0453684_0152160_847_1737 | 286 |
| 105 | 3300045051 | Ga0451576_0001414 | Ga0451576_0001414_6399_7289 | 286 |
| 106 | 3300046455 | Ga0495603_0150835 | Ga0495603_0150835_168_1091 | 286 |
| 107 | 3300046472 | Ga0495580_0015325 | Ga0495580_0015325_992_1915 | 286 |
| 108 | 3300046473 | Ga0495582_0091012 | Ga0495582_0091012_488_1411 | 286 |
| 109 | 3300046475 | Ga0495639_0010389 | Ga0495639_0010389_2693_3616 | 286 |
| 110 | 3300046529 | Ga0495652_0204109 | Ga0495652_0204109_378_1265 | 286 |
| 111 | 3300046535 | Ga0495586_0010401 | Ga0495586_0010401_2842_3765 | 286 |
| 112 | 3300046559 | Ga0495667_0033645 | Ga0495667_0033645_2513_3403 | 286 |
| 113 | 3300046674 | Ga0495588_0009567 | Ga0495588_0009567_813_1736 | 286 |
| 114 | 3300046681 | Ga0495647_0003005 | Ga0495647_0003005_1496_2419 | 286 |
| 115 | 3300046683 | Ga0495658_0004008 | Ga0495658_0004008_3386_4309 | 286 |
| 116 | 3300047315 | Ga0495581_0072139 | Ga0495581_0072139_205_1128 | 286 |
| 117 | 3300047321 | Ga0495676_0072455 | Ga0495676_0072455_1075_1998 | 286 |
| 118 | 3300047322 | Ga0495680_0104991 | Ga0495680_0104991_269_1159 | 286 |
| 119 | 3300048915 | Ga0496112_0075319 | Ga0496112_0075319_625_1509 | 286 |
| 120 | 3300050513 | nmdc:mga0rr50_406647_c1 | nmdc:mga0rr50_406647_c1_159_1049 | 286 |
| 121 | 3300050515 | nmdc:mga0a205_382270_c1 | nmdc:mga0a205_382270_c1_167_1057 | 286 |
| 122 | 3300005367 | Ga0070667_100591347 | Ga0070667_1005913471 | 287 |
| 123 | 3300005617 | Ga0068859_100216922 | Ga0068859_1002169222 | 287 |
| 124 | 3300006931 | Ga0097620_100216932 | Ga0097620_1002169322 | 287 |
| 125 | 3300009094 | Ga0111539_10368759 | Ga0111539_103687592 | 287 |
| 126 | 3300025986 | Ga0207658_10502259 | Ga0207658_105022592 | 287 |
| 127 | 3300035691 | Ga0373931_0163207 | Ga0373931_0163207_378_1268 | 287 |
| 128 | 3300005439 | Ga0070711_100000025 | Ga0070711_10000002570 | 288 |
| 129 | 3300005543 | Ga0070672_100168985 | Ga0070672_1001689853 | 288 |
| 130 | 3300006914 | Ga0075436_100128304 | Ga0075436_1001283042 | 288 |
| 131 | 3300009094 | Ga0111539_10247616 | Ga0111539_102476162 | 288 |
| 132 | 3300025303 | Ga0209051_1032658 | Ga0209051_10326582 | 288 |
| 133 | 3300025916 | Ga0207663_10000009 | Ga0207663_1000000930 | 288 |
| 134 | 3300025940 | Ga0207691_10074297 | Ga0207691_100742974 | 288 |
| 135 | 3300046472 | Ga0495580_0105575 | Ga0495580_0105575_419_1306 | 288 |
| 136 | 3300048907 | Ga0496104_0428781 | Ga0496104_0428781_42_944 | 288 |
| 137 | 3300050511 | nmdc:mga08y16_186045_c1 | nmdc:mga08y16_186045_c1_898_1782 | 288 |
| 138 | 3300050514 | nmdc:mga08x19_15_c1 | nmdc:mga08x19_15_c1_251271_252170 | 288 |
| 139 | 3300005336 | Ga0070680_100082465 | Ga0070680_1000824654 | 289 |
| 140 | 3300005435 | Ga0070714_100177049 | Ga0070714_1001770492 | 289 |
| 141 | 3300005438 | Ga0070701_10010220 | Ga0070701_100102204 | 289 |
| 142 | 3300005563 | Ga0068855_100007205 | Ga0068855_1000072054 | 289 |
| 143 | 3300005617 | Ga0068859_100037539 | Ga0068859_1000375391 | 289 |
| 144 | 3300006931 | Ga0097620_100037539 | Ga0097620_1000375391 | 289 |
| 145 | 3300009147 | Ga0114129_10054685 | Ga0114129_100546855 | 289 |
| 146 | 3300013306 | Ga0163162_10223306 | Ga0163162_102233063 | 289 |
| 147 | 3300025913 | Ga0207695_10361697 | Ga0207695_103616972 | 289 |
| 148 | 3300025924 | Ga0207694_10161172 | Ga0207694_101611723 | 289 |
| 149 | 3300025929 | Ga0207664_10203268 | Ga0207664_102032683 | 289 |
| 150 | 3300028653 | Ga0265323_10010559 | Ga0265323_100105595 | 289 |
| 151 | 3300028654 | Ga0265322_10011433 | Ga0265322_100114332 | 289 |
| 152 | 3300028800 | Ga0265338_10028952 | Ga0265338_100289523 | 289 |
| 153 | 3300028800 | Ga0265338_10080535 | Ga0265338_100805351 | 289 |
| 154 | 3300029957 | Ga0265324_10000100 | Ga0265324_100001003 | 289 |
| 155 | 3300031235 | Ga0265330_10010115 | Ga0265330_100101155 | 289 |
| 156 | 3300031238 | Ga0265332_10034507 | Ga0265332_100345072 | 289 |
| 157 | 3300031247 | Ga0265340_10000155 | Ga0265340_1000015534 | 289 |
| 158 | 3300031249 | Ga0265339_10000018 | Ga0265339_1000001836 | 289 |
| 159 | 3300031250 | Ga0265331_10018648 | Ga0265331_100186483 | 289 |
| 160 | 3300031711 | Ga0265314_10000465 | Ga0265314_1000046552 | 289 |
| 161 | 3300031711 | Ga0265314_10154688 | Ga0265314_101546882 | 289 |
| 162 | 3300031712 | Ga0265342_10009431 | Ga0265342_100094315 | 289 |
| 163 | 3300031712 | Ga0265342_10011424 | Ga0265342_100114246 | 289 |
| 164 | 3300050507 | nmdc:mga05p37_154167_c1 | nmdc:mga05p37_154167_c1_239_1126 | 289 |
| 165 | 3300050512 | nmdc:mga0n895_46128_c1 | nmdc:mga0n895_46128_c1_3335_4222 | 289 |
| 166 | 3300050513 | nmdc:mga0rr50_23721_c1 | nmdc:mga0rr50_23721_c1_1504_2391 | 289 |
| 167 | 3300050515 | nmdc:mga0a205_112681_c1 | nmdc:mga0a205_112681_c1_1666_2553 | 289 |
| 168 | 3300005614 | Ga0068856_100087573 | Ga0068856_1000875733 | 290 |
| 169 | 3300007076 | Ga0075435_100292145 | Ga0075435_1002921451 | 290 |
| 170 | 3300009101 | Ga0105247_10221070 | Ga0105247_102210701 | 290 |
| 171 | 3300014325 | Ga0163163_10222188 | Ga0163163_102221882 | 290 |
| 172 | 3300025949 | Ga0207667_10181630 | Ga0207667_101816303 | 290 |
| 173 | 3300026078 | Ga0207702_10064577 | Ga0207702_100645773 | 290 |
| 174 | 3300031595 | Ga0265313_10132983 | Ga0265313_101329831 | 290 |
| 175 | 3300044656 | Ga0466969_0006591 | Ga0466969_0006591_4303_5205 | 290 |
| 176 | 3300044693 | Ga0466961_0025773 | Ga0466961_0025773_942_1844 | 290 |
| 177 | 3300044706 | Ga0466964_0016894 | Ga0466964_0016894_1735_2637 | 290 |
| 178 | 3300044719 | Ga0466971_0007588 | Ga0466971_0007588_1551_2453 | 290 |
| 179 | 3300044842 | Ga0466957_0081598 | Ga0466957_0081598_194_1096 | 290 |
| 180 | 3300045049 | Ga0466959_0060352 | Ga0466959_0060352_1654_2556 | 290 |
| 181 | 3300046454 | Ga0495592_0025656 | Ga0495592_0025656_144_1079 | 290 |
| 182 | 3300046514 | Ga0495618_0036316 | Ga0495618_0036316_1977_2876 | 290 |
| 183 | 3300046517 | Ga0495630_0021058 | Ga0495630_0021058_3666_4565 | 290 |
| 184 | 3300046529 | Ga0495652_0160840 | Ga0495652_0160840_779_1678 | 290 |
| 185 | 3300046533 | Ga0495640_0008068 | Ga0495640_0008068_3564_4463 | 290 |
| 186 | 3300046535 | Ga0495586_0160931 | Ga0495586_0160931_125_1060 | 290 |
| 187 | 3300046642 | Ga0495634_0188354 | Ga0495634_0188354_148_1047 | 290 |
| 188 | 3300046683 | Ga0495658_0006442 | Ga0495658_0006442_1905_2804 | 290 |
| 189 | 3300046689 | Ga0495613_0029861 | Ga0495613_0029861_3000_3899 | 290 |
| 190 | 3300050507 | nmdc:mga05p37_271605_c1 | nmdc:mga05p37_271605_c1_1088_1981 | 290 |
| 191 | 3300061719 | Ga0466962_0005055 | Ga0466962_0005055_678_1580 | 290 |
| 192 | 3300005293 | Ga0065715_10119337 | Ga0065715_101193372 | 291 |
| 193 | 3300005295 | Ga0065707_10031181 | Ga0065707_100311811 | 291 |
| 194 | 3300005295 | Ga0065707_10110766 | Ga0065707_101107662 | 291 |
| 195 | 3300005336 | Ga0070680_100339995 | Ga0070680_1003399952 | 291 |
| 196 | 3300005445 | Ga0070708_100003651 | Ga0070708_10000365111 | 291 |
| 197 | 3300005445 | Ga0070708_100074952 | Ga0070708_1000749523 | 291 |
| 198 | 3300005445 | Ga0070708_100271711 | Ga0070708_1002717112 | 291 |
| 199 | 3300005467 | Ga0070706_100011465 | Ga0070706_1000114654 | 291 |
| 200 | 3300005467 | Ga0070706_100070108 | Ga0070706_1000701081 | 291 |
| 201 | 3300005467 | Ga0070706_100083429 | Ga0070706_1000834292 | 291 |
| 202 | 3300005468 | Ga0070707_100000509 | Ga0070707_10000050921 | 291 |
| 203 | 3300005468 | Ga0070707_100137550 | Ga0070707_1001375503 | 291 |
| 204 | 3300005471 | Ga0070698_100000808 | Ga0070698_10000080825 | 291 |
| 205 | 3300005471 | Ga0070698_100005969 | Ga0070698_1000059694 | 291 |
| 206 | 3300005518 | Ga0070699_100005358 | Ga0070699_1000053589 | 291 |
| 207 | 3300005518 | Ga0070699_100248056 | Ga0070699_1002480562 | 291 |
| 208 | 3300005536 | Ga0070697_100388443 | Ga0070697_1003884432 | 291 |
| 209 | 3300005545 | Ga0070695_100150656 | Ga0070695_1001506562 | 291 |
| 210 | 3300005549 | Ga0070704_100037317 | Ga0070704_1000373174 | 291 |
| 211 | 3300005841 | Ga0068863_100132077 | Ga0068863_1001320774 | 291 |
| 212 | 3300005844 | Ga0068862_100082609 | Ga0068862_1000826092 | 291 |
| 213 | 3300006173 | Ga0070716_100000009 | Ga0070716_100000009140 | 291 |
| 214 | 3300006353 | Ga0075370_10092452 | Ga0075370_100924522 | 291 |
| 215 | 3300006844 | Ga0075428_100044154 | Ga0075428_1000441543 | 291 |
| 216 | 3300006844 | Ga0075428_100295629 | Ga0075428_1002956292 | 291 |
| 217 | 3300006852 | Ga0075433_10081930 | Ga0075433_100819301 | 291 |
| 218 | 3300006871 | Ga0075434_100261198 | Ga0075434_1002611982 | 291 |
| 219 | 3300006871 | Ga0075434_100627148 | Ga0075434_1006271482 | 291 |
| 220 | 3300006880 | Ga0075429_100042380 | Ga0075429_1000423805 | 291 |
| 221 | 3300006880 | Ga0075429_100279415 | Ga0075429_1002794151 | 291 |
| 222 | 3300006914 | Ga0075436_100006704 | Ga0075436_1000067047 | 291 |
| 223 | 3300006914 | Ga0075436_100053534 | Ga0075436_1000535343 | 291 |
| 224 | 3300007076 | Ga0075435_100076444 | Ga0075435_1000764444 | 291 |
| 225 | 3300007076 | Ga0075435_100192749 | Ga0075435_1001927493 | 291 |
| 226 | 3300007265 | Ga0099794_10079429 | Ga0099794_100794292 | 291 |
| 227 | 3300009094 | Ga0111539_10030652 | Ga0111539_100306526 | 291 |
| 228 | 3300009147 | Ga0114129_10004820 | Ga0114129_100048205 | 291 |
| 229 | 3300009147 | Ga0114129_10120749 | Ga0114129_101207494 | 291 |
| 230 | 3300013296 | Ga0157374_10071454 | Ga0157374_100714541 | 291 |
| 231 | 3300013297 | Ga0157378_10110854 | Ga0157378_101108543 | 291 |
| 232 | 3300013297 | Ga0157378_10566296 | Ga0157378_105662961 | 291 |
| 233 | 3300013306 | Ga0163162_10035814 | Ga0163162_100358145 | 291 |
| 234 | 3300014325 | Ga0163163_10016629 | Ga0163163_100166293 | 291 |
| 235 | 3300014325 | Ga0163163_10034731 | Ga0163163_100347316 | 291 |
| 236 | 3300014968 | Ga0157379_10082588 | Ga0157379_100825884 | 291 |
| 237 | 3300025905 | Ga0207685_10000009 | Ga0207685_10000009119 | 291 |
| 238 | 3300025905 | Ga0207685_10000032 | Ga0207685_1000003245 | 291 |
| 239 | 3300025910 | Ga0207684_10017357 | Ga0207684_100173577 | 291 |
| 240 | 3300025910 | Ga0207684_10058710 | Ga0207684_100587101 | 291 |
| 241 | 3300025910 | Ga0207684_10110993 | Ga0207684_101109933 | 291 |
| 242 | 3300025910 | Ga0207684_10237484 | Ga0207684_102374842 | 291 |
| 243 | 3300025917 | Ga0207660_10318387 | Ga0207660_103183871 | 291 |
| 244 | 3300025922 | Ga0207646_10000723 | Ga0207646_1000072322 | 291 |
| 245 | 3300025922 | Ga0207646_10034120 | Ga0207646_100341203 | 291 |
| 246 | 3300025922 | Ga0207646_10101431 | Ga0207646_101014313 | 291 |
| 247 | 3300025939 | Ga0207665_10080168 | Ga0207665_100801682 | 291 |
| 248 | 3300025939 | Ga0207665_10331649 | Ga0207665_103316491 | 291 |
| 249 | 3300026095 | Ga0207676_10065088 | Ga0207676_100650883 | 291 |
| 250 | 3300027671 | Ga0209588_1011247 | Ga0209588_10112474 | 291 |
| 251 | 3300027907 | Ga0207428_10016392 | Ga0207428_100163923 | 291 |
| 252 | 3300028380 | Ga0268265_10036399 | Ga0268265_100363993 | 291 |
| 253 | 3300036401 | Ga0373937_0129964 | Ga0373937_0129964_347_1270 | 291 |
| 254 | 3300037471 | Ga0395905_0000210 | Ga0395905_0000210_15371_16345 | 291 |
| 255 | 3300046454 | Ga0495592_0037253 | Ga0495592_0037253_2617_3513 | 291 |
| 256 | 3300046516 | Ga0495628_0125544 | Ga0495628_0125544_798_1694 | 291 |
| 257 | 3300046533 | Ga0495640_0151619 | Ga0495640_0151619_143_1039 | 291 |
| 258 | 3300046535 | Ga0495586_0054736 | Ga0495586_0054736_439_1416 | 291 |
| 259 | 3300046809 | Ga0495600_0049281 | Ga0495600_0049281_1619_2515 | 291 |
| 260 | 3300047320 | Ga0495672_0200587 | Ga0495672_0200587_47_946 | 291 |
| 261 | 3300047322 | Ga0495680_0010940 | Ga0495680_0010940_6743_7639 | 291 |
| 262 | 3300050496 | nmdc:mga07m45_172601_c1 | nmdc:mga07m45_172601_c1_224_1129 | 291 |
| 263 | 3300050507 | nmdc:mga05p37_10705_c1 | nmdc:mga05p37_10705_c1_3552_4475 | 291 |
| 264 | 3300050512 | nmdc:mga0n895_112305_c1 | nmdc:mga0n895_112305_c1_1781_2704 | 291 |
| 265 | 3300050514 | nmdc:mga08x19_16_c1 | nmdc:mga08x19_16_c1_346002_346925 | 291 |
| 266 | 3300050514 | nmdc:mga08x19_2531_c1 | nmdc:mga08x19_2531_c1_6773_7696 | 291 |
| 267 | 3300050515 | nmdc:mga0a205_322739_c1 | nmdc:mga0a205_322739_c1_249_1172 | 291 |
| 268 | 3300050515 | nmdc:mga0a205_67360_c1 | nmdc:mga0a205_67360_c1_1611_2534 | 291 |
| 269 | 3300053077 | Ga0495601_0008949 | Ga0495601_0008949_1742_2638 | 291 |
| 270 | 3300053084 | Ga0495595_0043993 | Ga0495595_0043993_896_1792 | 291 |
| 271 | 3300053130 | Ga0500642_0000776 | Ga0500642_0000776_6052_7128 | 291 |
| 272 | 3300005290 | Ga0065712_10079505 | Ga0065712_100795053 | 292 |
| 273 | 3300005293 | Ga0065715_10176094 | Ga0065715_101760942 | 292 |
| 274 | 3300005331 | Ga0070670_100488293 | Ga0070670_1004882932 | 292 |
| 275 | 3300005335 | Ga0070666_10002163 | Ga0070666_100021637 | 292 |
| 276 | 3300005335 | Ga0070666_10268198 | Ga0070666_102681981 | 292 |
| 277 | 3300005340 | Ga0070689_100001654 | Ga0070689_10000165415 | 292 |
| 278 | 3300005343 | Ga0070687_100006977 | Ga0070687_1000069773 | 292 |
| 279 | 3300005353 | Ga0070669_100112678 | Ga0070669_1001126782 | 292 |
| 280 | 3300005354 | Ga0070675_100095953 | Ga0070675_1000959532 | 292 |
| 281 | 3300005355 | Ga0070671_100009401 | Ga0070671_1000094018 | 292 |
| 282 | 3300005364 | Ga0070673_100009909 | Ga0070673_1000099097 | 292 |
| 283 | 3300005365 | Ga0070688_100000911 | Ga0070688_1000009117 | 292 |
| 284 | 3300005367 | Ga0070667_100023481 | Ga0070667_1000234814 | 292 |
| 285 | 3300005438 | Ga0070701_10007216 | Ga0070701_100072165 | 292 |
| 286 | 3300005440 | Ga0070705_100053320 | Ga0070705_1000533202 | 292 |
| 287 | 3300005466 | Ga0070685_10001011 | Ga0070685_100010117 | 292 |
| 288 | 3300005467 | Ga0070706_100189705 | Ga0070706_1001897052 | 292 |
| 289 | 3300005468 | Ga0070707_100017479 | Ga0070707_1000174796 | 292 |
| 290 | 3300005468 | Ga0070707_100026541 | Ga0070707_1000265413 | 292 |
| 291 | 3300005518 | Ga0070699_100121099 | Ga0070699_1001210993 | 292 |
| 292 | 3300005543 | Ga0070672_100004815 | Ga0070672_10000481511 | 292 |
| 293 | 3300005544 | Ga0070686_100001290 | Ga0070686_10000129012 | 292 |
| 294 | 3300005548 | Ga0070665_100052522 | Ga0070665_1000525222 | 292 |
| 295 | 3300005564 | Ga0070664_100051336 | Ga0070664_1000513362 | 292 |
| 296 | 3300005577 | Ga0068857_100215117 | Ga0068857_1002151172 | 292 |
| 297 | 3300005577 | Ga0068857_100218864 | Ga0068857_1002188642 | 292 |
| 298 | 3300005617 | Ga0068859_100002534 | Ga0068859_10000253415 | 292 |
| 299 | 3300005618 | Ga0068864_100009061 | Ga0068864_1000090618 | 292 |
| 300 | 3300005841 | Ga0068863_100001204 | Ga0068863_10000120426 | 292 |
| 301 | 3300005842 | Ga0068858_100035505 | Ga0068858_1000355058 | 292 |
| 302 | 3300005843 | Ga0068860_100073654 | Ga0068860_1000736544 | 292 |
| 303 | 3300006844 | Ga0075428_100057521 | Ga0075428_1000575212 | 292 |
| 304 | 3300006852 | Ga0075433_10070479 | Ga0075433_100704793 | 292 |
| 305 | 3300006871 | Ga0075434_100103705 | Ga0075434_1001037053 | 292 |
| 306 | 3300006880 | Ga0075429_100077641 | Ga0075429_1000776414 | 292 |
| 307 | 3300006914 | Ga0075436_100054694 | Ga0075436_1000546945 | 292 |
| 308 | 3300006931 | Ga0097620_100002534 | Ga0097620_10000253415 | 292 |
| 309 | 3300007076 | Ga0075435_100185597 | Ga0075435_1001855972 | 292 |
| 310 | 3300009094 | Ga0111539_10096390 | Ga0111539_100963903 | 292 |
| 311 | 3300009101 | Ga0105247_10147143 | Ga0105247_101471432 | 292 |
| 312 | 3300009177 | Ga0105248_10001647 | Ga0105248_1000164718 | 292 |
| 313 | 3300009177 | Ga0105248_10023528 | Ga0105248_1002352810 | 292 |
| 314 | 3300009553 | Ga0105249_10006827 | Ga0105249_100068276 | 292 |
| 315 | 3300013296 | Ga0157374_10071015 | Ga0157374_100710153 | 292 |
| 316 | 3300013306 | Ga0163162_10006715 | Ga0163162_1000671513 | 292 |
| 317 | 3300013306 | Ga0163162_10095639 | Ga0163162_100956395 | 292 |
| 318 | 3300013308 | Ga0157375_10182927 | Ga0157375_101829271 | 292 |
| 319 | 3300014325 | Ga0163163_10033802 | Ga0163163_100338021 | 292 |
| 320 | 3300014745 | Ga0157377_10005452 | Ga0157377_100054526 | 292 |
| 321 | 3300014968 | Ga0157379_10001012 | Ga0157379_1000101216 | 292 |
| 322 | 3300014968 | Ga0157379_10094633 | Ga0157379_100946334 | 292 |
| 323 | 3300014968 | Ga0157379_10096982 | Ga0157379_100969822 | 292 |
| 324 | 3300014969 | Ga0157376_10052105 | Ga0157376_100521053 | 292 |
| 325 | 3300017792 | Ga0163161_10020757 | Ga0163161_100207574 | 292 |
| 326 | 3300025918 | Ga0207662_10005053 | Ga0207662_100050536 | 292 |
| 327 | 3300025922 | Ga0207646_10002477 | Ga0207646_100024775 | 292 |
| 328 | 3300025922 | Ga0207646_10005041 | Ga0207646_100050414 | 292 |
| 329 | 3300025923 | Ga0207681_10085824 | Ga0207681_100858243 | 292 |
| 330 | 3300025926 | Ga0207659_10004012 | Ga0207659_100040128 | 292 |
| 331 | 3300025926 | Ga0207659_10042039 | Ga0207659_100420391 | 292 |
| 332 | 3300025936 | Ga0207670_10009251 | Ga0207670_100092514 | 292 |
| 333 | 3300025938 | Ga0207704_10135380 | Ga0207704_101353803 | 292 |
| 334 | 3300025940 | Ga0207691_10032187 | Ga0207691_100321872 | 292 |
| 335 | 3300025941 | Ga0207711_10004123 | Ga0207711_1000412311 | 292 |
| 336 | 3300025941 | Ga0207711_10101091 | Ga0207711_101010914 | 292 |
| 337 | 3300025945 | Ga0207679_10048402 | Ga0207679_100484025 | 292 |
| 338 | 3300025960 | Ga0207651_10004213 | Ga0207651_100042136 | 292 |
| 339 | 3300025960 | Ga0207651_10034139 | Ga0207651_100341392 | 292 |
| 340 | 3300025961 | Ga0207712_10005313 | Ga0207712_100053136 | 292 |
| 341 | 3300025986 | Ga0207658_10005331 | Ga0207658_100053317 | 292 |
| 342 | 3300025986 | Ga0207658_10016732 | Ga0207658_100167324 | 292 |
| 343 | 3300025986 | Ga0207658_10380604 | Ga0207658_103806041 | 292 |
| 344 | 3300026035 | Ga0207703_10066169 | Ga0207703_100661691 | 292 |
| 345 | 3300026067 | Ga0207678_10129481 | Ga0207678_101294812 | 292 |
| 346 | 3300026088 | Ga0207641_10000983 | Ga0207641_1000098315 | 292 |
| 347 | 3300026088 | Ga0207641_10016230 | Ga0207641_100162303 | 292 |
| 348 | 3300026095 | Ga0207676_10006159 | Ga0207676_1000615911 | 292 |
| 349 | 3300026116 | Ga0207674_10109933 | Ga0207674_101099335 | 292 |
| 350 | 3300026121 | Ga0207683_10260786 | Ga0207683_102607863 | 292 |
| 351 | 3300027907 | Ga0207428_10215556 | Ga0207428_102155563 | 292 |
| 352 | 3300028381 | Ga0268264_10002973 | Ga0268264_1000297316 | 292 |
| 353 | 3300028381 | Ga0268264_10013075 | Ga0268264_100130754 | 292 |
| 354 | 3300031242 | Ga0265329_10005075 | Ga0265329_100050754 | 292 |
| 355 | 3300031344 | Ga0265316_10129827 | Ga0265316_101298273 | 292 |
| 356 | 3300035172 | Ga0373955_0163078 | Ga0373955_0163078_109_1005 | 292 |
| 357 | 3300035410 | Ga0373924_0015973 | Ga0373924_0015973_1373_2269 | 292 |
| 358 | 3300035692 | Ga0373935_0029080 | Ga0373935_0029080_401_1381 | 292 |
| 359 | 3300035725 | Ga0373947_0007062 | Ga0373947_0007062_1906_2886 | 292 |
| 360 | 3300036401 | Ga0373937_0062544 | Ga0373937_0062544_847_1743 | 292 |
| 361 | 3300037068 | Ga0373925_0032539 | Ga0373925_0032539_1193_2173 | 292 |
| 362 | 3300046454 | Ga0495592_0060551 | Ga0495592_0060551_716_1612 | 292 |
| 363 | 3300046459 | Ga0495629_0029309 | Ga0495629_0029309_878_1774 | 292 |
| 364 | 3300046511 | Ga0495608_0036439 | Ga0495608_0036439_827_1723 | 292 |
| 365 | 3300046514 | Ga0495618_0007202 | Ga0495618_0007202_2386_3282 | 292 |
| 366 | 3300046517 | Ga0495630_0157641 | Ga0495630_0157641_215_1111 | 292 |
| 367 | 3300046559 | Ga0495667_0036824 | Ga0495667_0036824_936_1832 | 292 |
| 368 | 3300046642 | Ga0495634_0025086 | Ga0495634_0025086_1564_2460 | 292 |
| 369 | 3300046675 | Ga0495657_0046643 | Ga0495657_0046643_522_1418 | 292 |
| 370 | 3300046689 | Ga0495613_0009281 | Ga0495613_0009281_2700_3596 | 292 |
| 371 | 3300046809 | Ga0495600_0174286 | Ga0495600_0174286_198_1094 | 292 |
| 372 | 3300047319 | Ga0495674_0084806 | Ga0495674_0084806_1447_2343 | 292 |
| 373 | 3300047444 | Ga0495675_0100141 | Ga0495675_0100141_395_1291 | 292 |
| 374 | 3300050508 | nmdc:mga09592_259807_c1 | nmdc:mga09592_259807_c1_280_1176 | 292 |
| 375 | 3300050510 | nmdc:mga06r32_271909_c1 | nmdc:mga06r32_271909_c1_718_1614 | 292 |
| 376 | 3300050511 | nmdc:mga08y16_127420_c1 | nmdc:mga08y16_127420_c1_637_1533 | 292 |
| 377 | 3300050512 | nmdc:mga0n895_115979_c1 | nmdc:mga0n895_115979_c1_695_1591 | 292 |
| 378 | 3300050513 | nmdc:mga0rr50_267159_c1 | nmdc:mga0rr50_267159_c1_245_1171 | 292 |
| 379 | 3300050515 | nmdc:mga0a205_132150_c1 | nmdc:mga0a205_132150_c1_1072_1968 | 292 |
| 380 | 3300005290 | Ga0065712_10077218 | Ga0065712_100772181 | 293 |
| 381 | 3300005330 | Ga0070690_100136242 | Ga0070690_1001362422 | 293 |
| 382 | 3300005331 | Ga0070670_100035564 | Ga0070670_1000355642 | 293 |
| 383 | 3300005335 | Ga0070666_10008426 | Ga0070666_100084265 | 293 |
| 384 | 3300005338 | Ga0068868_100001645 | Ga0068868_10000164512 | 293 |
| 385 | 3300005355 | Ga0070671_100029396 | Ga0070671_1000293962 | 293 |
| 386 | 3300005364 | Ga0070673_100149019 | Ga0070673_1001490193 | 293 |
| 387 | 3300005445 | Ga0070708_100184645 | Ga0070708_1001846452 | 293 |
| 388 | 3300005459 | Ga0068867_100390317 | Ga0068867_1003903172 | 293 |
| 389 | 3300005467 | Ga0070706_100374165 | Ga0070706_1003741651 | 293 |
| 390 | 3300005543 | Ga0070672_100025583 | Ga0070672_1000255833 | 293 |
| 391 | 3300005544 | Ga0070686_100059550 | Ga0070686_1000595501 | 293 |
| 392 | 3300005564 | Ga0070664_100003815 | Ga0070664_1000038152 | 293 |
| 393 | 3300005617 | Ga0068859_100139699 | Ga0068859_1001396992 | 293 |
| 394 | 3300005618 | Ga0068864_100003257 | Ga0068864_1000032574 | 293 |
| 395 | 3300005618 | Ga0068864_100113745 | Ga0068864_1001137454 | 293 |
| 396 | 3300005618 | Ga0068864_100203739 | Ga0068864_1002037392 | 293 |
| 397 | 3300005841 | Ga0068863_100018719 | Ga0068863_1000187194 | 293 |
| 398 | 3300005841 | Ga0068863_100024533 | Ga0068863_1000245333 | 293 |
| 399 | 3300005841 | Ga0068863_100419236 | Ga0068863_1004192362 | 293 |
| 400 | 3300005842 | Ga0068858_100007451 | Ga0068858_1000074519 | 293 |
| 401 | 3300006358 | Ga0068871_100026500 | Ga0068871_1000265002 | 293 |
| 402 | 3300006852 | Ga0075433_10166922 | Ga0075433_101669223 | 293 |
| 403 | 3300006871 | Ga0075434_100022397 | Ga0075434_1000223975 | 293 |
| 404 | 3300006931 | Ga0097620_100139702 | Ga0097620_1001397022 | 293 |
| 405 | 3300007076 | Ga0075435_100014447 | Ga0075435_1000144475 | 293 |
| 406 | 3300007265 | Ga0099794_10050342 | Ga0099794_100503423 | 293 |
| 407 | 3300009147 | Ga0114129_10106354 | Ga0114129_101063543 | 293 |
| 408 | 3300009177 | Ga0105248_10034588 | Ga0105248_100345884 | 293 |
| 409 | 3300009177 | Ga0105248_10237868 | Ga0105248_102378682 | 293 |
| 410 | 3300013296 | Ga0157374_10195394 | Ga0157374_101953943 | 293 |
| 411 | 3300013306 | Ga0163162_10008369 | Ga0163162_100083697 | 293 |
| 412 | 3300013308 | Ga0157375_10005048 | Ga0157375_1000504810 | 293 |
| 413 | 3300014325 | Ga0163163_10029339 | Ga0163163_100293394 | 293 |
| 414 | 3300014745 | Ga0157377_10029432 | Ga0157377_100294323 | 293 |
| 415 | 3300014969 | Ga0157376_10089655 | Ga0157376_100896552 | 293 |
| 416 | 3300025918 | Ga0207662_10148800 | Ga0207662_101488001 | 293 |
| 417 | 3300025925 | Ga0207650_10005556 | Ga0207650_100055564 | 293 |
| 418 | 3300025926 | Ga0207659_10109223 | Ga0207659_101092231 | 293 |
| 419 | 3300025931 | Ga0207644_10012091 | Ga0207644_100120913 | 293 |
| 420 | 3300025940 | Ga0207691_10012855 | Ga0207691_100128557 | 293 |
| 421 | 3300025941 | Ga0207711_10025749 | Ga0207711_100257494 | 293 |
| 422 | 3300025960 | Ga0207651_10200764 | Ga0207651_102007641 | 293 |
| 423 | 3300025986 | Ga0207658_10043938 | Ga0207658_100439383 | 293 |
| 424 | 3300026023 | Ga0207677_10010764 | Ga0207677_100107644 | 293 |
| 425 | 3300026035 | Ga0207703_10080614 | Ga0207703_100806142 | 293 |
| 426 | 3300026088 | Ga0207641_10082003 | Ga0207641_100820032 | 293 |
| 427 | 3300026088 | Ga0207641_10393463 | Ga0207641_103934632 | 293 |
| 428 | 3300026089 | Ga0207648_10450917 | Ga0207648_104509172 | 293 |
| 429 | 3300026095 | Ga0207676_10104881 | Ga0207676_101048814 | 293 |
| 430 | 3300026095 | Ga0207676_10232812 | Ga0207676_102328122 | 293 |
| 431 | 3300035172 | Ga0373955_0037591 | Ga0373955_0037591_737_1636 | 293 |
| 432 | 3300036401 | Ga0373937_0036952 | Ga0373937_0036952_3315_4214 | 293 |
| 433 | 3300046689 | Ga0495613_0010422 | Ga0495613_0010422_5393_6358 | 293 |
| 434 | 3300047471 | Ga0495684_0115975 | Ga0495684_0115975_674_1573 | 293 |
| 435 | 3300050507 | nmdc:mga05p37_219007_c1 | nmdc:mga05p37_219007_c1_177_1121 | 293 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2hyp-assembly1.cif.gz_A-2 | crystal structure of rv0805 d66a mutant | 0.7365 | 40 | 250 |
| 3d03-assembly1.cif.gz_A | 1.9a structure of glycerophoshphodiesterase (gpdq) from enterobacter aerogenes | 0.7315 | 42 | 293 |
| 2dxl-assembly1.cif.gz_A | glycerophosphodiesterase from enterobacter aerogenes | 0.7065 | 42 | 293 |
| 2nxf-assembly1.cif.gz_A | crystal structure of a dimetal phosphatase from danio rerio loc 393393 | 0.7013 | 40 | 249 |
| 6gj9-assembly1.cif.gz_A | purple acid phytase from wheat isoform b2 - regeneration complex | 0.6927 | 42 | 259 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D8PMT0_76_326_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7521 | 42 | 224 | 3.60.21.10 |
| af_Q8S2H5_315_629_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.75 | 42 | 229 | 3.60.21.10 |
| 3d03A01 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;GpdQ, catalytic alpha/beta sandwich domain | 0.7373 | 42 | 144 | 3.60.21.40 |
| 2hypA00 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7365 | 40 | 250 | 3.60.21.10 |
| af_Q9UUH0_46_301_3.60.21.10 | Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases | 0.7156 | 42 | 247 | 3.60.21.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V8TLJ9-F1-model_v4 | Serine/threonine protein phosphatase | 0.9467 | 85 | 172 |
GO:0005737
|
| AF-X7ZNG7-F1-model_v4 | Putative metallophosphoesterase | 0.9326 | 109 | 236 |
GO:0005737
GO:0016787 |
| AF-A0A2V8TLJ9-F1-model_v4 | Serine/threonine protein phosphatase | 0.9168 | 85 | 172 |
GO:0005737
|
| AF-H1S9Y9-F1-model_v4 | Ser/Thr protein phosphatase family protein | 0.9115 | 1 | 153 |
GO:0005737
GO:0016787 |
| AF-A0A4Q4WQ76-F1-model_v4 | Calcineurin-like phosphoesterase domain-containing protein | 0.8976 | 1 | 199 |
GO:0005737
GO:0016020 GO:0016787 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar