F443430

General Info

Members Datasets Scaffolds Average Seq Length
435 225 435 301

Family's Representative Sequence

Representative Sequence 3300053130|Ga0500642_0000776|Ga0500642_0000776_6052_7128
Length 358
Sequence LSPKGVSFALDGPQSRVPTRQYRRTAGFIPGKISYLRANKSGRPRVLARASSRTPREITMTLKIDRRDFARLAGLGGVAFASGLAGPHRFAQAKAATQDFFFLQLSDTHWGFSGPPNPDAANTLKKAVAAVNGLAQQPDFIVFTGDLTHTTDDAAERRKRMAEFRAIVAELKVKALRFMPGEHDAALDRGAAYQEFFGKTHYTFDHKGIHFIALDNVSDPAAAIGAEQLAWLKADLAQLDKETPIVVLAHRPLFDLYPQWDWATADGAAAVELLMPFEYVTVFYGHIHQEHHHMTGHIAHHAAMSLIFPQPAPGSQPKRTPPVAWDPAHPNKGLGWRRIGAKAGADELAVAETPLGPV

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
56 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
57 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
73 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
74 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
119 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
122 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
123 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
124 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
125 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
128 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
129 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
130 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
131 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
132 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
133 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
134 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
135 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
136 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
137 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
138 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
139 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
140 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
141 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
142 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
147 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
148 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
149 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
159 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
164 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
168 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
169 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
170 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
171 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
180 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
181 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
182 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
183 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
192 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
204 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
205 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
208 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
209 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
213 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
214 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
215 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
216 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
217 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
218 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
219 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
220 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
221 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
224 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
225 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.15
Nodule 0
Rhizoplane 0.92
Rhizosphere 97.7
Stem 0
Stem Tuber 0
Unclassified 0.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10077218 3300005290 Bacteria 3530
2 Ga0065712_10079505 3300005290 Bacteria 3209
3 Ga0065715_10119337 3300005293 Bacteria 2289
4 Ga0065715_10176094 3300005293 Bacteria 1502
5 Ga0065707_10031181 3300005295 Bacteria 1382
6 Ga0065707_10110766 3300005295 Bacteria 2417
7 Ga0065707_10200961 3300005295 Bacteria 1311
8 Ga0070658_10087665 3300005327 Bacteria 2562
9 Ga0070690_100136242 3300005330 Bacteria 1663
10 Ga0070670_100001864 3300005331 Bacteria 17178
11 Ga0070670_100035564 3300005331 Bacteria 4287
12 Ga0070670_100488293 3300005331 Bacteria 1094
13 Ga0070666_10002163 3300005335 Bacteria 11945
14 Ga0070666_10008426 3300005335 Bacteria 6402
15 Ga0070666_10268198 3300005335 Bacteria 1211
16 Ga0070680_100082465 3300005336 Bacteria 2654
17 Ga0070680_100339995 3300005336 Bacteria 1275
18 Ga0068868_100001645 3300005338 Bacteria 15247
19 Ga0070689_100001654 3300005340 Bacteria 14244
20 Ga0070687_100006977 3300005343 Bacteria 4673
21 Ga0070687_100025365 3300005343 Bacteria 2843
22 Ga0070669_100112678 3300005353 Bacteria 2066
23 Ga0070675_100095953 3300005354 Bacteria 2490
24 Ga0070671_100009401 3300005355 Bacteria 7850
25 Ga0070671_100029396 3300005355 Bacteria 4531
26 Ga0070673_100009909 3300005364 Bacteria 6420
27 Ga0070673_100149019 3300005364 Bacteria 1980
28 Ga0070688_100000911 3300005365 Bacteria 14778
29 Ga0070688_100104658 3300005365 Bacteria 1872
30 Ga0070667_100023481 3300005367 Bacteria 5116
31 Ga0070667_100591347 3300005367 Bacteria 1022
32 Ga0070714_100177049 3300005435 Bacteria 1939
33 Ga0070701_10007216 3300005438 Bacteria 4731
34 Ga0070701_10010220 3300005438 Bacteria 4142
35 Ga0070701_10047082 3300005438 Bacteria 2219
36 Ga0070711_100000025 3300005439 Bacteria 111524
37 Ga0070705_100053320 3300005440 Bacteria 2367
38 Ga0070694_100248942 3300005444 Bacteria 1343
39 Ga0070708_100003651 3300005445 Bacteria 12067
40 Ga0070708_100074952 3300005445 Bacteria 3053
41 Ga0070708_100184645 3300005445 Bacteria 1950
42 Ga0070708_100271711 3300005445 Bacteria 1594
43 Ga0068867_100390317 3300005459 Bacteria 1171
44 Ga0070685_10001011 3300005466 Bacteria 15117
45 Ga0070706_100011465 3300005467 Bacteria 8240
46 Ga0070706_100070108 3300005467 Bacteria 3242
47 Ga0070706_100083429 3300005467 Bacteria 2960
48 Ga0070706_100189705 3300005467 Bacteria 1921
49 Ga0070706_100374165 3300005467 Bacteria 1327
50 Ga0070707_100000509 3300005468 Bacteria 38647
51 Ga0070707_100017479 3300005468 Bacteria 6742
52 Ga0070707_100026541 3300005468 Bacteria 5500
53 Ga0070707_100137550 3300005468 Bacteria 2376
54 Ga0070698_100000808 3300005471 Bacteria 34171
55 Ga0070698_100005969 3300005471 Bacteria 13277
56 Ga0070699_100005358 3300005518 Bacteria 11246
57 Ga0070699_100121099 3300005518 Bacteria 2301
58 Ga0070699_100169139 3300005518 Bacteria 1936
59 Ga0070699_100248056 3300005518 Bacteria 1590
60 Ga0070684_100026564 3300005535 Bacteria 4880
61 Ga0070684_100175463 3300005535 Bacteria 1948
62 Ga0070697_100388443 3300005536 Bacteria 1210
63 Ga0070672_100004815 3300005543 Bacteria 8866
64 Ga0070672_100025583 3300005543 Bacteria 4381
65 Ga0070672_100168985 3300005543 Bacteria 1818
66 Ga0070686_100001290 3300005544 Bacteria 14163
67 Ga0070686_100012552 3300005544 Bacteria 4828
68 Ga0070686_100035869 3300005544 Bacteria 3065
69 Ga0070686_100059550 3300005544 Bacteria 2461
70 Ga0070695_100083325 3300005545 Bacteria 2119
71 Ga0070695_100150656 3300005545 Bacteria 1623
72 Ga0070696_100105175 3300005546 Bacteria 2027
73 Ga0070665_100052522 3300005548 Bacteria 4087
74 Ga0070704_100037317 3300005549 Plasmid 3319
75 Ga0068855_100007205 3300005563 Bacteria 13496
76 Ga0068855_100102251 3300005563 Bacteria 3298
77 Ga0070664_100003815 3300005564 Bacteria 12164
78 Ga0070664_100051336 3300005564 Bacteria 3492
79 Ga0068857_100215117 3300005577 Bacteria 1754
80 Ga0068857_100218864 3300005577 Unclassified 1739
81 Ga0068856_100087573 3300005614 Bacteria 3096
82 Ga0070702_100014986 3300005615 Bacteria 3946
83 Ga0068852_100052348 3300005616 Bacteria 3508
84 Ga0068859_100002534 3300005617 Bacteria 18545
85 Ga0068859_100037539 3300005617 Bacteria 4862
86 Ga0068859_100139699 3300005617 Bacteria 2496
87 Ga0068859_100216922 3300005617 Bacteria 2001
88 Ga0068864_100002406 3300005618 Bacteria 15455
89 Ga0068864_100003257 3300005618 Bacteria 13417
90 Ga0068864_100009061 3300005618 Bacteria 8203
91 Ga0068864_100113745 3300005618 Bacteria 2413
92 Ga0068864_100203739 3300005618 Unclassified 1819
93 Ga0068863_100001204 3300005841 Bacteria 25850
94 Ga0068863_100018719 3300005841 Bacteria 6626
95 Ga0068863_100024533 3300005841 Bacteria 5751
96 Ga0068863_100029751 3300005841 Bacteria 5215
97 Ga0068863_100132077 3300005841 Bacteria 2384
98 Ga0068863_100419236 3300005841 Unclassified 1311
99 Ga0068858_100007451 3300005842 Bacteria 10577
100 Ga0068858_100035505 3300005842 Bacteria 4624
101 Ga0068860_100073654 3300005843 Bacteria 3247
102 Ga0068860_100559279 3300005843 Bacteria 1147
103 Ga0068862_100082609 3300005844 Bacteria 2788
104 Ga0070716_100000009 3300006173 Bacteria 173295
105 Ga0097621_100003439 3300006237 Bacteria 10909
106 Ga0097621_100091397 3300006237 Bacteria 2548
107 Ga0075370_10092452 3300006353 Bacteria 1746
108 Ga0068871_100000765 3300006358 Bacteria 21675
109 Ga0068871_100026500 3300006358 Bacteria 4523
110 Ga0075428_100044154 3300006844 Unclassified 4899
111 Ga0075428_100057521 3300006844 Bacteria 4256
112 Ga0075428_100295629 3300006844 Bacteria 1742
113 Ga0075433_10070479 3300006852 Bacteria 3072
114 Ga0075433_10081930 3300006852 Bacteria 2845
115 Ga0075433_10166922 3300006852 Bacteria 1959
116 Ga0075433_10385065 3300006852 Bacteria 1238
117 Ga0075434_100002577 3300006871 Bacteria 16001
118 Ga0075434_100022397 3300006871 Bacteria 6153
119 Ga0075434_100103705 3300006871 Bacteria 2852
120 Ga0075434_100261198 3300006871 Bacteria 1750
121 Ga0075434_100627148 3300006871 Bacteria 1094
122 Ga0075429_100042380 3300006880 Bacteria 3962
123 Ga0075429_100077641 3300006880 Bacteria 2893
124 Ga0075429_100080790 3300006880 Bacteria 2835
125 Ga0075429_100279415 3300006880 Unclassified 1462
126 Ga0075436_100006704 3300006914 Bacteria 7884
127 Ga0075436_100053534 3300006914 Bacteria 2786
128 Ga0075436_100054694 3300006914 Bacteria 2756
129 Ga0075436_100128304 3300006914 Unclassified 1777
130 Ga0097620_100002534 3300006931 Bacteria 18545
131 Ga0097620_100037539 3300006931 Bacteria 4862
132 Ga0097620_100139702 3300006931 Bacteria 2496
133 Ga0097620_100216932 3300006931 Bacteria 2001
134 Ga0075435_100014447 3300007076 Bacteria 5901
135 Ga0075435_100076444 3300007076 Bacteria 2744
136 Ga0075435_100185597 3300007076 Bacteria 1758
137 Ga0075435_100192749 3300007076 Bacteria 1725
138 Ga0075435_100292145 3300007076 Bacteria 1393
139 Ga0099794_10050342 3300007265 Bacteria 2004
140 Ga0099794_10079429 3300007265 Bacteria 1616
141 Ga0111539_10030652 3300009094 Bacteria 6538
142 Ga0111539_10096390 3300009094 Bacteria 3474
143 Ga0111539_10247616 3300009094 Bacteria 2075
144 Ga0111539_10368759 3300009094 Bacteria 1671
145 Ga0105247_10147143 3300009101 Bacteria 1549
146 Ga0105247_10221070 3300009101 Unclassified 1282
147 Ga0114129_10004820 3300009147 Bacteria 19070
148 Ga0114129_10054685 3300009147 Bacteria 5596
149 Ga0114129_10106354 3300009147 Unclassified 3876
150 Ga0114129_10120749 3300009147 Bacteria 3608
151 Ga0114129_10521657 3300009147 Bacteria 1549
152 Ga0105242_10000432 3300009176 Bacteria 33401
153 Ga0105248_10001647 3300009177 Bacteria 24838
154 Ga0105248_10023528 3300009177 Bacteria 6843
155 Ga0105248_10034588 3300009177 Bacteria 5652
156 Ga0105248_10237868 3300009177 Unclassified 2050
157 Ga0105248_10238838 3300009177 Unclassified 2045
158 Ga0105249_10006827 3300009553 Bacteria 9952
159 Ga0105239_10124609 3300010375 Bacteria 2863
160 Ga0157374_10071015 3300013296 Bacteria 3282
161 Ga0157374_10071454 3300013296 Unclassified 3272
162 Ga0157374_10195394 3300013296 Bacteria 1980
163 Ga0157378_10110854 3300013297 Bacteria 2515
164 Ga0157378_10566296 3300013297 Bacteria 1143
165 Ga0163162_10006715 3300013306 Bacteria 11157
166 Ga0163162_10008369 3300013306 Bacteria 10084
167 Ga0163162_10035814 3300013306 Bacteria 4944
168 Ga0163162_10095639 3300013306 Bacteria 3058
169 Ga0163162_10223306 3300013306 Bacteria 2013
170 Ga0157375_10005048 3300013308 Bacteria 11456
171 Ga0157375_10182927 3300013308 Bacteria 2248
172 Ga0163163_10016629 3300014325 Bacteria 6839
173 Ga0163163_10029339 3300014325 Bacteria 5290
174 Ga0163163_10033802 3300014325 Bacteria 4949
175 Ga0163163_10034731 3300014325 Bacteria 4886
176 Ga0163163_10222188 3300014325 Unclassified 1938
177 Ga0157377_10005452 3300014745 Bacteria 5982
178 Ga0157377_10029432 3300014745 Bacteria 2965
179 Ga0157379_10001012 3300014968 Bacteria 22799
180 Ga0157379_10082588 3300014968 Bacteria 2879
181 Ga0157379_10094633 3300014968 Bacteria 2681
182 Ga0157379_10096982 3300014968 Bacteria 2646
183 Ga0157376_10041991 3300014969 Bacteria 3747
184 Ga0157376_10052105 3300014969 Bacteria 3401
185 Ga0157376_10089655 3300014969 Unclassified 2659
186 Ga0163161_10020757 3300017792 Bacteria 4611
187 Ga0209051_1032658 3300025303 Bacteria 1981
188 Ga0207647_10183959 3300025904 Bacteria 1212
189 Ga0207685_10000009 3300025905 Bacteria 242842
190 Ga0207685_10000032 3300025905 Bacteria 69450
191 Ga0207705_10306504 3300025909 Bacteria 1218
192 Ga0207684_10017357 3300025910 Bacteria 6174
193 Ga0207684_10058710 3300025910 Bacteria 3265
194 Ga0207684_10110993 3300025910 Bacteria 2347
195 Ga0207684_10237484 3300025910 Bacteria 1572
196 Ga0207695_10361697 3300025913 Bacteria 1338
197 Ga0207663_10000009 3300025916 Bacteria 196493
198 Ga0207660_10318387 3300025917 Bacteria 1242
199 Ga0207662_10005053 3300025918 Bacteria 6989
200 Ga0207662_10032708 3300025918 Bacteria 3029
201 Ga0207662_10038624 3300025918 Bacteria 2798
202 Ga0207662_10148800 3300025918 Bacteria 1488
203 Ga0207657_10261896 3300025919 Bacteria 1376
204 Ga0207646_10000723 3300025922 Bacteria 42789
205 Ga0207646_10002477 3300025922 Bacteria 21814
206 Ga0207646_10005041 3300025922 Bacteria 14052
207 Ga0207646_10034120 3300025922 Bacteria 4599
208 Ga0207646_10101431 3300025922 Bacteria 2580
209 Ga0207681_10085824 3300025923 Bacteria 2235
210 Ga0207694_10161172 3300025924 Bacteria 1812
211 Ga0207650_10005556 3300025925 Bacteria 8604
212 Ga0207659_10004012 3300025926 Bacteria 8880
213 Ga0207659_10042039 3300025926 Bacteria 3203
214 Ga0207659_10109223 3300025926 Bacteria 2099
215 Ga0207664_10203268 3300025929 Bacteria 1711
216 Ga0207644_10012091 3300025931 Bacteria 5726
217 Ga0207690_10192349 3300025932 Bacteria 1544
218 Ga0207670_10009251 3300025936 Bacteria 5611
219 Ga0207704_10135380 3300025938 Unclassified 1714
220 Ga0207665_10080168 3300025939 Bacteria 2245
221 Ga0207665_10331649 3300025939 Bacteria 1144
222 Ga0207691_10012855 3300025940 Bacteria 8014
223 Ga0207691_10032187 3300025940 Bacteria 4890
224 Ga0207691_10074297 3300025940 Unclassified 3066
225 Ga0207711_10004123 3300025941 Bacteria 12454
226 Ga0207711_10025749 3300025941 Bacteria 4933
227 Ga0207711_10101091 3300025941 Bacteria 2551
228 Ga0207679_10048402 3300025945 Bacteria 3095
229 Ga0207679_10088263 3300025945 Bacteria 2390
230 Ga0207667_10181630 3300025949 Bacteria 2160
231 Ga0207651_10004213 3300025960 Bacteria 7207
232 Ga0207651_10034139 3300025960 Bacteria 3291
233 Ga0207651_10200764 3300025960 Bacteria 1598
234 Ga0207712_10005313 3300025961 Bacteria 8136
235 Ga0207658_10005331 3300025986 Bacteria 8840
236 Ga0207658_10016732 3300025986 Bacteria 5047
237 Ga0207658_10043938 3300025986 Bacteria 3251
238 Ga0207658_10380604 3300025986 Bacteria 1236
239 Ga0207658_10502259 3300025986 Bacteria 1080
240 Ga0207677_10010764 3300026023 Bacteria 5186
241 Ga0207703_10066169 3300026035 Bacteria 2972
242 Ga0207703_10080614 3300026035 Bacteria 2711
243 Ga0207678_10129481 3300026067 Unclassified 2152
244 Ga0207678_10261242 3300026067 Bacteria 1484
245 Ga0207708_10244039 3300026075 Bacteria 1445
246 Ga0207702_10064577 3300026078 Bacteria 3133
247 Ga0207702_10190307 3300026078 Bacteria 1895
248 Ga0207641_10000983 3300026088 Bacteria 29120
249 Ga0207641_10016230 3300026088 Bacteria 6099
250 Ga0207641_10082003 3300026088 Bacteria 2801
251 Ga0207641_10393463 3300026088 Bacteria 1329
252 Ga0207648_10450917 3300026089 Bacteria 1171
253 Ga0207676_10006159 3300026095 Bacteria 8471
254 Ga0207676_10063678 3300026095 Bacteria 2929
255 Ga0207676_10065088 3300026095 Unclassified 2902
256 Ga0207676_10104881 3300026095 Bacteria 2352
257 Ga0207676_10232812 3300026095 Unclassified 1648
258 Ga0207676_10374773 3300026095 Bacteria 1323
259 Ga0207674_10109933 3300026116 Bacteria 2732
260 Ga0207683_10260786 3300026121 Bacteria 1582
261 Ga0207698_10035919 3300026142 Bacteria 3631
262 Ga0209588_1011247 3300027671 Bacteria 2702
263 Ga0207428_10016392 3300027907 Bacteria 6375
264 Ga0207428_10215556 3300027907 Bacteria 1441
265 Ga0268265_10036399 3300028380 Unclassified 3605
266 Ga0268264_10002973 3300028381 Bacteria 14727
267 Ga0268264_10013075 3300028381 Bacteria 6824
268 Ga0265323_10010559 3300028653 Bacteria 3741
269 Ga0265322_10011433 3300028654 Bacteria 2574
270 Ga0265338_10028952 3300028800 Bacteria 5508
271 Ga0265338_10080535 3300028800 Unclassified 2735
272 Ga0265324_10000100 3300029957 Bacteria 67937
273 Ga0265330_10010115 3300031235 Bacteria 4457
274 Ga0265332_10034507 3300031238 Bacteria 2198
275 Ga0265328_10002029 3300031239 Bacteria 9156
276 Ga0265329_10005075 3300031242 Bacteria 5373
277 Ga0265340_10000155 3300031247 Bacteria 34825
278 Ga0265339_10000018 3300031249 Bacteria 181364
279 Ga0265331_10018648 3300031250 Bacteria 3593
280 Ga0265316_10129827 3300031344 Bacteria 1899
281 Ga0265313_10132983 3300031595 Bacteria 1076
282 Ga0265314_10000465 3300031711 Bacteria 53953
283 Ga0265314_10154688 3300031711 Bacteria 1402
284 Ga0265342_10009431 3300031712 Bacteria 6882
285 Ga0265342_10011424 3300031712 Bacteria 6081
286 Ga0373950_0006442 3300034818 Bacteria 1791
287 Ga0373958_0003642 3300034819 Bacteria 2236
288 Ga0373926_0002881 3300035083 Bacteria 5511
289 Ga0373929_0002363 3300035085 Bacteria 3469
290 Ga0373944_0007477 3300035089 Bacteria 2931
291 Ga0373949_0002837 3300035090 Bacteria 4301
292 Ga0373952_0002312 3300035092 Bacteria 3434
293 Ga0373939_0002680 3300035114 Bacteria 4173
294 Ga0373953_0031094 3300035117 Bacteria 2075
295 Ga0373956_0071219 3300035119 Bacteria 1586
296 Ga0373957_0034194 3300035120 Bacteria 1881
297 Ga0373960_0042395 3300035121 Bacteria 1321
298 Ga0373943_0022342 3300035170 Bacteria 2930
299 Ga0373946_0002712 3300035171 Bacteria 6260
300 Ga0373946_0131560 3300035171 Bacteria 1151
301 Ga0373955_0009086 3300035172 Bacteria 4641
302 Ga0373955_0037591 3300035172 Bacteria 2575
303 Ga0373955_0163078 3300035172 Bacteria 1317
304 Ga0373955_0200892 3300035172 Bacteria 1187
305 Ga0373942_0022308 3300035207 Bacteria 1605
306 Ga0373942_0057827 3300035207 Bacteria 1104
307 Ga0373961_0005625 3300035241 Bacteria 3009
308 Ga0373961_0022530 3300035241 Bacteria 1686
309 Ga0373924_0015973 3300035410 Bacteria 2861
310 Ga0373924_0019338 3300035410 Bacteria 2638
311 Ga0373924_0020754 3300035410 Bacteria 2557
312 Ga0373931_0000137 3300035691 Bacteria 33227
313 Ga0373931_0042210 3300035691 Bacteria 2398
314 Ga0373931_0163207 3300035691 Bacteria 1308
315 Ga0373931_0270925 3300035691 Bacteria 1039
316 Ga0373935_0003641 3300035692 Bacteria 8983
317 Ga0373935_0029080 3300035692 Bacteria 3419
318 Ga0373927_0047346 3300035695 Bacteria 2781
319 Ga0373927_0192416 3300035695 Bacteria 1338
320 Ga0373933_0004100 3300035724 Bacteria 8028
321 Ga0373947_0007062 3300035725 Bacteria 6508
322 Ga0373947_0111288 3300035725 Bacteria 1730
323 Ga0373947_0142009 3300035725 Bacteria 1540
324 Ga0373937_0030198 3300036401 Bacteria 4909
325 Ga0373937_0036952 3300036401 Bacteria 4451
326 Ga0373937_0062544 3300036401 Bacteria 3422
327 Ga0373937_0129964 3300036401 Unclassified 2352
328 Ga0373925_0024685 3300037068 Bacteria 4389
329 Ga0373925_0032539 3300037068 Bacteria 3839
330 Ga0373925_0071641 3300037068 Bacteria 2621
331 Ga0395899_0010650 3300037312 Bacteria 7045
332 Ga0395899_0140309 3300037312 Bacteria 1720
333 Ga0395900_0026774 3300037418 Bacteria 5901
334 Ga0395900_0033906 3300037418 Bacteria 5254
335 Ga0395898_0033322 3300037466 Bacteria 5142
336 Ga0395905_0000210 3300037471 Bacteria 90096
337 Ga0395905_0009330 3300037471 Bacteria 9597
338 Ga0395901_0019693 3300038443 Bacteria 6898
339 Ga0395901_0064696 3300038443 Bacteria 3806
340 Ga0436365_1502423 3300039437 Bacteria 2811
341 Ga0436360_0420685 3300039438 Bacteria 6448
342 Ga0436360_0881504 3300039438 Bacteria 2920
343 Ga0436360_1367677 3300039438 Bacteria 1027
344 Ga0436361_0351372 3300039447 Bacteria 183069
345 Ga0466969_0006591 3300044656 Bacteria 6174
346 Ga0466961_0025773 3300044693 Bacteria 3779
347 Ga0466964_0016894 3300044706 Bacteria 2790
348 Ga0453684_0152160 3300044712 Bacteria 2748
349 Ga0466971_0007588 3300044719 Bacteria 4731
350 Ga0466957_0081598 3300044842 Bacteria 2014
351 Ga0466959_0060352 3300045049 Bacteria 2759
352 Ga0451576_0001414 3300045051 Bacteria 41151
353 Ga0495592_0025656 3300046454 Bacteria 4473
354 Ga0495592_0037253 3300046454 Bacteria 3662
355 Ga0495592_0060551 3300046454 Bacteria 2784
356 Ga0495603_0150835 3300046455 Bacteria 1350
357 Ga0495629_0029309 3300046459 Bacteria 3904
358 Ga0495580_0015325 3300046472 Bacteria 5785
359 Ga0495580_0105575 3300046472 Bacteria 1957
360 Ga0495582_0091012 3300046473 Bacteria 1701
361 Ga0495639_0010389 3300046475 Bacteria 4010
362 Ga0495594_0179891 3300046499 Bacteria 1204
363 Ga0495608_0036439 3300046511 Bacteria 3312
364 Ga0495618_0007202 3300046514 Bacteria 6736
365 Ga0495618_0036316 3300046514 Bacteria 3092
366 Ga0495628_0125544 3300046516 Bacteria 1967
367 Ga0495630_0021058 3300046517 Bacteria 4814
368 Ga0495630_0157641 3300046517 Bacteria 1728
369 Ga0495630_0353880 3300046517 Bacteria 1124
370 Ga0495652_0160840 3300046529 Bacteria 1744
371 Ga0495652_0204109 3300046529 Bacteria 1498
372 Ga0495640_0008068 3300046533 Bacteria 8270
373 Ga0495640_0151619 3300046533 Bacteria 1489
374 Ga0495586_0010401 3300046535 Bacteria 4946
375 Ga0495586_0054736 3300046535 Bacteria 2163
376 Ga0495586_0160931 3300046535 Bacteria 1266
377 Ga0495621_0040079 3300046539 Bacteria 1640
378 Ga0495667_0033645 3300046559 Bacteria 3430
379 Ga0495667_0036824 3300046559 Bacteria 3262
380 Ga0495634_0025086 3300046642 Bacteria 4178
381 Ga0495634_0188354 3300046642 Bacteria 1288
382 Ga0495588_0009567 3300046674 Bacteria 4485
383 Ga0495657_0046643 3300046675 Bacteria 2932
384 Ga0495647_0003005 3300046681 Bacteria 5367
385 Ga0495647_0138710 3300046681 Unclassified 1036
386 Ga0495658_0004008 3300046683 Bacteria 7260
387 Ga0495658_0006442 3300046683 Bacteria 5767
388 Ga0495669_0018584 3300046684 Bacteria 2990
389 Ga0495613_0009281 3300046689 Bacteria 7298
390 Ga0495613_0010422 3300046689 Bacteria 6903
391 Ga0495613_0029861 3300046689 Bacteria 4051
392 Ga0495600_0049281 3300046809 Bacteria 2748
393 Ga0495600_0174286 3300046809 Unclassified 1387
394 Ga0495581_0072139 3300047315 Bacteria 1998
395 Ga0495674_0084806 3300047319 Bacteria 2714
396 Ga0495672_0200587 3300047320 Bacteria 998
397 Ga0495676_0072455 3300047321 Bacteria 2645
398 Ga0495680_0010940 3300047322 Bacteria 8063
399 Ga0495680_0104991 3300047322 Bacteria 2101
400 Ga0495675_0100141 3300047444 Unclassified 1814
401 Ga0495684_0115975 3300047471 Bacteria 2019
402 Ga0496102_0000215 3300048905 Bacteria 76113
403 Ga0496103_0036429 3300048906 Bacteria 3013
404 Ga0496104_0428781 3300048907 Bacteria 1234
405 Ga0496112_0075319 3300048915 Bacteria 3338
406 nmdc:mga07m45_172601_c1 3300050496 Bacteria 1257
407 nmdc:mga05p37_10705_c1 3300050507 Bacteria 10887
408 nmdc:mga05p37_154167_c1 3300050507 Unclassified 2808
409 nmdc:mga05p37_219007_c1 3300050507 Bacteria 2298
410 nmdc:mga05p37_271605_c1 3300050507 Bacteria 2025
411 nmdc:mga09592_259807_c1 3300050508 Bacteria 1506
412 nmdc:mga06r32_271909_c1 3300050510 Bacteria 1682
413 nmdc:mga08y16_127420_c1 3300050511 Bacteria 2648
414 nmdc:mga08y16_186045_c1 3300050511 Bacteria 2155
415 nmdc:mga0n895_112305_c1 3300050512 Bacteria 2742
416 nmdc:mga0n895_115979_c1 3300050512 Bacteria 2697
417 nmdc:mga0n895_46128_c1 3300050512 Unclassified 4256
418 nmdc:mga0n895_584598_c1 3300050512 Unclassified 1120
419 nmdc:mga0rr50_23721_c1 3300050513 Unclassified 4237
420 nmdc:mga0rr50_267159_c1 3300050513 Bacteria 1425
421 nmdc:mga0rr50_406647_c1 3300050513 Bacteria 1150
422 nmdc:mga08x19_15_c1 3300050514 Bacteria 354290
423 nmdc:mga08x19_16_c1 3300050514 Bacteria 348119
424 nmdc:mga08x19_2531_c1 3300050514 Bacteria 11107
425 nmdc:mga0a205_112681_c1 3300050515 Bacteria 2619
426 nmdc:mga0a205_132150_c1 3300050515 Bacteria 2397
427 nmdc:mga0a205_310908_c1 3300050515 Bacteria 1448
428 nmdc:mga0a205_322739_c1 3300050515 Bacteria 1415
429 nmdc:mga0a205_382270_c1 3300050515 Bacteria 1273
430 nmdc:mga0a205_67360_c1 3300050515 Bacteria 3458
431 Ga0495601_0008949 3300053077 Bacteria 5909
432 Ga0495595_0043993 3300053084 Bacteria 2050
433 Ga0500642_0000776 3300053130 Bacteria 9346
434 Ga0500616_0006139 3300053153 Bacteria 7947
435 Ga0466962_0005055 3300061719 Bacteria 6345

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009177 Ga0105248_10238838 Ga0105248_102388384 250
2 3300039437 Ga0436365_1502423 Ga0436365_1502423_1310_2191 250
3 3300046499 Ga0495594_0179891 Ga0495594_0179891_368_1141 251
4 3300050512 nmdc:mga0n895_584598_c1 nmdc:mga0n895_584598_c1_257_1057 258
5 3300005518 Ga0070699_100169139 Ga0070699_1001691392 268
6 3300035120 Ga0373957_0034194 Ga0373957_0034194_53_892 273
7 3300046681 Ga0495647_0138710 Ga0495647_0138710_32_913 277
8 3300050515 nmdc:mga0a205_310908_c1 nmdc:mga0a205_310908_c1_345_1196 277
9 3300039438 Ga0436360_0881504 Ga0436360_0881504_763_1662 279
10 3300039438 Ga0436360_1367677 Ga0436360_1367677_54_920 279
11 3300005535 Ga0070684_100175463 Ga0070684_1001754632 280
12 3300005563 Ga0068855_100102251 Ga0068855_1001022513 280
13 3300005616 Ga0068852_100052348 Ga0068852_1000523483 280
14 3300010375 Ga0105239_10124609 Ga0105239_101246093 280
15 3300025904 Ga0207647_10183959 Ga0207647_101839592 280
16 3300025919 Ga0207657_10261896 Ga0207657_102618962 280
17 3300025932 Ga0207690_10192349 Ga0207690_101923493 280
18 3300025945 Ga0207679_10088263 Ga0207679_100882633 280
19 3300026067 Ga0207678_10261242 Ga0207678_102612422 280
20 3300026078 Ga0207702_10190307 Ga0207702_101903073 280
21 3300026142 Ga0207698_10035919 Ga0207698_100359192 280
22 3300037418 Ga0395900_0033906 Ga0395900_0033906_3062_3934 280
23 3300038443 Ga0395901_0019693 Ga0395901_0019693_4580_5452 280
24 3300053153 Ga0500616_0006139 Ga0500616_0006139_3260_4132 281
25 3300026075 Ga0207708_10244039 Ga0207708_102440392 282
26 3300031239 Ga0265328_10002029 Ga0265328_100020298 282
27 3300006237 Ga0097621_100091397 Ga0097621_1000913975 283
28 3300014969 Ga0157376_10041991 Ga0157376_100419914 283
29 3300039447 Ga0436361_0351372 Ga0436361_0351372_123990_124880 283
30 3300046517 Ga0495630_0353880 Ga0495630_0353880_18_869 283
31 3300048905 Ga0496102_0000215 Ga0496102_0000215_22540_23418 283
32 3300048906 Ga0496103_0036429 Ga0496103_0036429_947_1825 283
33 3300009176 Ga0105242_10000432 Ga0105242_1000043236 285
34 3300037312 Ga0395899_0010650 Ga0395899_0010650_2066_2947 285
35 3300037418 Ga0395900_0026774 Ga0395900_0026774_3800_4681 285
36 3300037466 Ga0395898_0033322 Ga0395898_0033322_412_1293 285
37 3300037471 Ga0395905_0009330 Ga0395905_0009330_4886_5767 285
38 3300038443 Ga0395901_0064696 Ga0395901_0064696_2272_3153 285
39 3300046539 Ga0495621_0040079 Ga0495621_0040079_369_1256 285
40 3300046684 Ga0495669_0018584 Ga0495669_0018584_1467_2354 285
41 3300005295 Ga0065707_10200961 Ga0065707_102009611 286
42 3300005327 Ga0070658_10087665 Ga0070658_100876653 286
43 3300005331 Ga0070670_100001864 Ga0070670_1000018643 286
44 3300005343 Ga0070687_100025365 Ga0070687_1000253653 286
45 3300005365 Ga0070688_100104658 Ga0070688_1001046582 286
46 3300005438 Ga0070701_10047082 Ga0070701_100470822 286
47 3300005444 Ga0070694_100248942 Ga0070694_1002489421 286
48 3300005535 Ga0070684_100026564 Ga0070684_1000265646 286
49 3300005544 Ga0070686_100012552 Ga0070686_1000125526 286
50 3300005544 Ga0070686_100035869 Ga0070686_1000358692 286
51 3300005545 Ga0070695_100083325 Ga0070695_1000833252 286
52 3300005546 Ga0070696_100105175 Ga0070696_1001051753 286
53 3300005615 Ga0070702_100014986 Ga0070702_1000149864 286
54 3300005618 Ga0068864_100002406 Ga0068864_1000024069 286
55 3300005841 Ga0068863_100029751 Ga0068863_1000297512 286
56 3300005843 Ga0068860_100559279 Ga0068860_1005592792 286
57 3300006237 Ga0097621_100003439 Ga0097621_1000034393 286
58 3300006358 Ga0068871_100000765 Ga0068871_10000076520 286
59 3300006852 Ga0075433_10385065 Ga0075433_103850652 286
60 3300006871 Ga0075434_100002577 Ga0075434_1000025778 286
61 3300006880 Ga0075429_100080790 Ga0075429_1000807901 286
62 3300009147 Ga0114129_10521657 Ga0114129_105216573 286
63 3300025909 Ga0207705_10306504 Ga0207705_103065042 286
64 3300025918 Ga0207662_10032708 Ga0207662_100327083 286
65 3300025918 Ga0207662_10038624 Ga0207662_100386243 286
66 3300026095 Ga0207676_10063678 Ga0207676_100636784 286
67 3300026095 Ga0207676_10374773 Ga0207676_103747732 286
68 3300034818 Ga0373950_0006442 Ga0373950_0006442_404_1294 286
69 3300034819 Ga0373958_0003642 Ga0373958_0003642_1022_1912 286
70 3300035083 Ga0373926_0002881 Ga0373926_0002881_3310_4233 286
71 3300035085 Ga0373929_0002363 Ga0373929_0002363_1767_2783 286
72 3300035089 Ga0373944_0007477 Ga0373944_0007477_1627_2550 286
73 3300035090 Ga0373949_0002837 Ga0373949_0002837_2347_3363 286
74 3300035092 Ga0373952_0002312 Ga0373952_0002312_1059_2075 286
75 3300035114 Ga0373939_0002680 Ga0373939_0002680_81_971 286
76 3300035117 Ga0373953_0031094 Ga0373953_0031094_309_1199 286
77 3300035119 Ga0373956_0071219 Ga0373956_0071219_597_1487 286
78 3300035121 Ga0373960_0042395 Ga0373960_0042395_115_1005 286
79 3300035170 Ga0373943_0022342 Ga0373943_0022342_422_1345 286
80 3300035171 Ga0373946_0002712 Ga0373946_0002712_5120_6043 286
81 3300035171 Ga0373946_0131560 Ga0373946_0131560_27_950 286
82 3300035172 Ga0373955_0009086 Ga0373955_0009086_2868_3758 286
83 3300035172 Ga0373955_0200892 Ga0373955_0200892_40_927 286
84 3300035207 Ga0373942_0022308 Ga0373942_0022308_104_994 286
85 3300035207 Ga0373942_0057827 Ga0373942_0057827_112_1002 286
86 3300035241 Ga0373961_0005625 Ga0373961_0005625_280_1296 286
87 3300035241 Ga0373961_0022530 Ga0373961_0022530_609_1499 286
88 3300035410 Ga0373924_0019338 Ga0373924_0019338_1368_2258 286
89 3300035410 Ga0373924_0020754 Ga0373924_0020754_543_1466 286
90 3300035691 Ga0373931_0000137 Ga0373931_0000137_12466_13482 286
91 3300035691 Ga0373931_0042210 Ga0373931_0042210_1462_2352 286
92 3300035691 Ga0373931_0270925 Ga0373931_0270925_83_973 286
93 3300035692 Ga0373935_0003641 Ga0373935_0003641_4093_5016 286
94 3300035695 Ga0373927_0047346 Ga0373927_0047346_1053_1976 286
95 3300035695 Ga0373927_0192416 Ga0373927_0192416_256_1179 286
96 3300035724 Ga0373933_0004100 Ga0373933_0004100_397_1287 286
97 3300035725 Ga0373947_0111288 Ga0373947_0111288_361_1284 286
98 3300035725 Ga0373947_0142009 Ga0373947_0142009_447_1370 286
99 3300036401 Ga0373937_0030198 Ga0373937_0030198_2621_3511 286
100 3300037068 Ga0373925_0024685 Ga0373925_0024685_50_973 286
101 3300037068 Ga0373925_0071641 Ga0373925_0071641_893_1816 286
102 3300037312 Ga0395899_0140309 Ga0395899_0140309_390_1280 286
103 3300039438 Ga0436360_0420685 Ga0436360_0420685_5260_6150 286
104 3300044712 Ga0453684_0152160 Ga0453684_0152160_847_1737 286
105 3300045051 Ga0451576_0001414 Ga0451576_0001414_6399_7289 286
106 3300046455 Ga0495603_0150835 Ga0495603_0150835_168_1091 286
107 3300046472 Ga0495580_0015325 Ga0495580_0015325_992_1915 286
108 3300046473 Ga0495582_0091012 Ga0495582_0091012_488_1411 286
109 3300046475 Ga0495639_0010389 Ga0495639_0010389_2693_3616 286
110 3300046529 Ga0495652_0204109 Ga0495652_0204109_378_1265 286
111 3300046535 Ga0495586_0010401 Ga0495586_0010401_2842_3765 286
112 3300046559 Ga0495667_0033645 Ga0495667_0033645_2513_3403 286
113 3300046674 Ga0495588_0009567 Ga0495588_0009567_813_1736 286
114 3300046681 Ga0495647_0003005 Ga0495647_0003005_1496_2419 286
115 3300046683 Ga0495658_0004008 Ga0495658_0004008_3386_4309 286
116 3300047315 Ga0495581_0072139 Ga0495581_0072139_205_1128 286
117 3300047321 Ga0495676_0072455 Ga0495676_0072455_1075_1998 286
118 3300047322 Ga0495680_0104991 Ga0495680_0104991_269_1159 286
119 3300048915 Ga0496112_0075319 Ga0496112_0075319_625_1509 286
120 3300050513 nmdc:mga0rr50_406647_c1 nmdc:mga0rr50_406647_c1_159_1049 286
121 3300050515 nmdc:mga0a205_382270_c1 nmdc:mga0a205_382270_c1_167_1057 286
122 3300005367 Ga0070667_100591347 Ga0070667_1005913471 287
123 3300005617 Ga0068859_100216922 Ga0068859_1002169222 287
124 3300006931 Ga0097620_100216932 Ga0097620_1002169322 287
125 3300009094 Ga0111539_10368759 Ga0111539_103687592 287
126 3300025986 Ga0207658_10502259 Ga0207658_105022592 287
127 3300035691 Ga0373931_0163207 Ga0373931_0163207_378_1268 287
128 3300005439 Ga0070711_100000025 Ga0070711_10000002570 288
129 3300005543 Ga0070672_100168985 Ga0070672_1001689853 288
130 3300006914 Ga0075436_100128304 Ga0075436_1001283042 288
131 3300009094 Ga0111539_10247616 Ga0111539_102476162 288
132 3300025303 Ga0209051_1032658 Ga0209051_10326582 288
133 3300025916 Ga0207663_10000009 Ga0207663_1000000930 288
134 3300025940 Ga0207691_10074297 Ga0207691_100742974 288
135 3300046472 Ga0495580_0105575 Ga0495580_0105575_419_1306 288
136 3300048907 Ga0496104_0428781 Ga0496104_0428781_42_944 288
137 3300050511 nmdc:mga08y16_186045_c1 nmdc:mga08y16_186045_c1_898_1782 288
138 3300050514 nmdc:mga08x19_15_c1 nmdc:mga08x19_15_c1_251271_252170 288
139 3300005336 Ga0070680_100082465 Ga0070680_1000824654 289
140 3300005435 Ga0070714_100177049 Ga0070714_1001770492 289
141 3300005438 Ga0070701_10010220 Ga0070701_100102204 289
142 3300005563 Ga0068855_100007205 Ga0068855_1000072054 289
143 3300005617 Ga0068859_100037539 Ga0068859_1000375391 289
144 3300006931 Ga0097620_100037539 Ga0097620_1000375391 289
145 3300009147 Ga0114129_10054685 Ga0114129_100546855 289
146 3300013306 Ga0163162_10223306 Ga0163162_102233063 289
147 3300025913 Ga0207695_10361697 Ga0207695_103616972 289
148 3300025924 Ga0207694_10161172 Ga0207694_101611723 289
149 3300025929 Ga0207664_10203268 Ga0207664_102032683 289
150 3300028653 Ga0265323_10010559 Ga0265323_100105595 289
151 3300028654 Ga0265322_10011433 Ga0265322_100114332 289
152 3300028800 Ga0265338_10028952 Ga0265338_100289523 289
153 3300028800 Ga0265338_10080535 Ga0265338_100805351 289
154 3300029957 Ga0265324_10000100 Ga0265324_100001003 289
155 3300031235 Ga0265330_10010115 Ga0265330_100101155 289
156 3300031238 Ga0265332_10034507 Ga0265332_100345072 289
157 3300031247 Ga0265340_10000155 Ga0265340_1000015534 289
158 3300031249 Ga0265339_10000018 Ga0265339_1000001836 289
159 3300031250 Ga0265331_10018648 Ga0265331_100186483 289
160 3300031711 Ga0265314_10000465 Ga0265314_1000046552 289
161 3300031711 Ga0265314_10154688 Ga0265314_101546882 289
162 3300031712 Ga0265342_10009431 Ga0265342_100094315 289
163 3300031712 Ga0265342_10011424 Ga0265342_100114246 289
164 3300050507 nmdc:mga05p37_154167_c1 nmdc:mga05p37_154167_c1_239_1126 289
165 3300050512 nmdc:mga0n895_46128_c1 nmdc:mga0n895_46128_c1_3335_4222 289
166 3300050513 nmdc:mga0rr50_23721_c1 nmdc:mga0rr50_23721_c1_1504_2391 289
167 3300050515 nmdc:mga0a205_112681_c1 nmdc:mga0a205_112681_c1_1666_2553 289
168 3300005614 Ga0068856_100087573 Ga0068856_1000875733 290
169 3300007076 Ga0075435_100292145 Ga0075435_1002921451 290
170 3300009101 Ga0105247_10221070 Ga0105247_102210701 290
171 3300014325 Ga0163163_10222188 Ga0163163_102221882 290
172 3300025949 Ga0207667_10181630 Ga0207667_101816303 290
173 3300026078 Ga0207702_10064577 Ga0207702_100645773 290
174 3300031595 Ga0265313_10132983 Ga0265313_101329831 290
175 3300044656 Ga0466969_0006591 Ga0466969_0006591_4303_5205 290
176 3300044693 Ga0466961_0025773 Ga0466961_0025773_942_1844 290
177 3300044706 Ga0466964_0016894 Ga0466964_0016894_1735_2637 290
178 3300044719 Ga0466971_0007588 Ga0466971_0007588_1551_2453 290
179 3300044842 Ga0466957_0081598 Ga0466957_0081598_194_1096 290
180 3300045049 Ga0466959_0060352 Ga0466959_0060352_1654_2556 290
181 3300046454 Ga0495592_0025656 Ga0495592_0025656_144_1079 290
182 3300046514 Ga0495618_0036316 Ga0495618_0036316_1977_2876 290
183 3300046517 Ga0495630_0021058 Ga0495630_0021058_3666_4565 290
184 3300046529 Ga0495652_0160840 Ga0495652_0160840_779_1678 290
185 3300046533 Ga0495640_0008068 Ga0495640_0008068_3564_4463 290
186 3300046535 Ga0495586_0160931 Ga0495586_0160931_125_1060 290
187 3300046642 Ga0495634_0188354 Ga0495634_0188354_148_1047 290
188 3300046683 Ga0495658_0006442 Ga0495658_0006442_1905_2804 290
189 3300046689 Ga0495613_0029861 Ga0495613_0029861_3000_3899 290
190 3300050507 nmdc:mga05p37_271605_c1 nmdc:mga05p37_271605_c1_1088_1981 290
191 3300061719 Ga0466962_0005055 Ga0466962_0005055_678_1580 290
192 3300005293 Ga0065715_10119337 Ga0065715_101193372 291
193 3300005295 Ga0065707_10031181 Ga0065707_100311811 291
194 3300005295 Ga0065707_10110766 Ga0065707_101107662 291
195 3300005336 Ga0070680_100339995 Ga0070680_1003399952 291
196 3300005445 Ga0070708_100003651 Ga0070708_10000365111 291
197 3300005445 Ga0070708_100074952 Ga0070708_1000749523 291
198 3300005445 Ga0070708_100271711 Ga0070708_1002717112 291
199 3300005467 Ga0070706_100011465 Ga0070706_1000114654 291
200 3300005467 Ga0070706_100070108 Ga0070706_1000701081 291
201 3300005467 Ga0070706_100083429 Ga0070706_1000834292 291
202 3300005468 Ga0070707_100000509 Ga0070707_10000050921 291
203 3300005468 Ga0070707_100137550 Ga0070707_1001375503 291
204 3300005471 Ga0070698_100000808 Ga0070698_10000080825 291
205 3300005471 Ga0070698_100005969 Ga0070698_1000059694 291
206 3300005518 Ga0070699_100005358 Ga0070699_1000053589 291
207 3300005518 Ga0070699_100248056 Ga0070699_1002480562 291
208 3300005536 Ga0070697_100388443 Ga0070697_1003884432 291
209 3300005545 Ga0070695_100150656 Ga0070695_1001506562 291
210 3300005549 Ga0070704_100037317 Ga0070704_1000373174 291
211 3300005841 Ga0068863_100132077 Ga0068863_1001320774 291
212 3300005844 Ga0068862_100082609 Ga0068862_1000826092 291
213 3300006173 Ga0070716_100000009 Ga0070716_100000009140 291
214 3300006353 Ga0075370_10092452 Ga0075370_100924522 291
215 3300006844 Ga0075428_100044154 Ga0075428_1000441543 291
216 3300006844 Ga0075428_100295629 Ga0075428_1002956292 291
217 3300006852 Ga0075433_10081930 Ga0075433_100819301 291
218 3300006871 Ga0075434_100261198 Ga0075434_1002611982 291
219 3300006871 Ga0075434_100627148 Ga0075434_1006271482 291
220 3300006880 Ga0075429_100042380 Ga0075429_1000423805 291
221 3300006880 Ga0075429_100279415 Ga0075429_1002794151 291
222 3300006914 Ga0075436_100006704 Ga0075436_1000067047 291
223 3300006914 Ga0075436_100053534 Ga0075436_1000535343 291
224 3300007076 Ga0075435_100076444 Ga0075435_1000764444 291
225 3300007076 Ga0075435_100192749 Ga0075435_1001927493 291
226 3300007265 Ga0099794_10079429 Ga0099794_100794292 291
227 3300009094 Ga0111539_10030652 Ga0111539_100306526 291
228 3300009147 Ga0114129_10004820 Ga0114129_100048205 291
229 3300009147 Ga0114129_10120749 Ga0114129_101207494 291
230 3300013296 Ga0157374_10071454 Ga0157374_100714541 291
231 3300013297 Ga0157378_10110854 Ga0157378_101108543 291
232 3300013297 Ga0157378_10566296 Ga0157378_105662961 291
233 3300013306 Ga0163162_10035814 Ga0163162_100358145 291
234 3300014325 Ga0163163_10016629 Ga0163163_100166293 291
235 3300014325 Ga0163163_10034731 Ga0163163_100347316 291
236 3300014968 Ga0157379_10082588 Ga0157379_100825884 291
237 3300025905 Ga0207685_10000009 Ga0207685_10000009119 291
238 3300025905 Ga0207685_10000032 Ga0207685_1000003245 291
239 3300025910 Ga0207684_10017357 Ga0207684_100173577 291
240 3300025910 Ga0207684_10058710 Ga0207684_100587101 291
241 3300025910 Ga0207684_10110993 Ga0207684_101109933 291
242 3300025910 Ga0207684_10237484 Ga0207684_102374842 291
243 3300025917 Ga0207660_10318387 Ga0207660_103183871 291
244 3300025922 Ga0207646_10000723 Ga0207646_1000072322 291
245 3300025922 Ga0207646_10034120 Ga0207646_100341203 291
246 3300025922 Ga0207646_10101431 Ga0207646_101014313 291
247 3300025939 Ga0207665_10080168 Ga0207665_100801682 291
248 3300025939 Ga0207665_10331649 Ga0207665_103316491 291
249 3300026095 Ga0207676_10065088 Ga0207676_100650883 291
250 3300027671 Ga0209588_1011247 Ga0209588_10112474 291
251 3300027907 Ga0207428_10016392 Ga0207428_100163923 291
252 3300028380 Ga0268265_10036399 Ga0268265_100363993 291
253 3300036401 Ga0373937_0129964 Ga0373937_0129964_347_1270 291
254 3300037471 Ga0395905_0000210 Ga0395905_0000210_15371_16345 291
255 3300046454 Ga0495592_0037253 Ga0495592_0037253_2617_3513 291
256 3300046516 Ga0495628_0125544 Ga0495628_0125544_798_1694 291
257 3300046533 Ga0495640_0151619 Ga0495640_0151619_143_1039 291
258 3300046535 Ga0495586_0054736 Ga0495586_0054736_439_1416 291
259 3300046809 Ga0495600_0049281 Ga0495600_0049281_1619_2515 291
260 3300047320 Ga0495672_0200587 Ga0495672_0200587_47_946 291
261 3300047322 Ga0495680_0010940 Ga0495680_0010940_6743_7639 291
262 3300050496 nmdc:mga07m45_172601_c1 nmdc:mga07m45_172601_c1_224_1129 291
263 3300050507 nmdc:mga05p37_10705_c1 nmdc:mga05p37_10705_c1_3552_4475 291
264 3300050512 nmdc:mga0n895_112305_c1 nmdc:mga0n895_112305_c1_1781_2704 291
265 3300050514 nmdc:mga08x19_16_c1 nmdc:mga08x19_16_c1_346002_346925 291
266 3300050514 nmdc:mga08x19_2531_c1 nmdc:mga08x19_2531_c1_6773_7696 291
267 3300050515 nmdc:mga0a205_322739_c1 nmdc:mga0a205_322739_c1_249_1172 291
268 3300050515 nmdc:mga0a205_67360_c1 nmdc:mga0a205_67360_c1_1611_2534 291
269 3300053077 Ga0495601_0008949 Ga0495601_0008949_1742_2638 291
270 3300053084 Ga0495595_0043993 Ga0495595_0043993_896_1792 291
271 3300053130 Ga0500642_0000776 Ga0500642_0000776_6052_7128 291
272 3300005290 Ga0065712_10079505 Ga0065712_100795053 292
273 3300005293 Ga0065715_10176094 Ga0065715_101760942 292
274 3300005331 Ga0070670_100488293 Ga0070670_1004882932 292
275 3300005335 Ga0070666_10002163 Ga0070666_100021637 292
276 3300005335 Ga0070666_10268198 Ga0070666_102681981 292
277 3300005340 Ga0070689_100001654 Ga0070689_10000165415 292
278 3300005343 Ga0070687_100006977 Ga0070687_1000069773 292
279 3300005353 Ga0070669_100112678 Ga0070669_1001126782 292
280 3300005354 Ga0070675_100095953 Ga0070675_1000959532 292
281 3300005355 Ga0070671_100009401 Ga0070671_1000094018 292
282 3300005364 Ga0070673_100009909 Ga0070673_1000099097 292
283 3300005365 Ga0070688_100000911 Ga0070688_1000009117 292
284 3300005367 Ga0070667_100023481 Ga0070667_1000234814 292
285 3300005438 Ga0070701_10007216 Ga0070701_100072165 292
286 3300005440 Ga0070705_100053320 Ga0070705_1000533202 292
287 3300005466 Ga0070685_10001011 Ga0070685_100010117 292
288 3300005467 Ga0070706_100189705 Ga0070706_1001897052 292
289 3300005468 Ga0070707_100017479 Ga0070707_1000174796 292
290 3300005468 Ga0070707_100026541 Ga0070707_1000265413 292
291 3300005518 Ga0070699_100121099 Ga0070699_1001210993 292
292 3300005543 Ga0070672_100004815 Ga0070672_10000481511 292
293 3300005544 Ga0070686_100001290 Ga0070686_10000129012 292
294 3300005548 Ga0070665_100052522 Ga0070665_1000525222 292
295 3300005564 Ga0070664_100051336 Ga0070664_1000513362 292
296 3300005577 Ga0068857_100215117 Ga0068857_1002151172 292
297 3300005577 Ga0068857_100218864 Ga0068857_1002188642 292
298 3300005617 Ga0068859_100002534 Ga0068859_10000253415 292
299 3300005618 Ga0068864_100009061 Ga0068864_1000090618 292
300 3300005841 Ga0068863_100001204 Ga0068863_10000120426 292
301 3300005842 Ga0068858_100035505 Ga0068858_1000355058 292
302 3300005843 Ga0068860_100073654 Ga0068860_1000736544 292
303 3300006844 Ga0075428_100057521 Ga0075428_1000575212 292
304 3300006852 Ga0075433_10070479 Ga0075433_100704793 292
305 3300006871 Ga0075434_100103705 Ga0075434_1001037053 292
306 3300006880 Ga0075429_100077641 Ga0075429_1000776414 292
307 3300006914 Ga0075436_100054694 Ga0075436_1000546945 292
308 3300006931 Ga0097620_100002534 Ga0097620_10000253415 292
309 3300007076 Ga0075435_100185597 Ga0075435_1001855972 292
310 3300009094 Ga0111539_10096390 Ga0111539_100963903 292
311 3300009101 Ga0105247_10147143 Ga0105247_101471432 292
312 3300009177 Ga0105248_10001647 Ga0105248_1000164718 292
313 3300009177 Ga0105248_10023528 Ga0105248_1002352810 292
314 3300009553 Ga0105249_10006827 Ga0105249_100068276 292
315 3300013296 Ga0157374_10071015 Ga0157374_100710153 292
316 3300013306 Ga0163162_10006715 Ga0163162_1000671513 292
317 3300013306 Ga0163162_10095639 Ga0163162_100956395 292
318 3300013308 Ga0157375_10182927 Ga0157375_101829271 292
319 3300014325 Ga0163163_10033802 Ga0163163_100338021 292
320 3300014745 Ga0157377_10005452 Ga0157377_100054526 292
321 3300014968 Ga0157379_10001012 Ga0157379_1000101216 292
322 3300014968 Ga0157379_10094633 Ga0157379_100946334 292
323 3300014968 Ga0157379_10096982 Ga0157379_100969822 292
324 3300014969 Ga0157376_10052105 Ga0157376_100521053 292
325 3300017792 Ga0163161_10020757 Ga0163161_100207574 292
326 3300025918 Ga0207662_10005053 Ga0207662_100050536 292
327 3300025922 Ga0207646_10002477 Ga0207646_100024775 292
328 3300025922 Ga0207646_10005041 Ga0207646_100050414 292
329 3300025923 Ga0207681_10085824 Ga0207681_100858243 292
330 3300025926 Ga0207659_10004012 Ga0207659_100040128 292
331 3300025926 Ga0207659_10042039 Ga0207659_100420391 292
332 3300025936 Ga0207670_10009251 Ga0207670_100092514 292
333 3300025938 Ga0207704_10135380 Ga0207704_101353803 292
334 3300025940 Ga0207691_10032187 Ga0207691_100321872 292
335 3300025941 Ga0207711_10004123 Ga0207711_1000412311 292
336 3300025941 Ga0207711_10101091 Ga0207711_101010914 292
337 3300025945 Ga0207679_10048402 Ga0207679_100484025 292
338 3300025960 Ga0207651_10004213 Ga0207651_100042136 292
339 3300025960 Ga0207651_10034139 Ga0207651_100341392 292
340 3300025961 Ga0207712_10005313 Ga0207712_100053136 292
341 3300025986 Ga0207658_10005331 Ga0207658_100053317 292
342 3300025986 Ga0207658_10016732 Ga0207658_100167324 292
343 3300025986 Ga0207658_10380604 Ga0207658_103806041 292
344 3300026035 Ga0207703_10066169 Ga0207703_100661691 292
345 3300026067 Ga0207678_10129481 Ga0207678_101294812 292
346 3300026088 Ga0207641_10000983 Ga0207641_1000098315 292
347 3300026088 Ga0207641_10016230 Ga0207641_100162303 292
348 3300026095 Ga0207676_10006159 Ga0207676_1000615911 292
349 3300026116 Ga0207674_10109933 Ga0207674_101099335 292
350 3300026121 Ga0207683_10260786 Ga0207683_102607863 292
351 3300027907 Ga0207428_10215556 Ga0207428_102155563 292
352 3300028381 Ga0268264_10002973 Ga0268264_1000297316 292
353 3300028381 Ga0268264_10013075 Ga0268264_100130754 292
354 3300031242 Ga0265329_10005075 Ga0265329_100050754 292
355 3300031344 Ga0265316_10129827 Ga0265316_101298273 292
356 3300035172 Ga0373955_0163078 Ga0373955_0163078_109_1005 292
357 3300035410 Ga0373924_0015973 Ga0373924_0015973_1373_2269 292
358 3300035692 Ga0373935_0029080 Ga0373935_0029080_401_1381 292
359 3300035725 Ga0373947_0007062 Ga0373947_0007062_1906_2886 292
360 3300036401 Ga0373937_0062544 Ga0373937_0062544_847_1743 292
361 3300037068 Ga0373925_0032539 Ga0373925_0032539_1193_2173 292
362 3300046454 Ga0495592_0060551 Ga0495592_0060551_716_1612 292
363 3300046459 Ga0495629_0029309 Ga0495629_0029309_878_1774 292
364 3300046511 Ga0495608_0036439 Ga0495608_0036439_827_1723 292
365 3300046514 Ga0495618_0007202 Ga0495618_0007202_2386_3282 292
366 3300046517 Ga0495630_0157641 Ga0495630_0157641_215_1111 292
367 3300046559 Ga0495667_0036824 Ga0495667_0036824_936_1832 292
368 3300046642 Ga0495634_0025086 Ga0495634_0025086_1564_2460 292
369 3300046675 Ga0495657_0046643 Ga0495657_0046643_522_1418 292
370 3300046689 Ga0495613_0009281 Ga0495613_0009281_2700_3596 292
371 3300046809 Ga0495600_0174286 Ga0495600_0174286_198_1094 292
372 3300047319 Ga0495674_0084806 Ga0495674_0084806_1447_2343 292
373 3300047444 Ga0495675_0100141 Ga0495675_0100141_395_1291 292
374 3300050508 nmdc:mga09592_259807_c1 nmdc:mga09592_259807_c1_280_1176 292
375 3300050510 nmdc:mga06r32_271909_c1 nmdc:mga06r32_271909_c1_718_1614 292
376 3300050511 nmdc:mga08y16_127420_c1 nmdc:mga08y16_127420_c1_637_1533 292
377 3300050512 nmdc:mga0n895_115979_c1 nmdc:mga0n895_115979_c1_695_1591 292
378 3300050513 nmdc:mga0rr50_267159_c1 nmdc:mga0rr50_267159_c1_245_1171 292
379 3300050515 nmdc:mga0a205_132150_c1 nmdc:mga0a205_132150_c1_1072_1968 292
380 3300005290 Ga0065712_10077218 Ga0065712_100772181 293
381 3300005330 Ga0070690_100136242 Ga0070690_1001362422 293
382 3300005331 Ga0070670_100035564 Ga0070670_1000355642 293
383 3300005335 Ga0070666_10008426 Ga0070666_100084265 293
384 3300005338 Ga0068868_100001645 Ga0068868_10000164512 293
385 3300005355 Ga0070671_100029396 Ga0070671_1000293962 293
386 3300005364 Ga0070673_100149019 Ga0070673_1001490193 293
387 3300005445 Ga0070708_100184645 Ga0070708_1001846452 293
388 3300005459 Ga0068867_100390317 Ga0068867_1003903172 293
389 3300005467 Ga0070706_100374165 Ga0070706_1003741651 293
390 3300005543 Ga0070672_100025583 Ga0070672_1000255833 293
391 3300005544 Ga0070686_100059550 Ga0070686_1000595501 293
392 3300005564 Ga0070664_100003815 Ga0070664_1000038152 293
393 3300005617 Ga0068859_100139699 Ga0068859_1001396992 293
394 3300005618 Ga0068864_100003257 Ga0068864_1000032574 293
395 3300005618 Ga0068864_100113745 Ga0068864_1001137454 293
396 3300005618 Ga0068864_100203739 Ga0068864_1002037392 293
397 3300005841 Ga0068863_100018719 Ga0068863_1000187194 293
398 3300005841 Ga0068863_100024533 Ga0068863_1000245333 293
399 3300005841 Ga0068863_100419236 Ga0068863_1004192362 293
400 3300005842 Ga0068858_100007451 Ga0068858_1000074519 293
401 3300006358 Ga0068871_100026500 Ga0068871_1000265002 293
402 3300006852 Ga0075433_10166922 Ga0075433_101669223 293
403 3300006871 Ga0075434_100022397 Ga0075434_1000223975 293
404 3300006931 Ga0097620_100139702 Ga0097620_1001397022 293
405 3300007076 Ga0075435_100014447 Ga0075435_1000144475 293
406 3300007265 Ga0099794_10050342 Ga0099794_100503423 293
407 3300009147 Ga0114129_10106354 Ga0114129_101063543 293
408 3300009177 Ga0105248_10034588 Ga0105248_100345884 293
409 3300009177 Ga0105248_10237868 Ga0105248_102378682 293
410 3300013296 Ga0157374_10195394 Ga0157374_101953943 293
411 3300013306 Ga0163162_10008369 Ga0163162_100083697 293
412 3300013308 Ga0157375_10005048 Ga0157375_1000504810 293
413 3300014325 Ga0163163_10029339 Ga0163163_100293394 293
414 3300014745 Ga0157377_10029432 Ga0157377_100294323 293
415 3300014969 Ga0157376_10089655 Ga0157376_100896552 293
416 3300025918 Ga0207662_10148800 Ga0207662_101488001 293
417 3300025925 Ga0207650_10005556 Ga0207650_100055564 293
418 3300025926 Ga0207659_10109223 Ga0207659_101092231 293
419 3300025931 Ga0207644_10012091 Ga0207644_100120913 293
420 3300025940 Ga0207691_10012855 Ga0207691_100128557 293
421 3300025941 Ga0207711_10025749 Ga0207711_100257494 293
422 3300025960 Ga0207651_10200764 Ga0207651_102007641 293
423 3300025986 Ga0207658_10043938 Ga0207658_100439383 293
424 3300026023 Ga0207677_10010764 Ga0207677_100107644 293
425 3300026035 Ga0207703_10080614 Ga0207703_100806142 293
426 3300026088 Ga0207641_10082003 Ga0207641_100820032 293
427 3300026088 Ga0207641_10393463 Ga0207641_103934632 293
428 3300026089 Ga0207648_10450917 Ga0207648_104509172 293
429 3300026095 Ga0207676_10104881 Ga0207676_101048814 293
430 3300026095 Ga0207676_10232812 Ga0207676_102328122 293
431 3300035172 Ga0373955_0037591 Ga0373955_0037591_737_1636 293
432 3300036401 Ga0373937_0036952 Ga0373937_0036952_3315_4214 293
433 3300046689 Ga0495613_0010422 Ga0495613_0010422_5393_6358 293
434 3300047471 Ga0495684_0115975 Ga0495684_0115975_674_1573 293
435 3300050507 nmdc:mga05p37_219007_c1 nmdc:mga05p37_219007_c1_177_1121 293

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00149

Metallophos

Calcineurin-like phosphoesterase

102

290

0.71

Structural Annotation

Top 5 Hits

ID Description Score Start End
2hyp-assembly1.cif.gz_A-2 crystal structure of rv0805 d66a mutant 0.7365 40 250
3d03-assembly1.cif.gz_A 1.9a structure of glycerophoshphodiesterase (gpdq) from enterobacter aerogenes 0.7315 42 293
2dxl-assembly1.cif.gz_A glycerophosphodiesterase from enterobacter aerogenes 0.7065 42 293
2nxf-assembly1.cif.gz_A crystal structure of a dimetal phosphatase from danio rerio loc 393393 0.7013 40 249
6gj9-assembly1.cif.gz_A purple acid phytase from wheat isoform b2 - regeneration complex 0.6927 42 259
ID Description Score Start End Superfamily
af_A0A1D8PMT0_76_326_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7521 42 224 3.60.21.10
af_Q8S2H5_315_629_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.75 42 229 3.60.21.10
3d03A01 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;GpdQ, catalytic alpha/beta sandwich domain 0.7373 42 144 3.60.21.40
2hypA00 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7365 40 250 3.60.21.10
af_Q9UUH0_46_301_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.7156 42 247 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A2V8TLJ9-F1-model_v4 Serine/threonine protein phosphatase 0.9467 85 172 GO:0005737
AF-X7ZNG7-F1-model_v4 Putative metallophosphoesterase 0.9326 109 236 GO:0005737
GO:0016787
AF-A0A2V8TLJ9-F1-model_v4 Serine/threonine protein phosphatase 0.9168 85 172 GO:0005737
AF-H1S9Y9-F1-model_v4 Ser/Thr protein phosphatase family protein 0.9115 1 153 GO:0005737
GO:0016787
AF-A0A4Q4WQ76-F1-model_v4 Calcineurin-like phosphoesterase domain-containing protein 0.8976 1 199 GO:0005737
GO:0016020
GO:0016787

Feature Viewer

pLDDT pTM Quality
81.1 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map