F443373

General Info

Members Datasets Scaffolds Average Seq Length
435 204 870 102

Family's Representative Sequence

Representative Sequence 3300039438|Ga0436360_0190645|Ga0436360_0190645_23_388
Length 121
Sequence MNPVLLLATAEAAPGVSTGEVGLNHYLILGALLFVCGAVCMATKRNAIGVLIGVELVLNGANINLVAFAHFNTAFAVEGLIFALMVIVLAAGEAAIALAIVLNFYNNHLTVDVDNAEELKG

Samples

Sample ID Description Type Environment
1 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
6 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
7 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
8 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
9 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
10 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
18 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
19 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
20 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
31 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
32 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
39 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
44 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
47 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
48 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
49 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
50 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
58 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
59 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
60 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
61 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
88 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
91 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
92 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
93 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
94 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
97 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
98 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
99 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
100 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
101 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
102 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
103 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
104 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
110 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
111 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
112 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
113 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
114 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
115 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
116 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
117 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
118 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
123 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
124 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
125 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
126 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
127 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
128 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
129 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
130 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
133 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
134 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
137 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
138 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
143 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
144 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
145 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
146 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
147 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
148 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
149 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
150 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
154 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
155 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
158 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
159 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
162 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
163 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
164 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
165 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
166 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
167 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
168 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
180 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
181 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
182 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
183 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
184 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
185 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
186 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
189 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
190 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
191 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
192 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
197 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
198 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
199 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
204 2671180531 Gemmata sp. SH-PL17 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.16
Metatranscriptomes 1.61
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 4.37
Rhizosphere 89.89
Stem 0
Stem Tuber 0
Unclassified 11.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436360_0190645 3300039438 Bacteria 576
2 Ga0065712_10071319 3300005290 Bacteria 5341
3 Ga0065707_10097065 3300005295 Bacteria 3187
4 Ga0070690_100588566 3300005330 Bacteria 843
5 Ga0070687_100927937 3300005343 Bacteria 626
6 Ga0070692_10875227 3300005345 Bacteria 619
7 Ga0070668_102153643 3300005347 Bacteria 515
8 Ga0070673_101824195 3300005364 Unclassified 576
9 Ga0070688_100418152 3300005365 Bacteria 996
10 Ga0070667_100493437 3300005367 Bacteria 1122
11 Ga0070714_100325079 3300005435 Bacteria 1439
12 Ga0070713_100024358 3300005436 Bacteria 4712
13 Ga0070713_100132171 3300005436 Bacteria 2202
14 Ga0070711_100391537 3300005439 Bacteria 1126
15 Ga0070711_100753864 3300005439 Bacteria 823
16 Ga0070685_10705946 3300005466 Bacteria 736
17 Ga0070706_100561769 3300005467 Bacteria 1061
18 Ga0070707_100025389 3300005468 Bacteria 5621
19 Ga0070707_101164796 3300005468 Bacteria 737
20 Ga0070699_100579707 3300005518 Bacteria 1022
21 Ga0070699_101979113 3300005518 Bacteria 533
22 Ga0070679_100265863 3300005530 Bacteria 1670
23 Ga0070684_101740894 3300005535 Bacteria 588
24 Ga0070697_101122681 3300005536 Bacteria 700
25 Ga0068853_102098268 3300005539 Bacteria 548
26 Ga0070686_101024238 3300005544 Unclassified 678
27 Ga0070665_100000314 3300005548 Bacteria 75274
28 Ga0070704_100076238 3300005549 Bacteria 2452
29 Ga0070704_100451312 3300005549 Bacteria 1107
30 Ga0068855_100518008 3300005563 Bacteria 1294
31 Ga0068855_101975382 3300005563 Bacteria 590
32 Ga0068854_101593517 3300005578 Bacteria 595
33 Ga0068856_102435964 3300005614 Unclassified 530
34 Ga0068859_101555958 3300005617 Bacteria 730
35 Ga0068859_102083877 3300005617 Bacteria 626
36 Ga0068864_100696148 3300005618 Bacteria 992
37 Ga0068861_101536379 3300005719 Bacteria 654
38 Ga0068860_101040923 3300005843 Bacteria 837
39 Ga0068860_101513287 3300005843 Bacteria 693
40 Ga0068862_101214818 3300005844 Bacteria 753
41 Ga0068862_101729385 3300005844 Bacteria 634
42 Ga0070717_10049227 3300006028 Bacteria 3459
43 Ga0070717_10092742 3300006028 Bacteria 2552
44 Ga0070717_10687597 3300006028 Unclassified 929
45 Ga0070717_11050188 3300006028 Bacteria 742
46 Ga0070717_11098875 3300006028 Bacteria 724
47 Ga0075428_100015679 3300006844 Bacteria 8397
48 Ga0075428_100017376 3300006844 Bacteria 7950
49 Ga0075428_100077216 3300006844 Bacteria 3635
50 Ga0075428_100227149 3300006844 Bacteria 2015
51 Ga0075428_100380637 3300006844 Bacteria 1513
52 Ga0075428_100681005 3300006844 Bacteria 1096
53 Ga0075428_102134250 3300006844 Bacteria 579
54 Ga0075431_100446871 3300006847 Bacteria 1289
55 Ga0075433_11725107 3300006852 Bacteria 539
56 Ga0075434_100348797 3300006871 Bacteria 1501
57 Ga0075434_100903056 3300006871 Bacteria 898
58 Ga0075429_100345338 3300006880 Bacteria 1303
59 Ga0075429_100775253 3300006880 Bacteria 840
60 Ga0075429_101034342 3300006880 Unclassified 718
61 Ga0097620_101555740 3300006931 Bacteria 730
62 Ga0097620_102084753 3300006931 Bacteria 626
63 Ga0075435_100435975 3300007076 Bacteria 1129
64 Ga0111539_10030111 3300009094 Bacteria 6601
65 Ga0111539_11293216 3300009094 Bacteria 846
66 Ga0111539_11618210 3300009094 Bacteria 751
67 Ga0111539_12756656 3300009094 Unclassified 569
68 Ga0105245_10137909 3300009098 Bacteria 2294
69 Ga0105245_10851560 3300009098 Bacteria 952
70 Ga0105245_12126394 3300009098 Bacteria 615
71 Ga0114129_10535724 3300009147 Bacteria 1525
72 Ga0114129_11307292 3300009147 Bacteria 898
73 Ga0114129_12365465 3300009147 Bacteria 637
74 Ga0114129_12600534 3300009147 Bacteria 604
75 Ga0105242_10545139 3300009176 Bacteria 1111
76 Ga0105242_10859884 3300009176 Unclassified 903
77 Ga0105242_12946738 3300009176 Unclassified 526
78 Ga0105237_10764374 3300009545 Bacteria 973
79 Ga0105237_10904282 3300009545 Unclassified 890
80 Ga0105238_10598987 3300009551 Bacteria 1110
81 Ga0105238_11569835 3300009551 Unclassified 688
82 Ga0105249_10528862 3300009553 Bacteria 1227
83 Ga0105249_11082721 3300009553 Bacteria 871
84 Ga0105239_10541734 3300010375 Bacteria 1325
85 Ga0157370_11358035 3300013104 Bacteria 640
86 Ga0157370_11688492 3300013104 Bacteria 569
87 Ga0157378_10062962 3300013297 Bacteria 3314
88 Ga0157378_12249956 3300013297 Bacteria 596
89 Ga0157372_12396179 3300013307 Bacteria 606
90 Ga0157377_11357168 3300014745 Bacteria 558
91 Ga0157376_11867923 3300014969 Bacteria 637
92 Ga0157376_13005108 3300014969 Bacteria 511
93 Ga0197907_10423358 3300020069 Unclassified 850
94 Ga0206349_1925088 3300020075 Unclassified 612
95 Ga0206350_10026695 3300020080 Bacteria 508
96 Ga0206350_11532134 3300020080 Bacteria 2327
97 Ga0213873_10130422 3300021358 Bacteria 744
98 Ga0213873_10295042 3300021358 Unclassified 522
99 Ga0213872_10062704 3300021361 Bacteria 1680
100 Ga0213874_10350333 3300021377 Bacteria 566
101 Ga0213871_10096952 3300021441 Bacteria 860
102 Ga0224712_10033887 3300022467 Bacteria 1873
103 Ga0207699_10226361 3300025906 Bacteria 1279
104 Ga0207684_10758794 3300025910 Bacteria 822
105 Ga0207663_10697117 3300025916 Bacteria 804
106 Ga0207660_10452059 3300025917 Unclassified 1039
107 Ga0207652_11017535 3300025921 Bacteria 728
108 Ga0207646_10023662 3300025922 Bacteria 5639
109 Ga0207646_10594286 3300025922 Bacteria 994
110 Ga0207681_11410169 3300025923 Bacteria 585
111 Ga0207687_10084845 3300025927 Bacteria 2296
112 Ga0207700_10025395 3300025928 Bacteria 4113
113 Ga0207700_10661336 3300025928 Unclassified 932
114 Ga0207700_11835485 3300025928 Unclassified 532
115 Ga0207664_10324641 3300025929 Bacteria 1358
116 Ga0207664_10635528 3300025929 Bacteria 959
117 Ga0207706_10814222 3300025933 Bacteria 793
118 Ga0207686_10274165 3300025934 Unclassified 1242
119 Ga0207686_10358572 3300025934 Bacteria 1100
120 Ga0207665_11306649 3300025939 Bacteria 578
121 Ga0207665_11634707 3300025939 Bacteria 510
122 Ga0207667_11239852 3300025949 Bacteria 724
123 Ga0207651_11601043 3300025960 Bacteria 587
124 Ga0207712_10457992 3300025961 Bacteria 1083
125 Ga0207668_11849706 3300025972 Bacteria 545
126 Ga0207658_10799795 3300025986 Bacteria 856
127 Ga0207678_10435305 3300026067 Bacteria 1138
128 Ga0207708_11972995 3300026075 Bacteria 511
129 Ga0207641_10378164 3300026088 Bacteria 1356
130 Ga0207648_10836084 3300026089 Unclassified 858
131 Ga0207648_11573379 3300026089 Bacteria 618
132 Ga0207648_12246894 3300026089 Bacteria 506
133 Ga0207676_10480398 3300026095 Bacteria 1177
134 Ga0207675_101687148 3300026118 Bacteria 654
135 Ga0207683_10922500 3300026121 Unclassified 811
136 Ga0207428_10055290 3300027907 Bacteria 3156
137 Ga0268266_10001332 3300028379 Bacteria 29935
138 Ga0268265_10971242 3300028380 Unclassified 838
139 Ga0268265_11776353 3300028380 Unclassified 623
140 Ga0265337_1001768 3300028556 Bacteria 10421
141 Ga0265326_10004233 3300028558 Bacteria 4617
142 Ga0265326_10101314 3300028558 Unclassified 817
143 Ga0265326_10106793 3300028558 Bacteria 794
144 Ga0265318_10028820 3300028577 Bacteria 2168
145 Ga0265323_10002904 3300028653 Bacteria 7686
146 Ga0265323_10008129 3300028653 Bacteria 4338
147 Ga0265323_10008801 3300028653 Bacteria 4148
148 Ga0265323_10041542 3300028653 Bacteria 1668
149 Ga0265322_10009285 3300028654 Bacteria 2856
150 Ga0265322_10055484 3300028654 Bacteria 1124
151 Ga0265322_10134458 3300028654 Bacteria 706
152 Ga0265336_10078034 3300028666 Unclassified 989
153 Ga0307515_10149428 3300028794 Bacteria 2452
154 Ga0265338_10022872 3300028800 Bacteria 6449
155 Ga0265338_10030323 3300028800 Bacteria 5331
156 Ga0265338_10067418 3300028800 Bacteria 3091
157 Ga0265338_10152822 3300028800 Bacteria 1791
158 Ga0265338_10662441 3300028800 Bacteria 723
159 Ga0265330_10000518 3300031235 Bacteria 25473
160 Ga0265330_10000635 3300031235 Bacteria 22568
161 Ga0265330_10001989 3300031235 Bacteria 11343
162 Ga0265330_10013367 3300031235 Bacteria 3827
163 Ga0265330_10013834 3300031235 Bacteria 3753
164 Ga0265330_10017711 3300031235 Bacteria 3279
165 Ga0265330_10038346 3300031235 Bacteria 2130
166 Ga0265330_10062558 3300031235 Bacteria 1618
167 Ga0265330_10149617 3300031235 Bacteria 992
168 Ga0265332_10022715 3300031238 Bacteria 2768
169 Ga0265332_10027451 3300031238 Bacteria 2494
170 Ga0265332_10089539 3300031238 Unclassified 1302
171 Ga0265332_10180899 3300031238 Bacteria 878
172 Ga0265328_10034111 3300031239 Bacteria 1885
173 Ga0265328_10127419 3300031239 Bacteria 952
174 Ga0265328_10431821 3300031239 Bacteria 519
175 Ga0265320_10028334 3300031240 Bacteria 2909
176 Ga0265325_10006617 3300031241 Bacteria 7016
177 Ga0265325_10012950 3300031241 Bacteria 4758
178 Ga0265325_10028725 3300031241 Bacteria 2994
179 Ga0265325_10062098 3300031241 Bacteria 1893
180 Ga0265325_10184705 3300031241 Bacteria 969
181 Ga0265329_10001023 3300031242 Bacteria 13951
182 Ga0265329_10001033 3300031242 Bacteria 13863
183 Ga0265340_10000048 3300031247 Bacteria 55214
184 Ga0265340_10156545 3300031247 Unclassified 1037
185 Ga0265339_10002345 3300031249 Bacteria 13611
186 Ga0265339_10018017 3300031249 Bacteria 4171
187 Ga0265339_10234995 3300031249 Bacteria 892
188 Ga0265339_10248360 3300031249 Bacteria 862
189 Ga0265339_10292132 3300031249 Unclassified 779
190 Ga0265331_10000249 3300031250 Bacteria 64057
191 Ga0265331_10003927 3300031250 Bacteria 9400
192 Ga0265331_10024475 3300031250 Bacteria 3053
193 Ga0265331_10344596 3300031250 Bacteria 667
194 Ga0265331_10543269 3300031250 Archaea 524
195 Ga0265316_10000385 3300031344 Bacteria 50282
196 Ga0265316_10000528 3300031344 Bacteria 43117
197 Ga0265316_10000658 3300031344 Bacteria 38387
198 Ga0265316_10002836 3300031344 Bacteria 17735
199 Ga0265316_10011750 3300031344 Bacteria 7876
200 Ga0265316_10023965 3300031344 Bacteria 5124
201 Ga0265316_10081722 3300031344 Bacteria 2477
202 Ga0265316_10236981 3300031344 Unclassified 1342
203 Ga0265316_10470791 3300031344 Bacteria 900
204 Ga0265316_10724422 3300031344 Bacteria 700
205 Ga0265316_10871796 3300031344 Unclassified 629
206 Ga0265316_10902370 3300031344 Bacteria 617
207 Ga0265313_10000651 3300031595 Bacteria 35713
208 Ga0265313_10002711 3300031595 Bacteria 15003
209 Ga0265313_10059961 3300031595 Bacteria 1787
210 Ga0307508_10426449 3300031616 Bacteria 918
211 Ga0316575_10260433 3300031665 Bacteria 728
212 Ga0265314_10000123 3300031711 Bacteria 119667
213 Ga0265314_10000329 3300031711 Bacteria 66603
214 Ga0265314_10001168 3300031711 Bacteria 30218
215 Ga0265314_10119265 3300031711 Bacteria 1663
216 Ga0265314_10130569 3300031711 Bacteria 1568
217 Ga0265342_10000531 3300031712 Bacteria 40583
218 Ga0265342_10001476 3300031712 Bacteria 21863
219 Ga0265342_10002495 3300031712 Bacteria 15847
220 Ga0265342_10003154 3300031712 Bacteria 13753
221 Ga0265342_10011307 3300031712 Bacteria 6119
222 Ga0265342_10026684 3300031712 Bacteria 3616
223 Ga0265342_10219431 3300031712 Bacteria 1025
224 Ga0316576_10004881 3300031727 Bacteria 8107
225 Ga0307409_100870921 3300031995 Bacteria 913
226 Ga0307409_102954242 3300031995 Bacteria 502
227 Ga0307416_101618956 3300032002 Bacteria 753
228 Ga0373955_0372654 3300035172 Bacteria 866
229 Ga0373955_0534308 3300035172 Bacteria 717
230 Ga0373931_1256175 3300035691 Bacteria 508
231 Ga0373935_0795639 3300035692 Bacteria 698
232 Ga0373937_0092332 3300036401 Bacteria 2806
233 Ga0373925_1664594 3300037068 Bacteria 521
234 Ga0436364_0266955 3300037853 Bacteria 780
235 Ga0436364_0770789 3300037853 Bacteria 617
236 Ga0436364_0774572 3300037853 Bacteria 839
237 Ga0436364_0871193 3300037853 Bacteria 534
238 Ga0436364_1022235 3300037853 Bacteria 2411
239 Ga0436365_0205815 3300039437 Bacteria 823
240 Ga0436365_0860597 3300039437 Bacteria 548
241 Ga0436360_0011027 3300039438 Bacteria 645
242 Ga0436360_0044697 3300039438 Unclassified 622
243 Ga0436360_0421739 3300039438 Bacteria 533
244 Ga0436360_0839543 3300039438 Bacteria 627
245 Ga0436360_0918928 3300039438 Bacteria 534
246 Ga0436360_0987457 3300039438 Bacteria 572
247 Ga0436360_1082119 3300039438 Bacteria 1329
248 Ga0436360_1202107 3300039438 Bacteria 1033
249 Ga0436360_1286586 3300039438 Bacteria 549
250 Ga0436361_0212179 3300039447 Bacteria 1338
251 Ga0436361_0220706 3300039447 Unclassified 1475
252 Ga0436361_0453654 3300039447 Bacteria 963
253 Ga0436361_0552511 3300039447 Bacteria 709
254 Ga0436361_0851747 3300039447 Bacteria 1652
255 Ga0436361_0919706 3300039447 Bacteria 707
256 Ga0436361_1081988 3300039447 Unclassified 547
257 Ga0436363_0162819 3300039450 Unclassified 520
258 Ga0436363_0233507 3300039450 Bacteria 856
259 Ga0436363_0348273 3300039450 Bacteria 644
260 Ga0436363_0849392 3300039450 Bacteria 606
261 Ga0436363_0874296 3300039450 Bacteria 560
262 Ga0436363_0959948 3300039450 Bacteria 850
263 Ga0436363_1230189 3300039450 Bacteria 667
264 Ga0436363_1553357 3300039450 Bacteria 870
265 Ga0436362_0134737 3300039453 Bacteria 609
266 Ga0436362_0387916 3300039453 Bacteria 4443
267 Ga0436362_0660708 3300039453 Bacteria 1606
268 Ga0436362_0886286 3300039453 Bacteria 547
269 Ga0436362_0943452 3300039453 Bacteria 546
270 Ga0436362_1159178 3300039453 Unclassified 744
271 Ga0439465_0020788 3300041413 Bacteria 2057
272 Ga0451837_1739609 3300041494 Unclassified 532
273 Ga0451849_0564813 3300041505 Bacteria 543
274 Ga0439445_0039640 3300042004 Bacteria 1249
275 Ga0439434_0045496 3300042435 Bacteria 1354
276 Ga0451577_0041752 3300042876 Bacteria 4117
277 Ga0451577_0088056 3300042876 Bacteria 2770
278 Ga0451577_0220933 3300042876 Bacteria 1713
279 Ga0451577_0267995 3300042876 Bacteria 1546
280 Ga0451577_0339543 3300042876 Bacteria 1362
281 Ga0451577_0423476 3300042876 Bacteria 1209
282 Ga0451577_0456521 3300042876 Bacteria 1160
283 Ga0451577_0457858 3300042876 Bacteria 1158
284 Ga0451577_1048068 3300042876 Bacteria 731
285 Ga0451577_1382979 3300042876 Bacteria 624
286 Ga0453683_0017167 3300044673 Bacteria 4664
287 Ga0453683_0035433 3300044673 Bacteria 3144
288 Ga0453683_0079757 3300044673 Bacteria 2050
289 Ga0453683_0903582 3300044673 Bacteria 584
290 Ga0466965_0410542 3300044683 Bacteria 749
291 Ga0453684_0000248 3300044712 Bacteria 232277
292 Ga0453684_0001494 3300044712 Bacteria 65880
293 Ga0453684_0019408 3300044712 Bacteria 10353
294 Ga0453684_0029975 3300044712 Bacteria 7701
295 Ga0453684_0039470 3300044712 Bacteria 6432
296 Ga0453684_0057600 3300044712 Bacteria 5027
297 Ga0453684_0057812 3300044712 Bacteria 5014
298 Ga0453684_0163864 3300044712 Bacteria 2626
299 Ga0453684_0175876 3300044712 Bacteria 2517
300 Ga0453684_0201584 3300044712 Bacteria 2319
301 Ga0453684_0226836 3300044712 Bacteria 2159
302 Ga0453684_0256016 3300044712 Bacteria 2007
303 Ga0453684_0324027 3300044712 Bacteria 1744
304 Ga0453684_0397830 3300044712 Bacteria 1543
305 Ga0453684_0483074 3300044712 Bacteria 1374
306 Ga0453684_0779031 3300044712 Bacteria 1033
307 Ga0453684_1206577 3300044712 Bacteria 794
308 Ga0466970_0833319 3300044765 Bacteria 541
309 Ga0466959_0765699 3300045049 Bacteria 646
310 Ga0451576_0000701 3300045051 Bacteria 68025
311 Ga0451576_0097667 3300045051 Bacteria 3054
312 Ga0451576_0549651 3300045051 Bacteria 1213
313 Ga0451576_0591204 3300045051 Bacteria 1166
314 Ga0451576_0657250 3300045051 Bacteria 1101
315 Ga0451576_0731339 3300045051 Bacteria 1039
316 Ga0451576_0775311 3300045051 Bacteria 1007
317 Ga0451576_1198603 3300045051 Bacteria 793
318 Ga0451576_1592043 3300045051 Unclassified 678
319 Ga0451576_1961372 3300045051 Bacteria 603
320 Ga0466958_0261837 3300045836 Bacteria 1107
321 Ga0466967_1035120 3300045976 Bacteria 818
322 Ga0495592_0254887 3300046454 Unclassified 1158
323 Ga0495592_0607074 3300046454 Bacteria 667
324 Ga0495608_0208163 3300046511 Bacteria 1231
325 Ga0495628_0481796 3300046516 Bacteria 898
326 Ga0495628_0559399 3300046516 Unclassified 820
327 Ga0495628_0613760 3300046516 Bacteria 776
328 Ga0495630_0352266 3300046517 Bacteria 1127
329 Ga0495652_0451550 3300046529 Unclassified 900
330 Ga0495587_0055580 3300046536 Bacteria 2331
331 Ga0495645_0489980 3300046543 Bacteria 770
332 Ga0495667_0039752 3300046559 Bacteria 3126
333 Ga0495635_0199046 3300046663 Bacteria 1359
334 Ga0495657_0708471 3300046675 Bacteria 578
335 Ga0495647_0410125 3300046681 Bacteria 623
336 Ga0495613_0289044 3300046689 Bacteria 1137
337 Ga0495604_0116001 3300047317 Bacteria 1945
338 Ga0495675_0179760 3300047444 Bacteria 1296
339 Ga0495602_0575111 3300048088 Unclassified 778
340 Ga0496100_0418888 3300048903 Bacteria 1022
341 Ga0496104_0029385 3300048907 Bacteria 5098
342 Ga0496105_0002332 3300048908 Bacteria 13758
343 Ga0496105_1326297 3300048908 Bacteria 524
344 Ga0496108_0069306 3300048911 Unclassified 2976
345 Ga0496108_0875230 3300048911 Bacteria 772
346 Ga0496108_1000663 3300048911 Bacteria 714
347 Ga0496109_0014860 3300048912 Bacteria 6774
348 Ga0496109_0335009 3300048912 Bacteria 1429
349 Ga0496110_0484947 3300048913 Bacteria 1126
350 Ga0496110_0516325 3300048913 Bacteria 1087
351 Ga0496110_1078674 3300048913 Unclassified 711
352 Ga0496111_1258235 3300048914 Bacteria 523
353 Ga0496112_0034412 3300048915 Unclassified 4931
354 Ga0496112_1303491 3300048915 Bacteria 642
355 Ga0496112_1405523 3300048915 Bacteria 612
356 Ga0496114_0818638 3300048917 Bacteria 810
357 Ga0496115_0322968 3300048918 Bacteria 1262
358 Ga0496115_0353348 3300048918 Unclassified 1198
359 Ga0496121_0502615 3300048924 Bacteria 769
360 Ga0496126_0068915 3300048929 Bacteria 3157
361 Ga0501031_0032011 3300049568 Bacteria 3430
362 Ga0501033_0022612 3300049570 Bacteria 4743
363 Ga0501033_0692520 3300049570 Bacteria 694
364 Ga0501034_0002169 3300049571 Bacteria 24340
365 Ga0501034_0006404 3300049571 Bacteria 12682
366 Ga0501036_0096513 3300049572 Bacteria 2499
367 Ga0501036_0163459 3300049572 Bacteria 1876
368 Ga0501036_0669151 3300049572 Bacteria 859
369 Ga0501036_0684329 3300049572 Bacteria 848
370 Ga0501036_0821446 3300049572 Unclassified 765
371 Ga0501036_1730340 3300049572 Bacteria 504
372 Ga0501038_1331615 3300049574 Bacteria 518
373 Ga0501039_0332356 3300049575 Unclassified 1194
374 Ga0501040_0091192 3300049576 Bacteria 2119
375 Ga0501041_0070063 3300049577 Bacteria 2152
376 Ga0501042_0348195 3300049578 Bacteria 1072
377 Ga0501043_0127660 3300049579 Bacteria 1994
378 Ga0501046_0100008 3300049580 Bacteria 2225
379 Ga0501048_0556245 3300049582 Bacteria 823
380 Ga0501048_1220442 3300049582 Bacteria 541
381 Ga0501048_1284714 3300049582 Bacteria 526
382 Ga0501070_0111984 3300049586 Bacteria 2256
383 Ga0501070_0340783 3300049586 Unclassified 1218
384 Ga0501070_1309049 3300049586 Bacteria 553
385 Ga0501070_1366969 3300049586 Bacteria 539
386 Ga0501071_0349199 3300049587 Bacteria 1126
387 Ga0501071_1371874 3300049587 Bacteria 546
388 Ga0501072_0818877 3300049588 Bacteria 729
389 Ga0501072_0858012 3300049588 Bacteria 710
390 Ga0501075_0352547 3300049591 Bacteria 1121
391 Ga0501075_0717967 3300049591 Bacteria 761
392 Ga0501076_0033897 3300049592 Bacteria 3988
393 Ga0501076_1245205 3300049592 Bacteria 612
394 Ga0501079_0196358 3300049741 Bacteria 1575
395 Ga0501080_0794895 3300049742 Bacteria 830
396 Ga0501081_0779044 3300049743 Bacteria 719
397 Ga0501081_1129342 3300049743 Bacteria 593
398 Ga0501044_0106401 3300049823 Bacteria 2817
399 Ga0501044_0408574 3300049823 Unclassified 1269
400 Ga0501044_1527258 3300049823 Bacteria 533
401 Ga0501045_0054388 3300049824 Bacteria 2926
402 Ga0501045_1364048 3300049824 Bacteria 515
403 nmdc:mga00v17_366304_c1 3300050491 Bacteria 937
404 nmdc:mga0yw44_432657_c1 3300050492 Bacteria 891
405 nmdc:mga05p37_2067155_c1 3300050507 Bacteria 535
406 nmdc:mga05p37_473304_c1 3300050507 Bacteria 1445
407 nmdc:mga09592_316007_c1 3300050508 Bacteria 1353
408 nmdc:mga09592_741717_c1 3300050508 Bacteria 834
409 nmdc:mga06r32_555771_c1 3300050510 Bacteria 1121
410 nmdc:mga06r32_773602_c1 3300050510 Bacteria 922
411 nmdc:mga06r32_951283_c1 3300050510 Bacteria 813
412 nmdc:mga08y16_27766_c1 3300050511 Bacteria 5964
413 nmdc:mga0n895_1048627_c1 3300050512 Bacteria 794
414 nmdc:mga08x19_1120666_c1 3300050514 Bacteria 558
415 Ga0495601_0038025 3300053077 Bacteria 3008
416 Ga0495601_0939436 3300053077 Unclassified 545
417 Ga0495595_0041762 3300053084 Bacteria 2100
418 Ga0495595_0108246 3300053084 Bacteria 1346
419 Ga0495619_0003260 3300053085 Bacteria 10500
420 Ga0495619_0236688 3300053085 Bacteria 1265
421 Ga0495619_0571255 3300053085 Bacteria 775
422 Ga0501084_0078817 3300054114 Bacteria 2761
423 Ga0501084_0487566 3300054114 Bacteria 1042
424 Ga0501084_0635062 3300054114 Bacteria 902
425 Ga0501084_0850645 3300054114 Bacteria 768
426 Ga0501084_1285523 3300054114 Bacteria 613
427 Ga0587088_174233 3300059508 Bacteria 535
428 Ga0587079_244364 3300059647 Bacteria 508
429 Ga0530510_0019853 3300061734 Bacteria 4775
430 Ga0530510_0067266 3300061734 Bacteria 2599
431 Ga0530510_0181656 3300061734 Bacteria 1560
432 Ga0530510_0530687 3300061734 Bacteria 893
433 Ga0530510_0567533 3300061734 Bacteria 862
434 Ga0530510_1350414 3300061734 Unclassified 547
435 2673163232 2671180531 Bacteria 9045424
436 Ga0436360_0190645
437 Ga0065712_10071319
438 Ga0065707_10097065
439 Ga0070690_100588566
440 Ga0070687_100927937
441 Ga0070692_10875227
442 Ga0070668_102153643
443 Ga0070673_101824195
444 Ga0070688_100418152
445 Ga0070667_100493437
446 Ga0070714_100325079
447 Ga0070713_100024358
448 Ga0070713_100132171
449 Ga0070711_100391537
450 Ga0070711_100753864
451 Ga0070685_10705946
452 Ga0070706_100561769
453 Ga0070707_100025389
454 Ga0070707_101164796
455 Ga0070699_100579707
456 Ga0070699_101979113
457 Ga0070679_100265863
458 Ga0070684_101740894
459 Ga0070697_101122681
460 Ga0068853_102098268
461 Ga0070686_101024238
462 Ga0070665_100000314
463 Ga0070704_100076238
464 Ga0070704_100451312
465 Ga0068855_100518008
466 Ga0068855_101975382
467 Ga0068854_101593517
468 Ga0068856_102435964
469 Ga0068859_101555958
470 Ga0068859_102083877
471 Ga0068864_100696148
472 Ga0068861_101536379
473 Ga0068860_101040923
474 Ga0068860_101513287
475 Ga0068862_101214818
476 Ga0068862_101729385
477 Ga0070717_10049227
478 Ga0070717_10092742
479 Ga0070717_10687597
480 Ga0070717_11050188
481 Ga0070717_11098875
482 Ga0075428_100015679
483 Ga0075428_100017376
484 Ga0075428_100077216
485 Ga0075428_100227149
486 Ga0075428_100380637
487 Ga0075428_100681005
488 Ga0075428_102134250
489 Ga0075431_100446871
490 Ga0075433_11725107
491 Ga0075434_100348797
492 Ga0075434_100903056
493 Ga0075429_100345338
494 Ga0075429_100775253
495 Ga0075429_101034342
496 Ga0097620_101555740
497 Ga0097620_102084753
498 Ga0075435_100435975
499 Ga0111539_10030111
500 Ga0111539_11293216
501 Ga0111539_11618210
502 Ga0111539_12756656
503 Ga0105245_10137909
504 Ga0105245_10851560
505 Ga0105245_12126394
506 Ga0114129_10535724
507 Ga0114129_11307292
508 Ga0114129_12365465
509 Ga0114129_12600534
510 Ga0105242_10545139
511 Ga0105242_10859884
512 Ga0105242_12946738
513 Ga0105237_10764374
514 Ga0105237_10904282
515 Ga0105238_10598987
516 Ga0105238_11569835
517 Ga0105249_10528862
518 Ga0105249_11082721
519 Ga0105239_10541734
520 Ga0157370_11358035
521 Ga0157370_11688492
522 Ga0157378_10062962
523 Ga0157378_12249956
524 Ga0157372_12396179
525 Ga0157377_11357168
526 Ga0157376_11867923
527 Ga0157376_13005108
528 Ga0197907_10423358
529 Ga0206349_1925088
530 Ga0206350_10026695
531 Ga0206350_11532134
532 Ga0213873_10130422
533 Ga0213873_10295042
534 Ga0213872_10062704
535 Ga0213874_10350333
536 Ga0213871_10096952
537 Ga0224712_10033887
538 Ga0207699_10226361
539 Ga0207684_10758794
540 Ga0207663_10697117
541 Ga0207660_10452059
542 Ga0207652_11017535
543 Ga0207646_10023662
544 Ga0207646_10594286
545 Ga0207681_11410169
546 Ga0207687_10084845
547 Ga0207700_10025395
548 Ga0207700_10661336
549 Ga0207700_11835485
550 Ga0207664_10324641
551 Ga0207664_10635528
552 Ga0207706_10814222
553 Ga0207686_10274165
554 Ga0207686_10358572
555 Ga0207665_11306649
556 Ga0207665_11634707
557 Ga0207667_11239852
558 Ga0207651_11601043
559 Ga0207712_10457992
560 Ga0207668_11849706
561 Ga0207658_10799795
562 Ga0207678_10435305
563 Ga0207708_11972995
564 Ga0207641_10378164
565 Ga0207648_10836084
566 Ga0207648_11573379
567 Ga0207648_12246894
568 Ga0207676_10480398
569 Ga0207675_101687148
570 Ga0207683_10922500
571 Ga0207428_10055290
572 Ga0268266_10001332
573 Ga0268265_10971242
574 Ga0268265_11776353
575 Ga0265337_1001768
576 Ga0265326_10004233
577 Ga0265326_10101314
578 Ga0265326_10106793
579 Ga0265318_10028820
580 Ga0265323_10002904
581 Ga0265323_10008129
582 Ga0265323_10008801
583 Ga0265323_10041542
584 Ga0265322_10009285
585 Ga0265322_10055484
586 Ga0265322_10134458
587 Ga0265336_10078034
588 Ga0307515_10149428
589 Ga0265338_10022872
590 Ga0265338_10030323
591 Ga0265338_10067418
592 Ga0265338_10152822
593 Ga0265338_10662441
594 Ga0265330_10000518
595 Ga0265330_10000635
596 Ga0265330_10001989
597 Ga0265330_10013367
598 Ga0265330_10013834
599 Ga0265330_10017711
600 Ga0265330_10038346
601 Ga0265330_10062558
602 Ga0265330_10149617
603 Ga0265332_10022715
604 Ga0265332_10027451
605 Ga0265332_10089539
606 Ga0265332_10180899
607 Ga0265328_10034111
608 Ga0265328_10127419
609 Ga0265328_10431821
610 Ga0265320_10028334
611 Ga0265325_10006617
612 Ga0265325_10012950
613 Ga0265325_10028725
614 Ga0265325_10062098
615 Ga0265325_10184705
616 Ga0265329_10001023
617 Ga0265329_10001033
618 Ga0265340_10000048
619 Ga0265340_10156545
620 Ga0265339_10002345
621 Ga0265339_10018017
622 Ga0265339_10234995
623 Ga0265339_10248360
624 Ga0265339_10292132
625 Ga0265331_10000249
626 Ga0265331_10003927
627 Ga0265331_10024475
628 Ga0265331_10344596
629 Ga0265331_10543269
630 Ga0265316_10000385
631 Ga0265316_10000528
632 Ga0265316_10000658
633 Ga0265316_10002836
634 Ga0265316_10011750
635 Ga0265316_10023965
636 Ga0265316_10081722
637 Ga0265316_10236981
638 Ga0265316_10470791
639 Ga0265316_10724422
640 Ga0265316_10871796
641 Ga0265316_10902370
642 Ga0265313_10000651
643 Ga0265313_10002711
644 Ga0265313_10059961
645 Ga0307508_10426449
646 Ga0316575_10260433
647 Ga0265314_10000123
648 Ga0265314_10000329
649 Ga0265314_10001168
650 Ga0265314_10119265
651 Ga0265314_10130569
652 Ga0265342_10000531
653 Ga0265342_10001476
654 Ga0265342_10002495
655 Ga0265342_10003154
656 Ga0265342_10011307
657 Ga0265342_10026684
658 Ga0265342_10219431
659 Ga0316576_10004881
660 Ga0307409_100870921
661 Ga0307409_102954242
662 Ga0307416_101618956
663 Ga0373955_0372654
664 Ga0373955_0534308
665 Ga0373931_1256175
666 Ga0373935_0795639
667 Ga0373937_0092332
668 Ga0373925_1664594
669 Ga0436364_0266955
670 Ga0436364_0770789
671 Ga0436364_0774572
672 Ga0436364_0871193
673 Ga0436364_1022235
674 Ga0436365_0205815
675 Ga0436365_0860597
676 Ga0436360_0011027
677 Ga0436360_0044697
678 Ga0436360_0421739
679 Ga0436360_0839543
680 Ga0436360_0918928
681 Ga0436360_0987457
682 Ga0436360_1082119
683 Ga0436360_1202107
684 Ga0436360_1286586
685 Ga0436361_0212179
686 Ga0436361_0220706
687 Ga0436361_0453654
688 Ga0436361_0552511
689 Ga0436361_0851747
690 Ga0436361_0919706
691 Ga0436361_1081988
692 Ga0436363_0162819
693 Ga0436363_0233507
694 Ga0436363_0348273
695 Ga0436363_0849392
696 Ga0436363_0874296
697 Ga0436363_0959948
698 Ga0436363_1230189
699 Ga0436363_1553357
700 Ga0436362_0134737
701 Ga0436362_0387916
702 Ga0436362_0660708
703 Ga0436362_0886286
704 Ga0436362_0943452
705 Ga0436362_1159178
706 Ga0439465_0020788
707 Ga0451837_1739609
708 Ga0451849_0564813
709 Ga0439445_0039640
710 Ga0439434_0045496
711 Ga0451577_0041752
712 Ga0451577_0088056
713 Ga0451577_0220933
714 Ga0451577_0267995
715 Ga0451577_0339543
716 Ga0451577_0423476
717 Ga0451577_0456521
718 Ga0451577_0457858
719 Ga0451577_1048068
720 Ga0451577_1382979
721 Ga0453683_0017167
722 Ga0453683_0035433
723 Ga0453683_0079757
724 Ga0453683_0903582
725 Ga0466965_0410542
726 Ga0453684_0000248
727 Ga0453684_0001494
728 Ga0453684_0019408
729 Ga0453684_0029975
730 Ga0453684_0039470
731 Ga0453684_0057600
732 Ga0453684_0057812
733 Ga0453684_0163864
734 Ga0453684_0175876
735 Ga0453684_0201584
736 Ga0453684_0226836
737 Ga0453684_0256016
738 Ga0453684_0324027
739 Ga0453684_0397830
740 Ga0453684_0483074
741 Ga0453684_0779031
742 Ga0453684_1206577
743 Ga0466970_0833319
744 Ga0466959_0765699
745 Ga0451576_0000701
746 Ga0451576_0097667
747 Ga0451576_0549651
748 Ga0451576_0591204
749 Ga0451576_0657250
750 Ga0451576_0731339
751 Ga0451576_0775311
752 Ga0451576_1198603
753 Ga0451576_1592043
754 Ga0451576_1961372
755 Ga0466958_0261837
756 Ga0466967_1035120
757 Ga0495592_0254887
758 Ga0495592_0607074
759 Ga0495608_0208163
760 Ga0495628_0481796
761 Ga0495628_0559399
762 Ga0495628_0613760
763 Ga0495630_0352266
764 Ga0495652_0451550
765 Ga0495587_0055580
766 Ga0495645_0489980
767 Ga0495667_0039752
768 Ga0495635_0199046
769 Ga0495657_0708471
770 Ga0495647_0410125
771 Ga0495613_0289044
772 Ga0495604_0116001
773 Ga0495675_0179760
774 Ga0495602_0575111
775 Ga0496100_0418888
776 Ga0496104_0029385
777 Ga0496105_0002332
778 Ga0496105_1326297
779 Ga0496108_0069306
780 Ga0496108_0875230
781 Ga0496108_1000663
782 Ga0496109_0014860
783 Ga0496109_0335009
784 Ga0496110_0484947
785 Ga0496110_0516325
786 Ga0496110_1078674
787 Ga0496111_1258235
788 Ga0496112_0034412
789 Ga0496112_1303491
790 Ga0496112_1405523
791 Ga0496114_0818638
792 Ga0496115_0322968
793 Ga0496115_0353348
794 Ga0496121_0502615
795 Ga0496126_0068915
796 Ga0501031_0032011
797 Ga0501033_0022612
798 Ga0501033_0692520
799 Ga0501034_0002169
800 Ga0501034_0006404
801 Ga0501036_0096513
802 Ga0501036_0163459
803 Ga0501036_0669151
804 Ga0501036_0684329
805 Ga0501036_0821446
806 Ga0501036_1730340
807 Ga0501038_1331615
808 Ga0501039_0332356
809 Ga0501040_0091192
810 Ga0501041_0070063
811 Ga0501042_0348195
812 Ga0501043_0127660
813 Ga0501046_0100008
814 Ga0501048_0556245
815 Ga0501048_1220442
816 Ga0501048_1284714
817 Ga0501070_0111984
818 Ga0501070_0340783
819 Ga0501070_1309049
820 Ga0501070_1366969
821 Ga0501071_0349199
822 Ga0501071_1371874
823 Ga0501072_0818877
824 Ga0501072_0858012
825 Ga0501075_0352547
826 Ga0501075_0717967
827 Ga0501076_0033897
828 Ga0501076_1245205
829 Ga0501079_0196358
830 Ga0501080_0794895
831 Ga0501081_0779044
832 Ga0501081_1129342
833 Ga0501044_0106401
834 Ga0501044_0408574
835 Ga0501044_1527258
836 Ga0501045_0054388
837 Ga0501045_1364048
838 nmdc:mga00v17_366304_c1
839 nmdc:mga0yw44_432657_c1
840 nmdc:mga05p37_2067155_c1
841 nmdc:mga05p37_473304_c1
842 nmdc:mga09592_316007_c1
843 nmdc:mga09592_741717_c1
844 nmdc:mga06r32_555771_c1
845 nmdc:mga06r32_773602_c1
846 nmdc:mga06r32_951283_c1
847 nmdc:mga08y16_27766_c1
848 nmdc:mga0n895_1048627_c1
849 nmdc:mga08x19_1120666_c1
850 Ga0495601_0038025
851 Ga0495601_0939436
852 Ga0495595_0041762
853 Ga0495595_0108246
854 Ga0495619_0003260
855 Ga0495619_0236688
856 Ga0495619_0571255
857 Ga0501084_0078817
858 Ga0501084_0487566
859 Ga0501084_0635062
860 Ga0501084_0850645
861 Ga0501084_1285523
862 Ga0587088_174233
863 Ga0587079_244364
864 Ga0530510_0019853
865 Ga0530510_0067266
866 Ga0530510_0181656
867 Ga0530510_0530687
868 Ga0530510_0567533
869 Ga0530510_1350414
870 2673163232

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

25

121

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7s5c-assembly1.cif.gz_G m. xanthus ferritin-like protein encb 0.8494 10 54
2rbd-assembly1.cif.gz_A crystal structure of a putative spore coat protein (bh2358) from bacillus halodurans c-125 at 1.54 a resolution 0.8127 10 51
1mft-assembly1.cif.gz_B crystal structure of four-helix bundle model 0.7824 10 49
4he8-assembly1.cif.gz_K crystal structure of the membrane domain of respiratory complex i from thermus thermophilus 0.78 12 76
7s5c-assembly1.cif.gz_J m. xanthus ferritin-like protein encb 0.7721 7 54
ID Description Score Start End Superfamily
af_G5ECU8_16_433_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9321 8 55 1.20.1250.20
af_F1M1C9_4_290_1.50.10.10 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase; 0.8984 9 50 1.50.10.10
af_Q13286_94_435_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8848 8 55 1.20.1250.20
af_P31126_1_382_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8587 8 51 1.20.1250.20
af_P0A6E6_91_134_1.20.5.440 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;ATP synthase delta/epsilon subunit, C-terminal domain 0.8521 14 53 1.20.5.440
ID Description Score Start End GO Terms
AF-A0A3B8RRR6-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK 0.9902 5 56 GO:0016651
GO:0030964
GO:0042773
AF-A0A0C2S616-F1-model_v4 Uncharacterized protein 0.9827 10 54 GO:0016020
AF-A0A535NFT1-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK 0.9771 6 57 GO:0016020
AF-X1AV25-F1-model_v4 NADH-quinone oxidoreductase subunit K 0.9708 6 56 GO:0016020
AF-A0A7C7GYQ1-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK (EC 1.6.5.11) 0.9501 6 55 GO:0016020
GO:0016491

Map