F443333

General Info

Members Datasets Scaffolds Average Seq Length
435 279 870 256

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10049406|Ga0163162_100494063
Length 290
Sequence MKKPVPSFTDVVPLPGNRLYQQKSVFDEEGTSVMNMSFEGRKVVVVGGSSGMGLAAAHQVILGGGTAVITGRDEDRVQAAVDALSKNGKAWGITAELTDRDQVPEVRKLLAAEHADATLLVNAAGFFIPKPFSEYDEAFYDSYNELNRALFFITQTVVAGLVAGGQGGAIVSIGSMWAHQGIAATPHSGYSVQKGGLHSLTKALAIELAPHRIRVNAVAPAVVKSPLYLRFVEQDKFDETVDSFASFHPLGRIGQPEDVANAVSFLLSDKSGWMTGAIVDVDGGIMAGRN

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
39 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
40 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
91 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
146 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
159 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
160 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
161 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
164 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
168 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
172 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
175 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
176 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
177 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
178 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
179 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
180 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
181 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
182 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
183 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
184 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
185 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
197 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
205 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
206 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
207 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
208 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
216 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
220 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
221 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
227 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
230 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
238 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
239 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
240 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
247 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
248 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
254 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
258 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
259 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
260 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
261 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
262 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
266 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
267 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
268 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
269 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
270 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
274 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
275 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
276 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
277 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
278 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
279 2996221748 Micromonospora veneta CAP181 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.55
Metatranscriptomes 2.07
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.37
Nodule 0
Rhizoplane 10.34
Rhizosphere 82.99
Stem 0
Stem Tuber 0
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10049406 3300013306 Bacteria 4216
2 JGI24737J22298_10001370 3300001990 Bacteria 8643
3 JGI24735J21928_10084983 3300002067 Bacteria 906
4 JGI24751J29686_10009157 3300002459 Bacteria 2033
5 JGI25404J52841_10002201 3300003659 Bacteria 3650
6 Ga0070658_10045448 3300005327 Bacteria 3551
7 Ga0070683_100091209 3300005329 Bacteria 2861
8 Ga0070683_100145868 3300005329 Bacteria 2242
9 Ga0070670_100121950 3300005331 Bacteria 2248
10 Ga0068869_100005184 3300005334 Bacteria 8182
11 Ga0070666_10250490 3300005335 Bacteria 1254
12 Ga0070680_100100051 3300005336 Bacteria 2406
13 Ga0070682_100001358 3300005337 Bacteria 13814
14 Ga0068868_100037749 3300005338 Bacteria 3746
15 Ga0068868_100063601 3300005338 Bacteria 2927
16 Ga0070660_100081376 3300005339 Bacteria 2542
17 Ga0070661_100005817 3300005344 Bacteria 8480
18 Ga0070692_10005754 3300005345 Bacteria 5324
19 Ga0070675_100012141 3300005354 Bacteria 6755
20 Ga0070671_100001381 3300005355 Bacteria 18135
21 Ga0070674_100052988 3300005356 Bacteria 2800
22 Ga0070667_100048594 3300005367 Bacteria 3571
23 Ga0070667_100251803 3300005367 Bacteria 1579
24 Ga0070714_100057782 3300005435 Bacteria 3321
25 Ga0070714_100093784 3300005435 Bacteria 2633
26 Ga0070714_100221051 3300005435 Bacteria 1740
27 Ga0070713_100228806 3300005436 Bacteria 1689
28 Ga0070711_100452740 3300005439 Bacteria 1051
29 Ga0070663_100022845 3300005455 Bacteria 4185
30 Ga0070678_100002075 3300005456 Bacteria 10873
31 Ga0070678_100214586 3300005456 Bacteria 1597
32 Ga0070681_10063054 3300005458 Bacteria 3679
33 Ga0070698_100291469 3300005471 Bacteria 1563
34 Ga0070699_100033474 3300005518 Bacteria 4440
35 Ga0070679_100026167 3300005530 Bacteria 5728
36 Ga0070679_100098476 3300005530 Bacteria 2912
37 Ga0070684_100182287 3300005535 Bacteria 1909
38 Ga0070684_100590281 3300005535 Bacteria 1032
39 Ga0068853_100060054 3300005539 Bacteria 3284
40 Ga0070672_100052855 3300005543 Bacteria 3174
41 Ga0070693_100001381 3300005547 Bacteria 10947
42 Ga0070665_100053816 3300005548 Bacteria 4037
43 Ga0068855_100628985 3300005563 Bacteria 1155
44 Ga0070664_100029820 3300005564 Bacteria 4548
45 Ga0070664_100300431 3300005564 Bacteria 1450
46 Ga0068857_100032306 3300005577 Bacteria 4628
47 Ga0068857_100066550 3300005577 Bacteria 3206
48 Ga0068857_100081074 3300005577 Bacteria 2898
49 Ga0068857_100178559 3300005577 Bacteria 1932
50 Ga0068854_100069495 3300005578 Bacteria 2571
51 Ga0068856_100032884 3300005614 Bacteria 5079
52 Ga0068856_100701308 3300005614 Bacteria 1032
53 Ga0070702_100371693 3300005615 Bacteria 1014
54 Ga0068852_100023281 3300005616 Bacteria 4983
55 Ga0068864_100033615 3300005618 Bacteria 4360
56 Ga0068866_10344111 3300005718 Bacteria 945
57 Ga0068861_100576794 3300005719 Bacteria 1029
58 Ga0068870_10256339 3300005840 Bacteria 1086
59 Ga0068863_100002961 3300005841 Bacteria 16789
60 Ga0068863_100302017 3300005841 Bacteria 1553
61 Ga0068858_100088062 3300005842 Bacteria 2888
62 Ga0068860_100095317 3300005843 Bacteria 2837
63 Ga0081455_10022464 3300005937 Bacteria 5895
64 Ga0081455_10053374 3300005937 Bacteria 3453
65 Ga0081455_10064856 3300005937 Bacteria 3057
66 Ga0081455_10173251 3300005937 Bacteria 1641
67 Ga0081538_10062315 3300005981 Bacteria 2128
68 Ga0081540_1000033 3300005983 Bacteria 142902
69 Ga0081540_1000793 3300005983 Bacteria 29004
70 Ga0081540_1009233 3300005983 Bacteria 6802
71 Ga0070717_10078394 3300006028 Bacteria 2768
72 Ga0075365_10073801 3300006038 Bacteria 2300
73 Ga0075363_100014859 3300006048 Bacteria 3816
74 Ga0075364_10163500 3300006051 Bacteria 1503
75 Ga0075364_10451191 3300006051 Bacteria 878
76 Ga0070715_10073680 3300006163 Bacteria 1532
77 Ga0070716_100251393 3300006173 Bacteria 1204
78 Ga0070716_100311820 3300006173 Bacteria 1099
79 Ga0070712_100071743 3300006175 Bacteria 2479
80 Ga0070712_100085837 3300006175 Bacteria 2292
81 Ga0097621_100032098 3300006237 Bacteria 4173
82 Ga0075370_10003068 3300006353 Bacteria 7879
83 Ga0075370_10009101 3300006353 Bacteria 5138
84 Ga0075370_10089584 3300006353 Bacteria 1774
85 Ga0075370_10108887 3300006353 Bacteria 1608
86 Ga0068871_100015317 3300006358 Bacteria 5735
87 Ga0075433_10042328 3300006852 Bacteria 3951
88 Ga0075433_10148894 3300006852 Bacteria 2082
89 Ga0075434_100002318 3300006871 Bacteria 16672
90 Ga0068865_100264893 3300006881 Bacteria 1362
91 Ga0075436_100001918 3300006914 Bacteria 14277
92 Ga0075435_100003546 3300007076 Bacteria 10597
93 Ga0105251_10019025 3300009011 Bacteria 3637
94 Ga0105240_10133112 3300009093 Bacteria 2980
95 Ga0111539_10081026 3300009094 Bacteria 3818
96 Ga0105245_10012452 3300009098 Bacteria 7401
97 Ga0105247_10018600 3300009101 Bacteria 4169
98 Ga0105247_10051211 3300009101 Bacteria 2542
99 Ga0105243_10268508 3300009148 Bacteria 1531
100 Ga0105241_10001502 3300009174 Bacteria 17895
101 Ga0105241_10039730 3300009174 Bacteria 3550
102 Ga0105248_10030032 3300009177 Bacteria 6066
103 Ga0105237_10639871 3300009545 Bacteria 1070
104 Ga0105238_10046427 3300009551 Bacteria 4384
105 Ga0105239_10676078 3300010375 Bacteria 1180
106 Ga0105239_11097245 3300010375 Bacteria 916
107 Ga0105246_10010488 3300011119 Bacteria 5735
108 Ga0157373_10061251 3300013100 Bacteria 2665
109 Ga0157371_10016118 3300013102 Bacteria 5587
110 Ga0157370_10005437 3300013104 Bacteria 14291
111 Ga0157370_10060045 3300013104 Bacteria 3611
112 Ga0157369_10017661 3300013105 Bacteria 8015
113 Ga0157369_10044737 3300013105 Bacteria 4817
114 Ga0157369_10102409 3300013105 Bacteria 3051
115 Ga0157374_10019944 3300013296 Bacteria 5943
116 Ga0157374_10507019 3300013296 Bacteria 1211
117 Ga0163162_10018548 3300013306 Bacteria 6818
118 Ga0163162_10055654 3300013306 Bacteria 3984
119 Ga0163162_10137488 3300013306 Bacteria 2555
120 Ga0163162_10738159 3300013306 Bacteria 1104
121 Ga0157372_10035103 3300013307 Bacteria 5518
122 Ga0157372_10199807 3300013307 Bacteria 2316
123 Ga0163163_10026035 3300014325 Bacteria 5586
124 Ga0163163_10150862 3300014325 Bacteria 2368
125 Ga0163163_10170760 3300014325 Bacteria 2221
126 Ga0157377_10010168 3300014745 Bacteria 4644
127 Ga0157379_10069892 3300014968 Bacteria 3141
128 Ga0157376_10027975 3300014969 Bacteria 4476
129 Ga0157376_10080645 3300014969 Bacteria 2792
130 Ga0163161_10232291 3300017792 Bacteria 1432
131 Ga0206355_1426634 3300020076 Bacteria 1516
132 Ga0206352_10397789 3300020078 Bacteria 2487
133 Ga0206354_10414378 3300020081 Bacteria 1214
134 Ga0206353_10350220 3300020082 Bacteria 929
135 Ga0206353_10847698 3300020082 Bacteria 3983
136 Ga0213871_10019273 3300021441 Bacteria 1678
137 Ga0224712_10075257 3300022467 Bacteria 1381
138 Ga0207713_1028082 3300025735 Bacteria 2543
139 Ga0207692_10002907 3300025898 Bacteria 6629
140 Ga0207710_10029468 3300025900 Bacteria 2389
141 Ga0207688_10005981 3300025901 Bacteria 6620
142 Ga0207688_10056125 3300025901 Bacteria 2212
143 Ga0207688_10416849 3300025901 Bacteria 834
144 Ga0207680_10236764 3300025903 Bacteria 1256
145 Ga0207647_10006219 3300025904 Bacteria 8702
146 Ga0207647_10082659 3300025904 Bacteria 1924
147 Ga0207647_10086039 3300025904 Bacteria 1879
148 Ga0207685_10009528 3300025905 Bacteria 2826
149 Ga0207699_10002126 3300025906 Bacteria 9366
150 Ga0207643_10000287 3300025908 Bacteria 35066
151 Ga0207705_10034756 3300025909 Bacteria 3605
152 Ga0207654_10026279 3300025911 Bacteria 3150
153 Ga0207654_10033589 3300025911 Bacteria 2845
154 Ga0207707_10056216 3300025912 Bacteria 3423
155 Ga0207707_10275830 3300025912 Bacteria 1457
156 Ga0207671_10256946 3300025914 Bacteria 1374
157 Ga0207693_10059215 3300025915 Bacteria 3000
158 Ga0207693_10090126 3300025915 Bacteria 2404
159 Ga0207663_10000908 3300025916 Bacteria 13528
160 Ga0207660_10038320 3300025917 Bacteria 3345
161 Ga0207649_10052212 3300025920 Bacteria 2535
162 Ga0207652_10022348 3300025921 Bacteria 5232
163 Ga0207652_10185680 3300025921 Bacteria 1869
164 Ga0207694_10048948 3300025924 Bacteria 3271
165 Ga0207650_10001725 3300025925 Bacteria 15544
166 Ga0207659_10009692 3300025926 Bacteria 6023
167 Ga0207687_10398102 3300025927 Bacteria 1132
168 Ga0207700_10002019 3300025928 Bacteria 11599
169 Ga0207700_10824771 3300025928 Bacteria 830
170 Ga0207664_10004787 3300025929 Bacteria 9200
171 Ga0207664_10016712 3300025929 Bacteria 5359
172 Ga0207664_10064712 3300025929 Bacteria 2926
173 Ga0207664_10130927 3300025929 Bacteria 2112
174 Ga0207664_10336352 3300025929 Bacteria 1334
175 Ga0207664_10386457 3300025929 Bacteria 1243
176 Ga0207644_10002744 3300025931 Bacteria 11335
177 Ga0207706_10370942 3300025933 Bacteria 1243
178 Ga0207706_10489920 3300025933 Bacteria 1062
179 Ga0207709_10160198 3300025935 Bacteria 1568
180 Ga0207670_10483206 3300025936 Bacteria 1003
181 Ga0207669_10142507 3300025937 Bacteria 1666
182 Ga0207669_10188675 3300025937 Bacteria 1485
183 Ga0207704_10100654 3300025938 Bacteria 1926
184 Ga0207665_10007719 3300025939 Bacteria 7101
185 Ga0207665_10127336 3300025939 Bacteria 1804
186 Ga0207691_10152595 3300025940 Bacteria 2030
187 Ga0207689_10010177 3300025942 Bacteria 8104
188 Ga0207661_10001410 3300025944 Bacteria 16200
189 Ga0207661_10013125 3300025944 Bacteria 6045
190 Ga0207661_10088989 3300025944 Bacteria 2567
191 Ga0207661_10188558 3300025944 Bacteria 1806
192 Ga0207679_10026236 3300025945 Bacteria 4016
193 Ga0207679_10081234 3300025945 Bacteria 2478
194 Ga0207679_10557285 3300025945 Bacteria 1029
195 Ga0207667_10116308 3300025949 Bacteria 2755
196 Ga0207667_10455520 3300025949 Bacteria 1300
197 Ga0207668_10123887 3300025972 Bacteria 1962
198 Ga0207658_10158941 3300025986 Bacteria 1850
199 Ga0207658_10261191 3300025986 Bacteria 1476
200 Ga0207677_10014805 3300026023 Bacteria 4568
201 Ga0207677_10172195 3300026023 Bacteria 1694
202 Ga0207677_10257229 3300026023 Bacteria 1421
203 Ga0207703_10251693 3300026035 Bacteria 1593
204 Ga0207678_10001979 3300026067 Bacteria 18674
205 Ga0207678_10102640 3300026067 Bacteria 2441
206 Ga0207678_10140243 3300026067 Bacteria 2063
207 Ga0207708_10368283 3300026075 Bacteria 1182
208 Ga0207702_10015957 3300026078 Bacteria 6218
209 Ga0207702_10227654 3300026078 Bacteria 1741
210 Ga0207641_10014565 3300026088 Bacteria 6446
211 Ga0207676_10018488 3300026095 Bacteria 5066
212 Ga0207676_10377898 3300026095 Bacteria 1318
213 Ga0207674_10078960 3300026116 Bacteria 3296
214 Ga0207674_10117235 3300026116 Bacteria 2633
215 Ga0207674_10187813 3300026116 Bacteria 2017
216 Ga0207675_100237625 3300026118 Bacteria 1760
217 Ga0207683_10007800 3300026121 Bacteria 9159
218 Ga0207683_10151209 3300026121 Bacteria 2095
219 Ga0207698_10030993 3300026142 Bacteria 3855
220 Ga0207428_10047244 3300027907 Bacteria 3457
221 Ga0207428_10198749 3300027907 Bacteria 1509
222 Ga0268266_10392052 3300028379 Bacteria 1312
223 Ga0268266_10516799 3300028379 Bacteria 1141
224 Ga0268266_10739751 3300028379 Bacteria 949
225 Ga0268264_10206345 3300028381 Bacteria 1801
226 Ga0307513_10061641 3300031456 Bacteria 3970
227 Ga0307408_100136392 3300031548 Bacteria 1920
228 Ga0307413_10057681 3300031824 Bacteria 2376
229 Ga0307410_10058512 3300031852 Bacteria 2628
230 Ga0307406_10031231 3300031901 Bacteria 3241
231 Ga0307412_10266605 3300031911 Bacteria 1338
232 Ga0307409_100030429 3300031995 Bacteria 3878
233 Ga0307416_100019432 3300032002 Bacteria 4817
234 Ga0307414_10037736 3300032004 Bacteria 3238
235 Ga0307411_10040591 3300032005 Bacteria 2953
236 Ga0307415_100031292 3300032126 Bacteria 3426
237 Ga0307415_100050600 3300032126 Bacteria 2816
238 Ga0373930_0035068 3300034816 Bacteria 1048
239 Ga0373940_0005339 3300035088 Bacteria 2776
240 Ga0373951_0019755 3300035091 Bacteria 1538
241 Ga0373939_0004186 3300035114 Bacteria 3401
242 Ga0373941_0062245 3300035115 Bacteria 1217
243 Ga0373960_0045903 3300035121 Bacteria 1280
244 Ga0373931_0009058 3300035691 Bacteria 4745
245 Ga0373925_0000042 3300037068 Bacteria 135547
246 Ga0395900_0011367 3300037418 Bacteria 9108
247 Ga0395900_0296349 3300037418 Bacteria 1605
248 Ga0395898_0004678 3300037466 Bacteria 14915
249 Ga0395898_0019098 3300037466 Bacteria 6978
250 Ga0395898_0086208 3300037466 Bacteria 3027
251 Ga0395898_0226628 3300037466 Bacteria 1783
252 Ga0395905_0157341 3300037471 Bacteria 2137
253 Ga0395901_0016578 3300038443 Bacteria 7508
254 Ga0395901_0305302 3300038443 Bacteria 1649
255 Ga0436365_1401488 3300039437 Bacteria 12306
256 Ga0436360_0563847 3300039438 Bacteria 4263
257 Ga0436361_0332624 3300039447 Unclassified 1274
258 Ga0436361_0913121 3300039447 Unclassified 1574
259 Ga0451843_1218357 3300041509 Bacteria 922
260 Ga0439437_001210 3300042000 Bacteria 2709
261 Ga0439448_0034324 3300042005 Bacteria 1621
262 Ga0439463_020160 3300042016 Bacteria 1662
263 Ga0450917_000004 3300042120 Bacteria 9152
264 Ga0450888_000073 3300042126 Bacteria 7606
265 Ga0450891_001258 3300042129 Bacteria 2636
266 Ga0450903_017428 3300042138 Bacteria 1122
267 Ga0450889_001472 3300042144 Bacteria 2430
268 Ga0439459_0055664 3300042438 Bacteria 881
269 Ga0450916_009412 3300042530 Bacteria 1206
270 Ga0450893_0004857 3300042532 Bacteria 2147
271 Ga0466969_0093868 3300044656 Bacteria 1419
272 Ga0466972_0018217 3300044658 Bacteria 3513
273 Ga0466972_0025173 3300044658 Bacteria 2952
274 Ga0466972_0134804 3300044658 Bacteria 1163
275 Ga0466965_0002639 3300044683 Bacteria 7675
276 Ga0466965_0006145 3300044683 Bacteria 5430
277 Ga0466963_0003592 3300044694 Bacteria 8914
278 Ga0466963_0017584 3300044694 Bacteria 4459
279 Ga0466963_0025449 3300044694 Bacteria 3775
280 Ga0466963_0102694 3300044694 Bacteria 1958
281 Ga0466963_0137045 3300044694 Bacteria 1694
282 Ga0466963_0159116 3300044694 Bacteria 1571
283 Ga0466963_0332289 3300044694 Bacteria 1070
284 Ga0466968_0002420 3300044735 Bacteria 6846
285 Ga0466957_0005094 3300044842 Bacteria 7350
286 Ga0466957_0423457 3300044842 Bacteria 914
287 Ga0466960_0000143 3300044901 Bacteria 24441
288 Ga0466960_0001149 3300044901 Bacteria 9507
289 Ga0466960_0004690 3300044901 Bacteria 5362
290 Ga0466960_0008088 3300044901 Bacteria 4296
291 Ga0466960_0022700 3300044901 Bacteria 2809
292 Ga0466960_0032324 3300044901 Bacteria 2422
293 Ga0466959_0014745 3300045049 Bacteria 5690
294 Ga0466958_0118809 3300045836 Bacteria 1654
295 Ga0466967_0001755 3300045976 Bacteria 12955
296 Ga0466967_0005540 3300045976 Bacteria 8764
297 Ga0466967_0008199 3300045976 Bacteria 7631
298 Ga0466967_0094593 3300045976 Bacteria 2721
299 Ga0466967_0505498 3300045976 Bacteria 1186
300 Ga0495629_0018174 3300046459 Bacteria 5037
301 Ga0495629_0281893 3300046459 Bacteria 1140
302 Ga0495651_0112901 3300046462 Bacteria 2007
303 Ga0495580_0111790 3300046472 Unclassified 1897
304 Ga0495639_0064256 3300046475 Bacteria 1686
305 Ga0495662_0006694 3300046476 Bacteria 5744
306 Ga0495664_0000141 3300046477 Bacteria 36021
307 Ga0495594_0034245 3300046499 Bacteria 2762
308 Ga0495594_0086927 3300046499 Bacteria 1749
309 Ga0495607_0121032 3300046501 Unclassified 1374
310 Ga0495630_0090112 3300046517 Bacteria 2317
311 Ga0495644_0000460 3300046523 Bacteria 17632
312 Ga0495648_0001466 3300046524 Bacteria 23072
313 Ga0495648_0019135 3300046524 Bacteria 4826
314 Ga0495666_0037079 3300046526 Bacteria 2372
315 Ga0495642_0020520 3300046528 Bacteria 2596
316 Ga0495652_0062176 3300046529 Bacteria 3149
317 Ga0495665_0000412 3300046531 Bacteria 21894
318 Ga0495640_0045658 3300046533 Bacteria 3039
319 Ga0495586_0024322 3300046535 Bacteria 3238
320 Ga0495609_0038727 3300046538 Unclassified 2148
321 Ga0495609_0113619 3300046538 Bacteria 1167
322 Ga0495609_0187879 3300046538 Bacteria 868
323 Ga0495667_0034422 3300046559 Bacteria 3388
324 Ga0495634_0012778 3300046642 Bacteria 6078
325 Ga0495625_0018353 3300046660 Bacteria 5464
326 Ga0495635_0010683 3300046663 Bacteria 6427
327 Ga0495646_0005617 3300046680 Bacteria 7936
328 Ga0495669_0004760 3300046684 Bacteria 5628
329 Ga0495613_0001270 3300046689 Bacteria 19252
330 Ga0495613_0040399 3300046689 Bacteria 3457
331 Ga0495624_0025159 3300046690 Bacteria 3912
332 Ga0495600_0001125 3300046809 Bacteria 14586
333 Ga0495581_0000332 3300047315 Bacteria 23453
334 Ga0495604_0013604 3300047317 Bacteria 6490
335 Ga0495674_0041562 3300047319 Bacteria 4106
336 Ga0495674_0303503 3300047319 Bacteria 1304
337 Ga0495672_0007102 3300047320 Bacteria 8491
338 Ga0495672_0013374 3300047320 Bacteria 5666
339 Ga0495672_0019007 3300047320 Bacteria 4544
340 Ga0495676_0013151 3300047321 Bacteria 7443
341 Ga0495675_0028328 3300047444 Bacteria 3571
342 Ga0495677_0154217 3300047445 Bacteria 885
343 Ga0495673_0002107 3300047469 Bacteria 14477
344 Ga0495673_0004511 3300047469 Bacteria 8693
345 Ga0495684_0167327 3300047471 Bacteria 1637
346 Ga0495614_0003523 3300048089 Bacteria 7011
347 Ga0496100_0009669 3300048903 Bacteria 5423
348 Ga0496100_0011066 3300048903 Bacteria 5120
349 Ga0496100_0040917 3300048903 Bacteria 2952
350 Ga0496100_0118295 3300048903 Bacteria 1851
351 Ga0496101_0023901 3300048904 Bacteria 4225
352 Ga0496101_0092098 3300048904 Bacteria 2257
353 Ga0496102_0007002 3300048905 Bacteria 9627
354 Ga0496102_0040147 3300048905 Bacteria 4232
355 Ga0496102_0246443 3300048905 Bacteria 1685
356 Ga0496102_0617966 3300048905 Bacteria 1007
357 Ga0496102_0649177 3300048905 Bacteria 978
358 Ga0496103_0335093 3300048906 Bacteria 973
359 Ga0496104_0005320 3300048907 Bacteria 11262
360 Ga0496104_0026346 3300048907 Bacteria 5367
361 Ga0496104_0069917 3300048907 Bacteria 3337
362 Ga0496105_0007312 3300048908 Bacteria 8530
363 Ga0496105_0007748 3300048908 Bacteria 8332
364 Ga0496105_0214727 3300048908 Bacteria 1567
365 Ga0496105_0648428 3300048908 Bacteria 815
366 Ga0496106_0006649 3300048909 Bacteria 8560
367 Ga0496106_0017453 3300048909 Bacteria 5311
368 Ga0496106_0024970 3300048909 Bacteria 4445
369 Ga0496107_0038061 3300048910 Bacteria 3453
370 Ga0496107_0050147 3300048910 Bacteria 3008
371 Ga0496107_0071728 3300048910 Bacteria 2517
372 Ga0496108_0018519 3300048911 Bacteria 5702
373 Ga0496108_0045108 3300048911 Bacteria 3681
374 Ga0496109_0062462 3300048912 Bacteria 3406
375 Ga0496109_0227957 3300048912 Bacteria 1752
376 Ga0496110_0002653 3300048913 Bacteria 13491
377 Ga0496110_0032907 3300048913 Bacteria 4482
378 Ga0496111_0020438 3300048914 Bacteria 4609
379 Ga0496111_0087910 3300048914 Bacteria 2275
380 Ga0496112_0027035 3300048915 Bacteria 5530
381 Ga0496112_0119438 3300048915 Bacteria 2606
382 Ga0496112_0202186 3300048915 Bacteria 1946
383 Ga0496113_0003323 3300048916 Bacteria 9605
384 Ga0496113_0021597 3300048916 Bacteria 4542
385 Ga0496114_0004195 3300048917 Bacteria 11164
386 Ga0496114_0020449 3300048917 Bacteria 5373
387 Ga0496114_0647852 3300048917 Bacteria 929
388 Ga0496115_0005845 3300048918 Bacteria 8962
389 Ga0496115_0068262 3300048918 Bacteria 2878
390 Ga0496115_0259612 3300048918 Bacteria 1429
391 Ga0496115_0690392 3300048918 Bacteria 803
392 Ga0496126_0027581 3300048929 Bacteria 5422
393 Ga0496126_0075039 3300048929 Bacteria 3002
394 Ga0501034_0279219 3300049571 Bacteria 1610
395 Ga0501034_0570052 3300049571 Bacteria 1040
396 Ga0501038_0169154 3300049574 Bacteria 1771
397 Ga0501042_0231154 3300049578 Bacteria 1334
398 Ga0501069_0051059 3300049585 Bacteria 2301
399 Ga0501227_012647 3300049665 Bacteria 1850
400 Ga0501081_0060927 3300049743 Bacteria 2616
401 Ga0501044_0166152 3300049823 Bacteria 2181
402 nmdc:mga03n38_3266_c1 3300050490 Bacteria 5180
403 nmdc:mga03n38_594_c1 3300050490 Bacteria 9214
404 nmdc:mga00v17_148926_c1 3300050491 Bacteria 1503
405 nmdc:mga0yw44_79909_c1 3300050492 Bacteria 2047
406 nmdc:mga06z11_282545_c1 3300050494 Bacteria 983
407 nmdc:mga07m45_164130_c1 3300050496 Bacteria 1290
408 nmdc:mga07m45_20611_c1 3300050496 Bacteria 3582
409 nmdc:mga07m45_62944_c1 3300050496 Bacteria 2103
410 nmdc:mga05p37_556083_c1 3300050507 Bacteria 1305
411 nmdc:mga08y16_10682_c1 3300050511 Bacteria 9637
412 nmdc:mga08y16_239922_c1 3300050511 Bacteria 1874
413 nmdc:mga0n895_327310_c1 3300050512 Bacteria 1553
414 nmdc:mga0n895_49432_c1 3300050512 Bacteria 4120
415 nmdc:mga0rr50_28186_c1 3300050513 Bacteria 3945
416 nmdc:mga0rr50_68489_c1 3300050513 Bacteria 2699
417 nmdc:mga08x19_1613_c1 3300050514 Bacteria 13993
418 nmdc:mga08x19_76356_c1 3300050514 Bacteria 2192
419 nmdc:mga0a205_141730_c1 3300050515 Bacteria 2304
420 nmdc:mga0a205_29507_c1 3300050515 Bacteria 5249
421 Ga0500643_004026 3300053087 Bacteria 6789
422 Ga0500643_004771 3300053087 Bacteria 6008
423 Ga0500645_000046 3300053730 Bacteria 106127
424 Ga0587083_0016961 3300059505 Bacteria 1296
425 Ga0587088_012084 3300059508 Bacteria 1300
426 Ga0587078_012193 3300059646 Bacteria 1006
427 Ga0466962_0021496 3300061719 Bacteria 3098
428 Ga0466962_0027630 3300061719 Bacteria 2722
429 Ga0466962_0048716 3300061719 Bacteria 2025
430 2623589303 2622736626 Bacteria 7181580
431 2643746393 2643221544 Bacteria 5886209
432 2867314711 2867312974 Bacteria 7058875
433 2867322273 2867319477 Bacteria 7069771
434 2902793051 2902792274 Bacteria 7270173
435 2996223176 2996221748 Bacteria 6799777
436 Ga0163162_10049406
437 JGI24737J22298_10001370
438 JGI24735J21928_10084983
439 JGI24751J29686_10009157
440 JGI25404J52841_10002201
441 Ga0070658_10045448
442 Ga0070683_100091209
443 Ga0070683_100145868
444 Ga0070670_100121950
445 Ga0068869_100005184
446 Ga0070666_10250490
447 Ga0070680_100100051
448 Ga0070682_100001358
449 Ga0068868_100037749
450 Ga0068868_100063601
451 Ga0070660_100081376
452 Ga0070661_100005817
453 Ga0070692_10005754
454 Ga0070675_100012141
455 Ga0070671_100001381
456 Ga0070674_100052988
457 Ga0070667_100048594
458 Ga0070667_100251803
459 Ga0070714_100057782
460 Ga0070714_100093784
461 Ga0070714_100221051
462 Ga0070713_100228806
463 Ga0070711_100452740
464 Ga0070663_100022845
465 Ga0070678_100002075
466 Ga0070678_100214586
467 Ga0070681_10063054
468 Ga0070698_100291469
469 Ga0070699_100033474
470 Ga0070679_100026167
471 Ga0070679_100098476
472 Ga0070684_100182287
473 Ga0070684_100590281
474 Ga0068853_100060054
475 Ga0070672_100052855
476 Ga0070693_100001381
477 Ga0070665_100053816
478 Ga0068855_100628985
479 Ga0070664_100029820
480 Ga0070664_100300431
481 Ga0068857_100032306
482 Ga0068857_100066550
483 Ga0068857_100081074
484 Ga0068857_100178559
485 Ga0068854_100069495
486 Ga0068856_100032884
487 Ga0068856_100701308
488 Ga0070702_100371693
489 Ga0068852_100023281
490 Ga0068864_100033615
491 Ga0068866_10344111
492 Ga0068861_100576794
493 Ga0068870_10256339
494 Ga0068863_100002961
495 Ga0068863_100302017
496 Ga0068858_100088062
497 Ga0068860_100095317
498 Ga0081455_10022464
499 Ga0081455_10053374
500 Ga0081455_10064856
501 Ga0081455_10173251
502 Ga0081538_10062315
503 Ga0081540_1000033
504 Ga0081540_1000793
505 Ga0081540_1009233
506 Ga0070717_10078394
507 Ga0075365_10073801
508 Ga0075363_100014859
509 Ga0075364_10163500
510 Ga0075364_10451191
511 Ga0070715_10073680
512 Ga0070716_100251393
513 Ga0070716_100311820
514 Ga0070712_100071743
515 Ga0070712_100085837
516 Ga0097621_100032098
517 Ga0075370_10003068
518 Ga0075370_10009101
519 Ga0075370_10089584
520 Ga0075370_10108887
521 Ga0068871_100015317
522 Ga0075433_10042328
523 Ga0075433_10148894
524 Ga0075434_100002318
525 Ga0068865_100264893
526 Ga0075436_100001918
527 Ga0075435_100003546
528 Ga0105251_10019025
529 Ga0105240_10133112
530 Ga0111539_10081026
531 Ga0105245_10012452
532 Ga0105247_10018600
533 Ga0105247_10051211
534 Ga0105243_10268508
535 Ga0105241_10001502
536 Ga0105241_10039730
537 Ga0105248_10030032
538 Ga0105237_10639871
539 Ga0105238_10046427
540 Ga0105239_10676078
541 Ga0105239_11097245
542 Ga0105246_10010488
543 Ga0157373_10061251
544 Ga0157371_10016118
545 Ga0157370_10005437
546 Ga0157370_10060045
547 Ga0157369_10017661
548 Ga0157369_10044737
549 Ga0157369_10102409
550 Ga0157374_10019944
551 Ga0157374_10507019
552 Ga0163162_10018548
553 Ga0163162_10055654
554 Ga0163162_10137488
555 Ga0163162_10738159
556 Ga0157372_10035103
557 Ga0157372_10199807
558 Ga0163163_10026035
559 Ga0163163_10150862
560 Ga0163163_10170760
561 Ga0157377_10010168
562 Ga0157379_10069892
563 Ga0157376_10027975
564 Ga0157376_10080645
565 Ga0163161_10232291
566 Ga0206355_1426634
567 Ga0206352_10397789
568 Ga0206354_10414378
569 Ga0206353_10350220
570 Ga0206353_10847698
571 Ga0213871_10019273
572 Ga0224712_10075257
573 Ga0207713_1028082
574 Ga0207692_10002907
575 Ga0207710_10029468
576 Ga0207688_10005981
577 Ga0207688_10056125
578 Ga0207688_10416849
579 Ga0207680_10236764
580 Ga0207647_10006219
581 Ga0207647_10082659
582 Ga0207647_10086039
583 Ga0207685_10009528
584 Ga0207699_10002126
585 Ga0207643_10000287
586 Ga0207705_10034756
587 Ga0207654_10026279
588 Ga0207654_10033589
589 Ga0207707_10056216
590 Ga0207707_10275830
591 Ga0207671_10256946
592 Ga0207693_10059215
593 Ga0207693_10090126
594 Ga0207663_10000908
595 Ga0207660_10038320
596 Ga0207649_10052212
597 Ga0207652_10022348
598 Ga0207652_10185680
599 Ga0207694_10048948
600 Ga0207650_10001725
601 Ga0207659_10009692
602 Ga0207687_10398102
603 Ga0207700_10002019
604 Ga0207700_10824771
605 Ga0207664_10004787
606 Ga0207664_10016712
607 Ga0207664_10064712
608 Ga0207664_10130927
609 Ga0207664_10336352
610 Ga0207664_10386457
611 Ga0207644_10002744
612 Ga0207706_10370942
613 Ga0207706_10489920
614 Ga0207709_10160198
615 Ga0207670_10483206
616 Ga0207669_10142507
617 Ga0207669_10188675
618 Ga0207704_10100654
619 Ga0207665_10007719
620 Ga0207665_10127336
621 Ga0207691_10152595
622 Ga0207689_10010177
623 Ga0207661_10001410
624 Ga0207661_10013125
625 Ga0207661_10088989
626 Ga0207661_10188558
627 Ga0207679_10026236
628 Ga0207679_10081234
629 Ga0207679_10557285
630 Ga0207667_10116308
631 Ga0207667_10455520
632 Ga0207668_10123887
633 Ga0207658_10158941
634 Ga0207658_10261191
635 Ga0207677_10014805
636 Ga0207677_10172195
637 Ga0207677_10257229
638 Ga0207703_10251693
639 Ga0207678_10001979
640 Ga0207678_10102640
641 Ga0207678_10140243
642 Ga0207708_10368283
643 Ga0207702_10015957
644 Ga0207702_10227654
645 Ga0207641_10014565
646 Ga0207676_10018488
647 Ga0207676_10377898
648 Ga0207674_10078960
649 Ga0207674_10117235
650 Ga0207674_10187813
651 Ga0207675_100237625
652 Ga0207683_10007800
653 Ga0207683_10151209
654 Ga0207698_10030993
655 Ga0207428_10047244
656 Ga0207428_10198749
657 Ga0268266_10392052
658 Ga0268266_10516799
659 Ga0268266_10739751
660 Ga0268264_10206345
661 Ga0307513_10061641
662 Ga0307408_100136392
663 Ga0307413_10057681
664 Ga0307410_10058512
665 Ga0307406_10031231
666 Ga0307412_10266605
667 Ga0307409_100030429
668 Ga0307416_100019432
669 Ga0307414_10037736
670 Ga0307411_10040591
671 Ga0307415_100031292
672 Ga0307415_100050600
673 Ga0373930_0035068
674 Ga0373940_0005339
675 Ga0373951_0019755
676 Ga0373939_0004186
677 Ga0373941_0062245
678 Ga0373960_0045903
679 Ga0373931_0009058
680 Ga0373925_0000042
681 Ga0395900_0011367
682 Ga0395900_0296349
683 Ga0395898_0004678
684 Ga0395898_0019098
685 Ga0395898_0086208
686 Ga0395898_0226628
687 Ga0395905_0157341
688 Ga0395901_0016578
689 Ga0395901_0305302
690 Ga0436365_1401488
691 Ga0436360_0563847
692 Ga0436361_0332624
693 Ga0436361_0913121
694 Ga0451843_1218357
695 Ga0439437_001210
696 Ga0439448_0034324
697 Ga0439463_020160
698 Ga0450917_000004
699 Ga0450888_000073
700 Ga0450891_001258
701 Ga0450903_017428
702 Ga0450889_001472
703 Ga0439459_0055664
704 Ga0450916_009412
705 Ga0450893_0004857
706 Ga0466969_0093868
707 Ga0466972_0018217
708 Ga0466972_0025173
709 Ga0466972_0134804
710 Ga0466965_0002639
711 Ga0466965_0006145
712 Ga0466963_0003592
713 Ga0466963_0017584
714 Ga0466963_0025449
715 Ga0466963_0102694
716 Ga0466963_0137045
717 Ga0466963_0159116
718 Ga0466963_0332289
719 Ga0466968_0002420
720 Ga0466957_0005094
721 Ga0466957_0423457
722 Ga0466960_0000143
723 Ga0466960_0001149
724 Ga0466960_0004690
725 Ga0466960_0008088
726 Ga0466960_0022700
727 Ga0466960_0032324
728 Ga0466959_0014745
729 Ga0466958_0118809
730 Ga0466967_0001755
731 Ga0466967_0005540
732 Ga0466967_0008199
733 Ga0466967_0094593
734 Ga0466967_0505498
735 Ga0495629_0018174
736 Ga0495629_0281893
737 Ga0495651_0112901
738 Ga0495580_0111790
739 Ga0495639_0064256
740 Ga0495662_0006694
741 Ga0495664_0000141
742 Ga0495594_0034245
743 Ga0495594_0086927
744 Ga0495607_0121032
745 Ga0495630_0090112
746 Ga0495644_0000460
747 Ga0495648_0001466
748 Ga0495648_0019135
749 Ga0495666_0037079
750 Ga0495642_0020520
751 Ga0495652_0062176
752 Ga0495665_0000412
753 Ga0495640_0045658
754 Ga0495586_0024322
755 Ga0495609_0038727
756 Ga0495609_0113619
757 Ga0495609_0187879
758 Ga0495667_0034422
759 Ga0495634_0012778
760 Ga0495625_0018353
761 Ga0495635_0010683
762 Ga0495646_0005617
763 Ga0495669_0004760
764 Ga0495613_0001270
765 Ga0495613_0040399
766 Ga0495624_0025159
767 Ga0495600_0001125
768 Ga0495581_0000332
769 Ga0495604_0013604
770 Ga0495674_0041562
771 Ga0495674_0303503
772 Ga0495672_0007102
773 Ga0495672_0013374
774 Ga0495672_0019007
775 Ga0495676_0013151
776 Ga0495675_0028328
777 Ga0495677_0154217
778 Ga0495673_0002107
779 Ga0495673_0004511
780 Ga0495684_0167327
781 Ga0495614_0003523
782 Ga0496100_0009669
783 Ga0496100_0011066
784 Ga0496100_0040917
785 Ga0496100_0118295
786 Ga0496101_0023901
787 Ga0496101_0092098
788 Ga0496102_0007002
789 Ga0496102_0040147
790 Ga0496102_0246443
791 Ga0496102_0617966
792 Ga0496102_0649177
793 Ga0496103_0335093
794 Ga0496104_0005320
795 Ga0496104_0026346
796 Ga0496104_0069917
797 Ga0496105_0007312
798 Ga0496105_0007748
799 Ga0496105_0214727
800 Ga0496105_0648428
801 Ga0496106_0006649
802 Ga0496106_0017453
803 Ga0496106_0024970
804 Ga0496107_0038061
805 Ga0496107_0050147
806 Ga0496107_0071728
807 Ga0496108_0018519
808 Ga0496108_0045108
809 Ga0496109_0062462
810 Ga0496109_0227957
811 Ga0496110_0002653
812 Ga0496110_0032907
813 Ga0496111_0020438
814 Ga0496111_0087910
815 Ga0496112_0027035
816 Ga0496112_0119438
817 Ga0496112_0202186
818 Ga0496113_0003323
819 Ga0496113_0021597
820 Ga0496114_0004195
821 Ga0496114_0020449
822 Ga0496114_0647852
823 Ga0496115_0005845
824 Ga0496115_0068262
825 Ga0496115_0259612
826 Ga0496115_0690392
827 Ga0496126_0027581
828 Ga0496126_0075039
829 Ga0501034_0279219
830 Ga0501034_0570052
831 Ga0501038_0169154
832 Ga0501042_0231154
833 Ga0501069_0051059
834 Ga0501227_012647
835 Ga0501081_0060927
836 Ga0501044_0166152
837 nmdc:mga03n38_3266_c1
838 nmdc:mga03n38_594_c1
839 nmdc:mga00v17_148926_c1
840 nmdc:mga0yw44_79909_c1
841 nmdc:mga06z11_282545_c1
842 nmdc:mga07m45_164130_c1
843 nmdc:mga07m45_20611_c1
844 nmdc:mga07m45_62944_c1
845 nmdc:mga05p37_556083_c1
846 nmdc:mga08y16_10682_c1
847 nmdc:mga08y16_239922_c1
848 nmdc:mga0n895_327310_c1
849 nmdc:mga0n895_49432_c1
850 nmdc:mga0rr50_28186_c1
851 nmdc:mga0rr50_68489_c1
852 nmdc:mga08x19_1613_c1
853 nmdc:mga08x19_76356_c1
854 nmdc:mga0a205_141730_c1
855 nmdc:mga0a205_29507_c1
856 Ga0500643_004026
857 Ga0500643_004771
858 Ga0500645_000046
859 Ga0587083_0016961
860 Ga0587088_012084
861 Ga0587078_012193
862 Ga0466962_0021496
863 Ga0466962_0027630
864 Ga0466962_0048716
865 2623589303
866 2643746393
867 2867314711
868 2867322273
869 2902793051
870 2996223176

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

41

236

0.94

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

46

286

0.92

PF23441

36

287

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4cqm-assembly1.cif.gz_K crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9303 8 251
3lyl-assembly1.cif.gz_D structure of 3-oxoacyl-acylcarrier protein reductase, fabg from francisella tularensis 0.9272 4 250
4m8s-assembly1.cif.gz_D crystal structure of 3-ketoacyl -(acyl carrier protein) reductase (fabg) from neisseria meningitidis 0.9264 5 250
4cqm-assembly3.cif.gz_N crystal structure of heterotetrameric human ketoacyl reductase complexed with nad and nadp 0.9258 7 251
4fgs-assembly1.cif.gz_A crystal structure of a probable dehydrogenase protein 0.9254 4 251
ID Description Score Start End Superfamily
4cqmK00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9303 8 251 3.40.50.720
af_A0A0N7KIR0_69_250_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9277 6 164 3.40.50.720
af_Q0JEC9_1_74_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9182 6 62 3.40.50.720
2c07A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9176 2 250 3.40.50.720
5t2uB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9174 4 252 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X7SAG2-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.941 6 187 GO:0016616
AF-A0A384AZA9-F1-model_v4 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit (Quinone reductase CBR4) 0.9303 8 188 GO:0006633
GO:0016616
GO:0048038
AF-A0A7K2BU84-F1-model_v4 SDR family NAD(P)-dependent oxidoreductase 0.9281 6 187 GO:0005829
GO:0008709
AF-A0A314L114-F1-model_v4 Tropinone reductase 1 0.9275 6 196 GO:0016491
AF-A0A352FTI3-F1-model_v4 Short-chain dehydrogenase 0.9257 8 251 GO:0016491

Map