F443321
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 435 | 263 | 433 | 128 |
Family's Representative Sequence
| Representative Sequence | 3300009174|Ga0105241_12069392|Ga0105241_120693922 |
| Length | 141 |
| Sequence | MNDPEINLPDVVAEVTAVFARYEDALVRNRIDVLDELFWASPATVRYGAGENLVGIDAIRAFRAARPSTGLARTLAATVITTFGRDFANAMTEFRRDGDPAVGRQSQTWVRFAAGWRVVAAHVRLTCWALMPRTSPVNRSG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2675903059 | Asanoa hainanensis CGMCC 4.5593 | Isolate | Rhizosphere |
| 2 | 2857542790 | Achromobacter sp. R-72367 | Isolate | Unclassified |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 59 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 60 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 61 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 62 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 63 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 65 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 75 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 148 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 149 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 150 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 151 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 152 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 153 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 154 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 155 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 156 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 157 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 158 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 159 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 160 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 161 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 162 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 164 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 168 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 171 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 172 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 173 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 175 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 176 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 177 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 178 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 179 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 180 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 181 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 182 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 202 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 204 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 205 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 206 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 207 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 210 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 211 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 212 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 213 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 214 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 215 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 216 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 217 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 218 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 219 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 220 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 221 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 238 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 243 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 249 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 250 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 251 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 252 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 253 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 254 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 255 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 256 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 257 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 258 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 259 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 261 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 262 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.54 |
| Metatranscriptomes | 0 |
| Isolates | 0.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.53 |
| Nodule | 0.46 |
| Rhizoplane | 3.45 |
| Rhizosphere | 88.74 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.83 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10009248 | 3300003203 | Bacteria | 4418 |
| 2 | JGI25406J46586_10010273 | 3300003203 | Bacteria | 4158 |
| 3 | Ga0070658_11519242 | 3300005327 | Bacteria | 581 |
| 4 | Ga0070676_10002242 | 3300005328 | Bacteria | 9867 |
| 5 | Ga0070676_10058322 | 3300005328 | Bacteria | 2287 |
| 6 | Ga0070690_100038855 | 3300005330 | Bacteria | 3005 |
| 7 | Ga0070670_100051863 | 3300005331 | Bacteria | 3522 |
| 8 | Ga0070670_100131484 | 3300005331 | Bacteria | 2161 |
| 9 | Ga0070670_100378774 | 3300005331 | Bacteria | 1246 |
| 10 | Ga0070670_100585410 | 3300005331 | Bacteria | 997 |
| 11 | Ga0070670_101885340 | 3300005331 | Bacteria | 550 |
| 12 | Ga0070677_10019645 | 3300005333 | Bacteria | 2450 |
| 13 | Ga0068869_100003090 | 3300005334 | Bacteria | 10142 |
| 14 | Ga0070666_10022076 | 3300005335 | Bacteria | 4130 |
| 15 | Ga0070682_100393387 | 3300005337 | Bacteria | 1046 |
| 16 | Ga0068868_100017805 | 3300005338 | Bacteria | 5299 |
| 17 | Ga0068868_100130948 | 3300005338 | Bacteria | 2052 |
| 18 | Ga0068868_100390782 | 3300005338 | Bacteria | 1199 |
| 19 | Ga0070687_100039551 | 3300005343 | Bacteria | 2371 |
| 20 | Ga0070661_100623375 | 3300005344 | Bacteria | 873 |
| 21 | Ga0070668_100062059 | 3300005347 | Bacteria | 2895 |
| 22 | Ga0070668_100224482 | 3300005347 | Bacteria | 1551 |
| 23 | Ga0070668_101157773 | 3300005347 | Bacteria | 699 |
| 24 | Ga0070669_100001206 | 3300005353 | Bacteria | 18816 |
| 25 | Ga0070669_100328958 | 3300005353 | Bacteria | 1236 |
| 26 | Ga0070669_100668894 | 3300005353 | Bacteria | 875 |
| 27 | Ga0070675_100017822 | 3300005354 | Bacteria | 5649 |
| 28 | Ga0070675_100033820 | 3300005354 | Bacteria | 4145 |
| 29 | Ga0070675_100619331 | 3300005354 | Bacteria | 982 |
| 30 | Ga0070675_100805022 | 3300005354 | Bacteria | 859 |
| 31 | Ga0070671_100032040 | 3300005355 | Bacteria | 4346 |
| 32 | Ga0070671_100043160 | 3300005355 | Bacteria | 3748 |
| 33 | Ga0070671_100205891 | 3300005355 | Bacteria | 1668 |
| 34 | Ga0070671_100711825 | 3300005355 | Bacteria | 871 |
| 35 | Ga0070671_101512995 | 3300005355 | Bacteria | 594 |
| 36 | Ga0070671_101550603 | 3300005355 | Bacteria | 587 |
| 37 | Ga0070674_100014161 | 3300005356 | Bacteria | 4952 |
| 38 | Ga0070673_100204149 | 3300005364 | Bacteria | 1703 |
| 39 | Ga0070673_100475066 | 3300005364 | Bacteria | 1128 |
| 40 | Ga0070673_100500869 | 3300005364 | Bacteria | 1098 |
| 41 | Ga0070688_101170838 | 3300005365 | Bacteria | 617 |
| 42 | Ga0070659_100463780 | 3300005366 | Bacteria | 1076 |
| 43 | Ga0070667_100002633 | 3300005367 | Bacteria | 15542 |
| 44 | Ga0070667_100021138 | 3300005367 | Bacteria | 5407 |
| 45 | Ga0070667_100887339 | 3300005367 | Bacteria | 830 |
| 46 | Ga0070667_101170002 | 3300005367 | Bacteria | 719 |
| 47 | Ga0070703_10359549 | 3300005406 | Bacteria | 624 |
| 48 | Ga0070710_10131213 | 3300005437 | Bacteria | 1528 |
| 49 | Ga0070705_100061334 | 3300005440 | Bacteria | 2234 |
| 50 | Ga0070705_100205020 | 3300005440 | Bacteria | 1355 |
| 51 | Ga0070700_100052200 | 3300005441 | Bacteria | 2548 |
| 52 | Ga0070700_100654928 | 3300005441 | Bacteria | 830 |
| 53 | Ga0070694_100039963 | 3300005444 | Bacteria | 3125 |
| 54 | Ga0070708_100189125 | 3300005445 | Bacteria | 1925 |
| 55 | Ga0070708_100889194 | 3300005445 | Bacteria | 836 |
| 56 | Ga0070663_100051669 | 3300005455 | Bacteria | 2929 |
| 57 | Ga0070663_100400065 | 3300005455 | Bacteria | 1122 |
| 58 | Ga0070678_100030734 | 3300005456 | Bacteria | 3695 |
| 59 | Ga0070678_100074609 | 3300005456 | Bacteria | 2550 |
| 60 | Ga0070678_100324617 | 3300005456 | Bacteria | 1315 |
| 61 | Ga0070678_100400392 | 3300005456 | Bacteria | 1192 |
| 62 | Ga0070678_100963576 | 3300005456 | Bacteria | 783 |
| 63 | Ga0070678_101671779 | 3300005456 | Unclassified | 599 |
| 64 | Ga0070662_100023758 | 3300005457 | Bacteria | 4215 |
| 65 | Ga0068867_100021275 | 3300005459 | Bacteria | 4629 |
| 66 | Ga0068867_100039799 | 3300005459 | Bacteria | 3428 |
| 67 | Ga0068867_100171805 | 3300005459 | Bacteria | 1717 |
| 68 | Ga0068867_100384636 | 3300005459 | Bacteria | 1179 |
| 69 | Ga0070706_100166339 | 3300005467 | Bacteria | 2059 |
| 70 | Ga0070707_100404469 | 3300005468 | Bacteria | 1325 |
| 71 | Ga0070698_100066979 | 3300005471 | Bacteria | 3612 |
| 72 | Ga0070699_100442127 | 3300005518 | Bacteria | 1178 |
| 73 | Ga0070697_100057753 | 3300005536 | Bacteria | 3157 |
| 74 | Ga0070697_101148350 | 3300005536 | Bacteria | 692 |
| 75 | Ga0068853_100082427 | 3300005539 | Bacteria | 2817 |
| 76 | Ga0070672_100017686 | 3300005543 | Bacteria | 5136 |
| 77 | Ga0070672_100032502 | 3300005543 | Bacteria | 3938 |
| 78 | Ga0070672_100073820 | 3300005543 | Bacteria | 2719 |
| 79 | Ga0070672_100075948 | 3300005543 | Bacteria | 2683 |
| 80 | Ga0070672_100126400 | 3300005543 | Bacteria | 2097 |
| 81 | Ga0070672_100142779 | 3300005543 | Bacteria | 1976 |
| 82 | Ga0070672_100254968 | 3300005543 | Bacteria | 1478 |
| 83 | Ga0070672_101212177 | 3300005543 | Bacteria | 673 |
| 84 | Ga0070686_100154751 | 3300005544 | Bacteria | 1609 |
| 85 | Ga0070695_100110428 | 3300005545 | Bacteria | 1865 |
| 86 | Ga0070696_100176885 | 3300005546 | Bacteria | 1581 |
| 87 | Ga0070693_100558878 | 3300005547 | Bacteria | 820 |
| 88 | Ga0070665_100127782 | 3300005548 | Bacteria | 2544 |
| 89 | Ga0068855_100002197 | 3300005563 | Bacteria | 24123 |
| 90 | Ga0070664_100284181 | 3300005564 | Bacteria | 1492 |
| 91 | Ga0070664_100394467 | 3300005564 | Bacteria | 1265 |
| 92 | Ga0070664_100614614 | 3300005564 | Bacteria | 1008 |
| 93 | Ga0070664_100823375 | 3300005564 | Bacteria | 869 |
| 94 | Ga0068857_102484380 | 3300005577 | Bacteria | 509 |
| 95 | Ga0068854_100045930 | 3300005578 | Bacteria | 3108 |
| 96 | Ga0068854_100167639 | 3300005578 | Bacteria | 1706 |
| 97 | Ga0068856_100027049 | 3300005614 | Bacteria | 5596 |
| 98 | Ga0070702_100416260 | 3300005615 | Bacteria | 966 |
| 99 | Ga0068852_100016022 | 3300005616 | Bacteria | 5836 |
| 100 | Ga0068852_100420960 | 3300005616 | Bacteria | 1317 |
| 101 | Ga0068852_100704648 | 3300005616 | Bacteria | 1020 |
| 102 | Ga0068859_100074580 | 3300005617 | Bacteria | 3432 |
| 103 | Ga0068859_100185512 | 3300005617 | Bacteria | 2164 |
| 104 | Ga0068864_100067378 | 3300005618 | Bacteria | 3108 |
| 105 | Ga0068864_100083122 | 3300005618 | Bacteria | 2811 |
| 106 | Ga0068864_100174367 | 3300005618 | Bacteria | 1962 |
| 107 | Ga0068864_101278927 | 3300005618 | Bacteria | 734 |
| 108 | Ga0068864_101429708 | 3300005618 | Bacteria | 694 |
| 109 | Ga0068866_10001406 | 3300005718 | Bacteria | 10360 |
| 110 | Ga0068861_100012705 | 3300005719 | Bacteria | 5876 |
| 111 | Ga0068851_10138278 | 3300005834 | Bacteria | 1323 |
| 112 | Ga0068870_10148876 | 3300005840 | Bacteria | 1377 |
| 113 | Ga0068870_10491230 | 3300005840 | Bacteria | 816 |
| 114 | Ga0068863_100029990 | 3300005841 | Bacteria | 5195 |
| 115 | Ga0068863_100034799 | 3300005841 | Bacteria | 4797 |
| 116 | Ga0068863_100112741 | 3300005841 | Bacteria | 2589 |
| 117 | Ga0068858_100009363 | 3300005842 | Bacteria | 9350 |
| 118 | Ga0068860_100002496 | 3300005843 | Bacteria | 19308 |
| 119 | Ga0081539_10000044 | 3300005985 | Bacteria | 284021 |
| 120 | Ga0081539_10000320 | 3300005985 | Bacteria | 106935 |
| 121 | Ga0070717_10455452 | 3300006028 | Bacteria | 1153 |
| 122 | Ga0075364_10025958 | 3300006051 | Bacteria | 3733 |
| 123 | Ga0070715_10051676 | 3300006163 | Bacteria | 1770 |
| 124 | Ga0097621_100019914 | 3300006237 | Bacteria | 5162 |
| 125 | Ga0097621_100101459 | 3300006237 | Bacteria | 2421 |
| 126 | Ga0097621_100587855 | 3300006237 | Bacteria | 1016 |
| 127 | Ga0068871_100031428 | 3300006358 | Bacteria | 4188 |
| 128 | Ga0068871_100059216 | 3300006358 | Bacteria | 3120 |
| 129 | Ga0068871_100262925 | 3300006358 | Bacteria | 1505 |
| 130 | Ga0075428_100062337 | 3300006844 | Bacteria | 4082 |
| 131 | Ga0075430_101657496 | 3300006846 | Bacteria | 525 |
| 132 | Ga0075431_100017871 | 3300006847 | Bacteria | 7212 |
| 133 | Ga0075431_101616657 | 3300006847 | Bacteria | 605 |
| 134 | Ga0075433_10019149 | 3300006852 | Bacteria | 5695 |
| 135 | Ga0068865_100003788 | 3300006881 | Bacteria | 9081 |
| 136 | Ga0097620_100074582 | 3300006931 | Bacteria | 3432 |
| 137 | Ga0097620_100185502 | 3300006931 | Bacteria | 2164 |
| 138 | Ga0079104_1000388 | 3300006946 | Bacteria | 51046 |
| 139 | Ga0099794_10002456 | 3300007265 | Bacteria | 6836 |
| 140 | Ga0105240_10024203 | 3300009093 | Bacteria | 8013 |
| 141 | Ga0111539_10423266 | 3300009094 | Bacteria | 1551 |
| 142 | Ga0105245_10130321 | 3300009098 | Bacteria | 2358 |
| 143 | Ga0114129_10000507 | 3300009147 | Bacteria | 47550 |
| 144 | Ga0105243_10024982 | 3300009148 | Bacteria | 4562 |
| 145 | Ga0105243_10202186 | 3300009148 | Bacteria | 1743 |
| 146 | Ga0105243_10594878 | 3300009148 | Bacteria | 1064 |
| 147 | Ga0105243_10826337 | 3300009148 | Bacteria | 915 |
| 148 | Ga0105243_11721443 | 3300009148 | Bacteria | 656 |
| 149 | Ga0105241_12069392 | 3300009174 | Bacteria | 562 |
| 150 | Ga0105242_10025684 | 3300009176 | Bacteria | 4664 |
| 151 | Ga0105248_10067988 | 3300009177 | Bacteria | 4000 |
| 152 | Ga0105248_10073497 | 3300009177 | Bacteria | 3842 |
| 153 | Ga0105248_10184852 | 3300009177 | Bacteria | 2349 |
| 154 | Ga0105248_11565024 | 3300009177 | Bacteria | 747 |
| 155 | Ga0105248_12356011 | 3300009177 | Bacteria | 606 |
| 156 | Ga0105238_10053165 | 3300009551 | Bacteria | 4070 |
| 157 | Ga0105238_10338328 | 3300009551 | Unclassified | 1493 |
| 158 | Ga0105249_10008866 | 3300009553 | Bacteria | 8785 |
| 159 | Ga0105249_10436145 | 3300009553 | Bacteria | 1347 |
| 160 | Ga0105249_10598882 | 3300009553 | Bacteria | 1157 |
| 161 | Ga0105239_10643293 | 3300010375 | Bacteria | 1211 |
| 162 | Ga0157371_10660194 | 3300013102 | Bacteria | 781 |
| 163 | Ga0157378_10080517 | 3300013297 | Bacteria | 2942 |
| 164 | Ga0157378_10340192 | 3300013297 | Bacteria | 1463 |
| 165 | Ga0163162_10056904 | 3300013306 | Bacteria | 3938 |
| 166 | Ga0163162_10372034 | 3300013306 | Bacteria | 1562 |
| 167 | Ga0163162_10376407 | 3300013306 | Bacteria | 1553 |
| 168 | Ga0163162_10904687 | 3300013306 | Bacteria | 995 |
| 169 | Ga0163162_11888112 | 3300013306 | Bacteria | 684 |
| 170 | Ga0157375_10053665 | 3300013308 | Bacteria | 3967 |
| 171 | Ga0157375_10059297 | 3300013308 | Bacteria | 3791 |
| 172 | Ga0157375_10064588 | 3300013308 | Bacteria | 3645 |
| 173 | Ga0157375_10393892 | 3300013308 | Bacteria | 1552 |
| 174 | Ga0157375_10567190 | 3300013308 | Bacteria | 1296 |
| 175 | Ga0157375_11786477 | 3300013308 | Bacteria | 729 |
| 176 | Ga0163163_10155280 | 3300014325 | Bacteria | 2333 |
| 177 | Ga0163163_10174885 | 3300014325 | Bacteria | 2193 |
| 178 | Ga0163163_10714431 | 3300014325 | Bacteria | 1066 |
| 179 | Ga0157380_10214973 | 3300014326 | Bacteria | 1716 |
| 180 | Ga0157380_10549955 | 3300014326 | Bacteria | 1132 |
| 181 | Ga0157379_10118027 | 3300014968 | Bacteria | 2386 |
| 182 | Ga0157379_10250597 | 3300014968 | Bacteria | 1607 |
| 183 | Ga0157379_10279968 | 3300014968 | Bacteria | 1518 |
| 184 | Ga0157379_10316046 | 3300014968 | Bacteria | 1425 |
| 185 | Ga0157379_10801126 | 3300014968 | Bacteria | 889 |
| 186 | Ga0157376_10022462 | 3300014969 | Bacteria | 4919 |
| 187 | Ga0157376_12566013 | 3300014969 | Bacteria | 549 |
| 188 | Ga0163161_10029256 | 3300017792 | Bacteria | 3916 |
| 189 | Ga0163161_10295151 | 3300017792 | Bacteria | 1275 |
| 190 | Ga0163161_11103790 | 3300017792 | Bacteria | 682 |
| 191 | Ga0207697_10043128 | 3300025315 | Bacteria | 1855 |
| 192 | Ga0207656_10200983 | 3300025321 | Bacteria | 963 |
| 193 | Ga0207682_10007682 | 3300025893 | Bacteria | 4291 |
| 194 | Ga0207682_10077238 | 3300025893 | Bacteria | 1420 |
| 195 | Ga0207682_10172079 | 3300025893 | Bacteria | 985 |
| 196 | Ga0207682_10318607 | 3300025893 | Bacteria | 730 |
| 197 | Ga0207642_10014009 | 3300025899 | Bacteria | 2944 |
| 198 | Ga0207688_10030668 | 3300025901 | Bacteria | 2966 |
| 199 | Ga0207680_10001775 | 3300025903 | Bacteria | 10181 |
| 200 | Ga0207685_10037589 | 3300025905 | Bacteria | 1784 |
| 201 | Ga0207645_10004050 | 3300025907 | Bacteria | 10921 |
| 202 | Ga0207645_10018257 | 3300025907 | Bacteria | 4619 |
| 203 | Ga0207645_10134112 | 3300025907 | Bacteria | 1612 |
| 204 | Ga0207645_10247693 | 3300025907 | Bacteria | 1178 |
| 205 | Ga0207643_10086195 | 3300025908 | Bacteria | 1825 |
| 206 | Ga0207684_10006213 | 3300025910 | Bacteria | 10907 |
| 207 | Ga0207654_10889562 | 3300025911 | Bacteria | 645 |
| 208 | Ga0207660_10010796 | 3300025917 | Bacteria | 5936 |
| 209 | Ga0207662_10072493 | 3300025918 | Bacteria | 2087 |
| 210 | Ga0207649_11167286 | 3300025920 | Bacteria | 608 |
| 211 | Ga0207646_10180396 | 3300025922 | Bacteria | 1907 |
| 212 | Ga0207681_10009146 | 3300025923 | Bacteria | 6050 |
| 213 | Ga0207681_10170245 | 3300025923 | Bacteria | 1650 |
| 214 | Ga0207650_10047025 | 3300025925 | Bacteria | 3178 |
| 215 | Ga0207650_10053956 | 3300025925 | Bacteria | 2980 |
| 216 | Ga0207650_10875745 | 3300025925 | Bacteria | 762 |
| 217 | Ga0207650_10882410 | 3300025925 | Bacteria | 759 |
| 218 | Ga0207650_11522256 | 3300025925 | Bacteria | 568 |
| 219 | Ga0207659_10055542 | 3300025926 | Bacteria | 2833 |
| 220 | Ga0207659_10100787 | 3300025926 | Bacteria | 2176 |
| 221 | Ga0207687_10153179 | 3300025927 | Bacteria | 1761 |
| 222 | Ga0207687_10786305 | 3300025927 | Bacteria | 811 |
| 223 | Ga0207644_10001677 | 3300025931 | Bacteria | 14280 |
| 224 | Ga0207644_10092785 | 3300025931 | Bacteria | 2253 |
| 225 | Ga0207690_10247696 | 3300025932 | Bacteria | 1375 |
| 226 | Ga0207706_10059142 | 3300025933 | Bacteria | 3375 |
| 227 | Ga0207706_10216132 | 3300025933 | Bacteria | 1679 |
| 228 | Ga0207686_10686817 | 3300025934 | Bacteria | 813 |
| 229 | Ga0207709_10010461 | 3300025935 | Bacteria | 5106 |
| 230 | Ga0207709_10384815 | 3300025935 | Bacteria | 1068 |
| 231 | Ga0207670_10190642 | 3300025936 | Bacteria | 1551 |
| 232 | Ga0207669_10002216 | 3300025937 | Bacteria | 8257 |
| 233 | Ga0207669_10833720 | 3300025937 | Bacteria | 766 |
| 234 | Ga0207704_10002464 | 3300025938 | Bacteria | 8336 |
| 235 | Ga0207704_10076123 | 3300025938 | Bacteria | 2149 |
| 236 | Ga0207691_10041764 | 3300025940 | Bacteria | 4232 |
| 237 | Ga0207691_10073151 | 3300025940 | Bacteria | 3091 |
| 238 | Ga0207691_10092215 | 3300025940 | Bacteria | 2712 |
| 239 | Ga0207691_10122192 | 3300025940 | Bacteria | 2306 |
| 240 | Ga0207691_10128231 | 3300025940 | Bacteria | 2243 |
| 241 | Ga0207691_10692546 | 3300025940 | Bacteria | 860 |
| 242 | Ga0207711_10009406 | 3300025941 | Bacteria | 8160 |
| 243 | Ga0207711_10060000 | 3300025941 | Bacteria | 3277 |
| 244 | Ga0207711_10079407 | 3300025941 | Bacteria | 2864 |
| 245 | Ga0207711_10764149 | 3300025941 | Bacteria | 901 |
| 246 | Ga0207689_10055228 | 3300025942 | Bacteria | 3269 |
| 247 | Ga0207689_10389685 | 3300025942 | Bacteria | 1161 |
| 248 | Ga0207679_10161207 | 3300025945 | Bacteria | 1836 |
| 249 | Ga0207679_10667015 | 3300025945 | Bacteria | 942 |
| 250 | Ga0207679_10718409 | 3300025945 | Bacteria | 907 |
| 251 | Ga0207679_10749790 | 3300025945 | Bacteria | 888 |
| 252 | Ga0207667_10011668 | 3300025949 | Bacteria | 10195 |
| 253 | Ga0207651_10105367 | 3300025960 | Bacteria | 2103 |
| 254 | Ga0207651_10111973 | 3300025960 | Bacteria | 2051 |
| 255 | Ga0207651_10165585 | 3300025960 | Bacteria | 1738 |
| 256 | Ga0207651_10196189 | 3300025960 | Bacteria | 1614 |
| 257 | Ga0207651_10343828 | 3300025960 | Bacteria | 1254 |
| 258 | Ga0207651_10768595 | 3300025960 | Bacteria | 852 |
| 259 | Ga0207712_10018757 | 3300025961 | Bacteria | 4510 |
| 260 | Ga0207668_10007368 | 3300025972 | Bacteria | 6539 |
| 261 | Ga0207640_10280285 | 3300025981 | Bacteria | 1309 |
| 262 | Ga0207640_10384838 | 3300025981 | Bacteria | 1138 |
| 263 | Ga0207658_10000764 | 3300025986 | Bacteria | 27551 |
| 264 | Ga0207658_10014317 | 3300025986 | Bacteria | 5432 |
| 265 | Ga0207658_10200684 | 3300025986 | Bacteria | 1665 |
| 266 | Ga0207677_10083343 | 3300026023 | Bacteria | 2301 |
| 267 | Ga0207677_10100244 | 3300026023 | Bacteria | 2129 |
| 268 | Ga0207703_10005845 | 3300026035 | Bacteria | 9852 |
| 269 | Ga0207703_12364626 | 3300026035 | Bacteria | 507 |
| 270 | Ga0207639_10065441 | 3300026041 | Bacteria | 2822 |
| 271 | Ga0207678_10226886 | 3300026067 | Bacteria | 1599 |
| 272 | Ga0207708_10006866 | 3300026075 | Bacteria | 8419 |
| 273 | Ga0207641_10002081 | 3300026088 | Bacteria | 18972 |
| 274 | Ga0207641_10052603 | 3300026088 | Bacteria | 3449 |
| 275 | Ga0207641_10094168 | 3300026088 | Bacteria | 2626 |
| 276 | Ga0207648_10009660 | 3300026089 | Bacteria | 9225 |
| 277 | Ga0207648_10032136 | 3300026089 | Bacteria | 4637 |
| 278 | Ga0207648_10286788 | 3300026089 | Bacteria | 1473 |
| 279 | Ga0207648_10523453 | 3300026089 | Bacteria | 1087 |
| 280 | Ga0207648_11246776 | 3300026089 | Bacteria | 698 |
| 281 | Ga0207676_10017436 | 3300026095 | Bacteria | 5203 |
| 282 | Ga0207676_10189558 | 3300026095 | Bacteria | 1808 |
| 283 | Ga0207676_10388766 | 3300026095 | Bacteria | 1300 |
| 284 | Ga0207676_10681449 | 3300026095 | Bacteria | 994 |
| 285 | Ga0207676_11678536 | 3300026095 | Bacteria | 633 |
| 286 | Ga0207675_100057248 | 3300026118 | Bacteria | 3637 |
| 287 | Ga0207675_100258581 | 3300026118 | Bacteria | 1687 |
| 288 | Ga0207683_10103903 | 3300026121 | Bacteria | 2538 |
| 289 | Ga0207683_10355572 | 3300026121 | Bacteria | 1345 |
| 290 | Ga0207698_10014208 | 3300026142 | Bacteria | 5284 |
| 291 | Ga0207698_10392681 | 3300026142 | Bacteria | 1323 |
| 292 | Ga0209281_1000093 | 3300027111 | Bacteria | 240724 |
| 293 | Ga0268265_11276640 | 3300028380 | Bacteria | 734 |
| 294 | Ga0268264_10001240 | 3300028381 | Bacteria | 24403 |
| 295 | Ga0307512_10146976 | 3300030522 | Bacteria | 1422 |
| 296 | Ga0307513_10358310 | 3300031456 | Bacteria | 1204 |
| 297 | Ga0307509_10007099 | 3300031507 | Bacteria | 14778 |
| 298 | Ga0307408_100256156 | 3300031548 | Bacteria | 1446 |
| 299 | Ga0307408_101246520 | 3300031548 | Bacteria | 695 |
| 300 | Ga0307514_10047161 | 3300031649 | Bacteria | 3364 |
| 301 | Ga0307405_11053478 | 3300031731 | Bacteria | 697 |
| 302 | Ga0307518_10199172 | 3300031838 | Bacteria | 1332 |
| 303 | Ga0307410_10273316 | 3300031852 | Bacteria | 1323 |
| 304 | Ga0307406_10799138 | 3300031901 | Bacteria | 796 |
| 305 | Ga0307407_11280572 | 3300031903 | Bacteria | 575 |
| 306 | Ga0307409_100400591 | 3300031995 | Bacteria | 1311 |
| 307 | Ga0307411_10089223 | 3300032005 | Bacteria | 2147 |
| 308 | Ga0307510_10026478 | 3300033180 | Bacteria | 6663 |
| 309 | Ga0373930_0010070 | 3300034816 | Bacteria | 1682 |
| 310 | Ga0373948_0038566 | 3300034817 | Bacteria | 991 |
| 311 | Ga0373944_0294824 | 3300035089 | Bacteria | 608 |
| 312 | Ga0373932_0024912 | 3300035112 | Bacteria | 1615 |
| 313 | Ga0373936_0017536 | 3300035113 | Unclassified | 2758 |
| 314 | Ga0373936_0070311 | 3300035113 | Bacteria | 1441 |
| 315 | Ga0373945_0171082 | 3300035116 | Bacteria | 890 |
| 316 | Ga0373953_0322960 | 3300035117 | Bacteria | 675 |
| 317 | Ga0373943_0397944 | 3300035170 | Bacteria | 795 |
| 318 | Ga0373931_0007102 | 3300035691 | Bacteria | 5266 |
| 319 | Ga0373935_0526214 | 3300035692 | Bacteria | 860 |
| 320 | Ga0373927_0159292 | 3300035695 | Bacteria | 1479 |
| 321 | Ga0373933_0281439 | 3300035724 | Bacteria | 1075 |
| 322 | Ga0373937_0218681 | 3300036401 | Bacteria | 1793 |
| 323 | Ga0373937_0368832 | 3300036401 | Bacteria | 1361 |
| 324 | Ga0373937_0513718 | 3300036401 | Bacteria | 1138 |
| 325 | Ga0373925_0205625 | 3300037068 | Bacteria | 1567 |
| 326 | Ga0373925_0241618 | 3300037068 | Bacteria | 1446 |
| 327 | Ga0395900_0516600 | 3300037418 | Bacteria | 1143 |
| 328 | Ga0395905_0591670 | 3300037471 | Bacteria | 1011 |
| 329 | Ga0451833_0839225 | 3300041491 | Bacteria | 864 |
| 330 | Ga0451853_0817173 | 3300041512 | Bacteria | 790 |
| 331 | Ga0450889_009208 | 3300042144 | Bacteria | 1010 |
| 332 | Ga0451577_0190936 | 3300042876 | Bacteria | 1848 |
| 333 | Ga0453684_0354646 | 3300044712 | Bacteria | 1653 |
| 334 | Ga0451576_0004324 | 3300045051 | Bacteria | 18558 |
| 335 | Ga0495592_0001645 | 3300046454 | Bacteria | 15657 |
| 336 | Ga0495629_0586031 | 3300046459 | Bacteria | 747 |
| 337 | Ga0495580_0233221 | 3300046472 | Bacteria | 1263 |
| 338 | Ga0495628_0895111 | 3300046516 | Bacteria | 616 |
| 339 | Ga0495598_0165177 | 3300046537 | Bacteria | 781 |
| 340 | Ga0495645_0021522 | 3300046543 | Bacteria | 4659 |
| 341 | Ga0495645_0089809 | 3300046543 | Bacteria | 2197 |
| 342 | Ga0495645_0855922 | 3300046543 | Bacteria | 542 |
| 343 | Ga0495668_0119697 | 3300046616 | Bacteria | 1440 |
| 344 | Ga0495599_0207682 | 3300046678 | Bacteria | 1202 |
| 345 | Ga0495646_0124907 | 3300046680 | Bacteria | 1453 |
| 346 | Ga0495647_0102851 | 3300046681 | Bacteria | 1185 |
| 347 | Ga0495647_0383316 | 3300046681 | Bacteria | 644 |
| 348 | Ga0495658_0033869 | 3300046683 | Bacteria | 2800 |
| 349 | Ga0495658_0397552 | 3300046683 | Bacteria | 878 |
| 350 | Ga0495658_0489227 | 3300046683 | Bacteria | 787 |
| 351 | Ga0495670_0438956 | 3300046691 | Bacteria | 707 |
| 352 | Ga0495649_0023242 | 3300046694 | Bacteria | 3464 |
| 353 | Ga0495600_0447332 | 3300046809 | Bacteria | 799 |
| 354 | Ga0495636_0200990 | 3300047318 | Unclassified | 910 |
| 355 | Ga0495680_1106836 | 3300047322 | Bacteria | 500 |
| 356 | Ga0495681_0188980 | 3300047470 | Bacteria | 842 |
| 357 | Ga0495686_0001156 | 3300047472 | Bacteria | 30978 |
| 358 | Ga0495686_0285326 | 3300047472 | Bacteria | 916 |
| 359 | Ga0495615_0091114 | 3300048090 | Bacteria | 850 |
| 360 | Ga0496100_1061635 | 3300048903 | Bacteria | 638 |
| 361 | Ga0496101_0968986 | 3300048904 | Bacteria | 669 |
| 362 | Ga0496102_0005344 | 3300048905 | Bacteria | 10902 |
| 363 | Ga0496102_0042380 | 3300048905 | Bacteria | 4124 |
| 364 | Ga0496103_0102530 | 3300048906 | Bacteria | 1812 |
| 365 | Ga0496103_0403241 | 3300048906 | Unclassified | 878 |
| 366 | Ga0496105_0342263 | 3300048908 | Bacteria | 1196 |
| 367 | Ga0496105_0703686 | 3300048908 | Bacteria | 775 |
| 368 | Ga0496106_0378704 | 3300048909 | Bacteria | 1137 |
| 369 | Ga0496108_0098332 | 3300048911 | Bacteria | 2494 |
| 370 | Ga0496109_0045433 | 3300048912 | Bacteria | 3986 |
| 371 | Ga0496109_1099907 | 3300048912 | Bacteria | 732 |
| 372 | Ga0496110_0264960 | 3300048913 | Bacteria | 1564 |
| 373 | Ga0496114_0529341 | 3300048917 | Unclassified | 1042 |
| 374 | Ga0496114_1491139 | 3300048917 | Bacteria | 564 |
| 375 | Ga0496116_0012893 | 3300048919 | Bacteria | 6785 |
| 376 | Ga0496117_0000067 | 3300048920 | Bacteria | 249348 |
| 377 | Ga0496118_0000021 | 3300048921 | Bacteria | 444988 |
| 378 | Ga0496119_0144079 | 3300048922 | Unclassified | 1283 |
| 379 | Ga0496120_0077532 | 3300048923 | Unclassified | 1808 |
| 380 | Ga0496121_0029428 | 3300048924 | Bacteria | 5078 |
| 381 | Ga0496121_0159703 | 3300048924 | Bacteria | 1650 |
| 382 | Ga0496122_0284322 | 3300048925 | Unclassified | 902 |
| 383 | Ga0496124_0000024 | 3300048927 | Bacteria | 414291 |
| 384 | Ga0496124_0217109 | 3300048927 | Unclassified | 1441 |
| 385 | Ga0496125_0016059 | 3300048928 | Bacteria | 7208 |
| 386 | Ga0496126_0089871 | 3300048929 | Bacteria | 2702 |
| 387 | Ga0501033_0141443 | 3300049570 | Bacteria | 1739 |
| 388 | Ga0501036_0051217 | 3300049572 | Bacteria | 3496 |
| 389 | Ga0501036_1533956 | 3300049572 | Bacteria | 539 |
| 390 | Ga0501037_0159058 | 3300049573 | Bacteria | 1611 |
| 391 | Ga0501038_0020030 | 3300049574 | Bacteria | 6022 |
| 392 | Ga0501040_0011471 | 3300049576 | Bacteria | 5803 |
| 393 | Ga0501041_0044240 | 3300049577 | Bacteria | 2707 |
| 394 | Ga0501043_0251870 | 3300049579 | Bacteria | 1360 |
| 395 | Ga0501046_0369862 | 3300049580 | Bacteria | 1039 |
| 396 | Ga0501069_0117712 | 3300049585 | Bacteria | 1516 |
| 397 | Ga0501070_0412502 | 3300049586 | Bacteria | 1091 |
| 398 | Ga0501072_0051947 | 3300049588 | Bacteria | 3227 |
| 399 | Ga0501074_0399753 | 3300049590 | Bacteria | 974 |
| 400 | Ga0501075_0077015 | 3300049591 | Bacteria | 2523 |
| 401 | Ga0501076_0089938 | 3300049592 | Bacteria | 2468 |
| 402 | Ga0501077_0010748 | 3300049593 | Bacteria | 5700 |
| 403 | Ga0501223_045638 | 3300049663 | Bacteria | 850 |
| 404 | Ga0501257_014251 | 3300049686 | Bacteria | 1826 |
| 405 | Ga0501079_0002133 | 3300049741 | Bacteria | 14228 |
| 406 | Ga0501083_0059987 | 3300049744 | Bacteria | 2543 |
| 407 | Ga0501044_0235273 | 3300049823 | Bacteria | 1778 |
| 408 | Ga0501045_0067106 | 3300049824 | Bacteria | 2634 |
| 409 | nmdc:mga00v17_75515_c1 | 3300050491 | Bacteria | 2096 |
| 410 | nmdc:mga05p37_36371_c1 | 3300050507 | Bacteria | 6041 |
| 411 | nmdc:mga05p37_7843_c1 | 3300050507 | Bacteria | 12601 |
| 412 | nmdc:mga0qj67_1267571_c1 | 3300050509 | Bacteria | 572 |
| 413 | nmdc:mga06r32_16918_c1 | 3300050510 | Bacteria | 6653 |
| 414 | nmdc:mga08y16_479996_c1 | 3300050511 | Bacteria | 1265 |
| 415 | nmdc:mga0n895_146322_c1 | 3300050512 | Bacteria | 2393 |
| 416 | nmdc:mga0rr50_69721_c1 | 3300050513 | Bacteria | 2677 |
| 417 | nmdc:mga08x19_7383_c1 | 3300050514 | Bacteria | 6529 |
| 418 | nmdc:mga0a205_17962_c1 | 3300050515 | Bacteria | 6642 |
| 419 | Ga0500644_0004926 | 3300053088 | Bacteria | 3358 |
| 420 | Ga0500651_0278727 | 3300053093 | Bacteria | 965 |
| 421 | Ga0500594_0001115 | 3300053118 | Bacteria | 5765 |
| 422 | Ga0500594_0212333 | 3300053118 | Bacteria | 638 |
| 423 | Ga0500626_254608 | 3300053128 | Bacteria | 652 |
| 424 | Ga0500564_114915 | 3300053138 | Bacteria | 1178 |
| 425 | Ga0500568_0246431 | 3300053139 | Bacteria | 651 |
| 426 | Ga0500619_045955 | 3300053154 | Bacteria | 1398 |
| 427 | Ga0500636_0288831 | 3300053177 | Bacteria | 814 |
| 428 | Ga0501084_0002259 | 3300054114 | Bacteria | 15478 |
| 429 | Ga0590071_027388 | 3300059421 | Bacteria | 1353 |
| 430 | Ga0590074_029636 | 3300059423 | Bacteria | 964 |
| 431 | Ga0501082_0043672 | 3300060353 | Bacteria | 3865 |
| 432 | Ga0501082_0086604 | 3300060353 | Bacteria | 2702 |
| 433 | Ga0530510_0006560 | 3300061734 | Bacteria | 8109 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009148 | Ga0105243_10202186 | Ga0105243_102021862 | 112 |
| 2 | 3300025935 | Ga0207709_10384815 | Ga0207709_103848152 | 112 |
| 3 | 3300026089 | Ga0207648_10286788 | Ga0207648_102867882 | 112 |
| 4 | 3300046809 | Ga0495600_0447332 | Ga0495600_0447332_351_731 | 112 |
| 5 | 3300031901 | Ga0307406_10799138 | Ga0307406_107991382 | 117 |
| 6 | 3300005353 | Ga0070669_100328958 | Ga0070669_1003289582 | 118 |
| 7 | 3300005354 | Ga0070675_100805022 | Ga0070675_1008050222 | 118 |
| 8 | 3300005355 | Ga0070671_101512995 | Ga0070671_1015129952 | 118 |
| 9 | 3300005364 | Ga0070673_100475066 | Ga0070673_1004750662 | 118 |
| 10 | 3300025960 | Ga0207651_10196189 | Ga0207651_101961892 | 118 |
| 11 | 3300031548 | Ga0307408_100256156 | Ga0307408_1002561562 | 118 |
| 12 | 3300031731 | Ga0307405_11053478 | Ga0307405_110534782 | 118 |
| 13 | 3300031903 | Ga0307407_11280572 | Ga0307407_112805722 | 118 |
| 14 | 3300032005 | Ga0307411_10089223 | Ga0307411_100892232 | 118 |
| 15 | 3300049572 | Ga0501036_1533956 | Ga0501036_1533956_52_456 | 119 |
| 16 | 3300006028 | Ga0070717_10455452 | Ga0070717_104554521 | 122 |
| 17 | 3300005563 | Ga0068855_100002197 | Ga0068855_10000219718 | 123 |
| 18 | 3300005614 | Ga0068856_100027049 | Ga0068856_1000270495 | 123 |
| 19 | 3300009093 | Ga0105240_10024203 | Ga0105240_100242039 | 123 |
| 20 | 3300009551 | Ga0105238_10053165 | Ga0105238_100531652 | 123 |
| 21 | 3300010375 | Ga0105239_10643293 | Ga0105239_106432932 | 123 |
| 22 | 3300014968 | Ga0157379_10250597 | Ga0157379_102505972 | 123 |
| 23 | 3300025949 | Ga0207667_10011668 | Ga0207667_100116688 | 123 |
| 24 | iso_pu_bacteria | 2675903059 | 2676479621 | 123 |
| 25 | iso_pu_bacteria | 2857542790 | 2857545047 | 123 |
| 26 | 3300030522 | Ga0307512_10146976 | Ga0307512_101469762 | 125 |
| 27 | 3300033180 | Ga0307510_10026478 | Ga0307510_100264782 | 125 |
| 28 | 3300035089 | Ga0373944_0294824 | Ga0373944_0294824_182_559 | 125 |
| 29 | 3300035117 | Ga0373953_0322960 | Ga0373953_0322960_68_445 | 125 |
| 30 | 3300035170 | Ga0373943_0397944 | Ga0373943_0397944_17_394 | 125 |
| 31 | 3300035692 | Ga0373935_0526214 | Ga0373935_0526214_71_448 | 125 |
| 32 | 3300035724 | Ga0373933_0281439 | Ga0373933_0281439_152_529 | 125 |
| 33 | 3300036401 | Ga0373937_0368832 | Ga0373937_0368832_270_647 | 125 |
| 34 | 3300037068 | Ga0373925_0205625 | Ga0373925_0205625_556_933 | 125 |
| 35 | 3300046516 | Ga0495628_0895111 | Ga0495628_0895111_164_541 | 125 |
| 36 | 3300046543 | Ga0495645_0855922 | Ga0495645_0855922_15_392 | 125 |
| 37 | 3300046616 | Ga0495668_0119697 | Ga0495668_0119697_827_1204 | 125 |
| 38 | 3300046681 | Ga0495647_0383316 | Ga0495647_0383316_217_594 | 125 |
| 39 | 3300005367 | Ga0070667_100021138 | Ga0070667_1000211382 | 126 |
| 40 | 3300005539 | Ga0068853_100082427 | Ga0068853_1000824274 | 126 |
| 41 | 3300006051 | Ga0075364_10025958 | Ga0075364_100259582 | 126 |
| 42 | 3300006946 | Ga0079104_1000388 | Ga0079104_100038833 | 126 |
| 43 | 3300025986 | Ga0207658_10014317 | Ga0207658_100143172 | 126 |
| 44 | 3300026041 | Ga0207639_10065441 | Ga0207639_100654412 | 126 |
| 45 | 3300027111 | Ga0209281_1000093 | Ga0209281_1000093212 | 126 |
| 46 | 3300031507 | Ga0307509_10007099 | Ga0307509_100070994 | 126 |
| 47 | 3300031649 | Ga0307514_10047161 | Ga0307514_100471612 | 126 |
| 48 | 3300031838 | Ga0307518_10199172 | Ga0307518_101991722 | 126 |
| 49 | 3300035113 | Ga0373936_0017536 | Ga0373936_0017536_1345_1725 | 126 |
| 50 | 3300046454 | Ga0495592_0001645 | Ga0495592_0001645_2084_2464 | 126 |
| 51 | 3300046680 | Ga0495646_0124907 | Ga0495646_0124907_21_401 | 126 |
| 52 | 3300047472 | Ga0495686_0001156 | Ga0495686_0001156_8825_9220 | 126 |
| 53 | 3300047472 | Ga0495686_0285326 | Ga0495686_0285326_385_780 | 126 |
| 54 | 3300048905 | Ga0496102_0042380 | Ga0496102_0042380_3457_3837 | 126 |
| 55 | 3300048906 | Ga0496103_0403241 | Ga0496103_0403241_424_804 | 126 |
| 56 | 3300048917 | Ga0496114_0529341 | Ga0496114_0529341_24_404 | 126 |
| 57 | 3300048919 | Ga0496116_0012893 | Ga0496116_0012893_585_965 | 126 |
| 58 | 3300048920 | Ga0496117_0000067 | Ga0496117_0000067_232445_232825 | 126 |
| 59 | 3300048921 | Ga0496118_0000021 | Ga0496118_0000021_98928_99308 | 126 |
| 60 | 3300048922 | Ga0496119_0144079 | Ga0496119_0144079_745_1125 | 126 |
| 61 | 3300048923 | Ga0496120_0077532 | Ga0496120_0077532_639_1019 | 126 |
| 62 | 3300048924 | Ga0496121_0029428 | Ga0496121_0029428_353_733 | 126 |
| 63 | 3300048927 | Ga0496124_0217109 | Ga0496124_0217109_982_1362 | 126 |
| 64 | 3300048928 | Ga0496125_0016059 | Ga0496125_0016059_1111_1491 | 126 |
| 65 | 3300048929 | Ga0496126_0089871 | Ga0496126_0089871_1466_1846 | 126 |
| 66 | 3300050491 | nmdc:mga00v17_75515_c1 | nmdc:mga00v17_75515_c1_955_1335 | 126 |
| 67 | 3300053088 | Ga0500644_0004926 | Ga0500644_0004926_1334_1714 | 126 |
| 68 | 3300053093 | Ga0500651_0278727 | Ga0500651_0278727_444_824 | 126 |
| 69 | 3300053118 | Ga0500594_0001115 | Ga0500594_0001115_4875_5255 | 126 |
| 70 | 3300053138 | Ga0500564_114915 | Ga0500564_114915_602_982 | 126 |
| 71 | 3300053154 | Ga0500619_045955 | Ga0500619_045955_549_929 | 126 |
| 72 | 3300003203 | JGI25406J46586_10010273 | JGI25406J46586_100102731 | 127 |
| 73 | 3300005327 | Ga0070658_11519242 | Ga0070658_115192422 | 127 |
| 74 | 3300005328 | Ga0070676_10002242 | Ga0070676_100022425 | 127 |
| 75 | 3300005328 | Ga0070676_10058322 | Ga0070676_100583222 | 127 |
| 76 | 3300005330 | Ga0070690_100038855 | Ga0070690_1000388553 | 127 |
| 77 | 3300005331 | Ga0070670_100051863 | Ga0070670_1000518632 | 127 |
| 78 | 3300005331 | Ga0070670_100131484 | Ga0070670_1001314843 | 127 |
| 79 | 3300005331 | Ga0070670_100378774 | Ga0070670_1003787742 | 127 |
| 80 | 3300005331 | Ga0070670_100585410 | Ga0070670_1005854101 | 127 |
| 81 | 3300005331 | Ga0070670_101885340 | Ga0070670_1018853401 | 127 |
| 82 | 3300005333 | Ga0070677_10019645 | Ga0070677_100196452 | 127 |
| 83 | 3300005334 | Ga0068869_100003090 | Ga0068869_1000030904 | 127 |
| 84 | 3300005335 | Ga0070666_10022076 | Ga0070666_100220764 | 127 |
| 85 | 3300005337 | Ga0070682_100393387 | Ga0070682_1003933872 | 127 |
| 86 | 3300005338 | Ga0068868_100017805 | Ga0068868_1000178053 | 127 |
| 87 | 3300005338 | Ga0068868_100130948 | Ga0068868_1001309482 | 127 |
| 88 | 3300005338 | Ga0068868_100390782 | Ga0068868_1003907822 | 127 |
| 89 | 3300005343 | Ga0070687_100039551 | Ga0070687_1000395513 | 127 |
| 90 | 3300005344 | Ga0070661_100623375 | Ga0070661_1006233752 | 127 |
| 91 | 3300005347 | Ga0070668_100062059 | Ga0070668_1000620593 | 127 |
| 92 | 3300005347 | Ga0070668_100224482 | Ga0070668_1002244823 | 127 |
| 93 | 3300005347 | Ga0070668_101157773 | Ga0070668_1011577732 | 127 |
| 94 | 3300005353 | Ga0070669_100001206 | Ga0070669_1000012069 | 127 |
| 95 | 3300005353 | Ga0070669_100668894 | Ga0070669_1006688942 | 127 |
| 96 | 3300005354 | Ga0070675_100017822 | Ga0070675_1000178224 | 127 |
| 97 | 3300005354 | Ga0070675_100033820 | Ga0070675_1000338203 | 127 |
| 98 | 3300005354 | Ga0070675_100619331 | Ga0070675_1006193312 | 127 |
| 99 | 3300005355 | Ga0070671_100032040 | Ga0070671_1000320404 | 127 |
| 100 | 3300005355 | Ga0070671_100043160 | Ga0070671_1000431602 | 127 |
| 101 | 3300005355 | Ga0070671_100205891 | Ga0070671_1002058912 | 127 |
| 102 | 3300005355 | Ga0070671_100711825 | Ga0070671_1007118252 | 127 |
| 103 | 3300005355 | Ga0070671_101550603 | Ga0070671_1015506032 | 127 |
| 104 | 3300005356 | Ga0070674_100014161 | Ga0070674_1000141613 | 127 |
| 105 | 3300005364 | Ga0070673_100204149 | Ga0070673_1002041492 | 127 |
| 106 | 3300005364 | Ga0070673_100500869 | Ga0070673_1005008692 | 127 |
| 107 | 3300005365 | Ga0070688_101170838 | Ga0070688_1011708381 | 127 |
| 108 | 3300005366 | Ga0070659_100463780 | Ga0070659_1004637801 | 127 |
| 109 | 3300005367 | Ga0070667_100002633 | Ga0070667_10000263315 | 127 |
| 110 | 3300005367 | Ga0070667_100887339 | Ga0070667_1008873391 | 127 |
| 111 | 3300005367 | Ga0070667_101170002 | Ga0070667_1011700022 | 127 |
| 112 | 3300005441 | Ga0070700_100052200 | Ga0070700_1000522001 | 127 |
| 113 | 3300005441 | Ga0070700_100654928 | Ga0070700_1006549282 | 127 |
| 114 | 3300005455 | Ga0070663_100051669 | Ga0070663_1000516692 | 127 |
| 115 | 3300005455 | Ga0070663_100400065 | Ga0070663_1004000652 | 127 |
| 116 | 3300005456 | Ga0070678_100030734 | Ga0070678_1000307345 | 127 |
| 117 | 3300005456 | Ga0070678_100074609 | Ga0070678_1000746093 | 127 |
| 118 | 3300005456 | Ga0070678_100324617 | Ga0070678_1003246172 | 127 |
| 119 | 3300005456 | Ga0070678_100400392 | Ga0070678_1004003922 | 127 |
| 120 | 3300005456 | Ga0070678_100963576 | Ga0070678_1009635762 | 127 |
| 121 | 3300005456 | Ga0070678_101671779 | Ga0070678_1016717791 | 127 |
| 122 | 3300005457 | Ga0070662_100023758 | Ga0070662_1000237584 | 127 |
| 123 | 3300005459 | Ga0068867_100021275 | Ga0068867_1000212753 | 127 |
| 124 | 3300005459 | Ga0068867_100039799 | Ga0068867_1000397993 | 127 |
| 125 | 3300005459 | Ga0068867_100171805 | Ga0068867_1001718052 | 127 |
| 126 | 3300005459 | Ga0068867_100384636 | Ga0068867_1003846362 | 127 |
| 127 | 3300005543 | Ga0070672_100017686 | Ga0070672_1000176863 | 127 |
| 128 | 3300005543 | Ga0070672_100032502 | Ga0070672_1000325024 | 127 |
| 129 | 3300005543 | Ga0070672_100073820 | Ga0070672_1000738204 | 127 |
| 130 | 3300005543 | Ga0070672_100075948 | Ga0070672_1000759482 | 127 |
| 131 | 3300005543 | Ga0070672_100126400 | Ga0070672_1001264002 | 127 |
| 132 | 3300005543 | Ga0070672_100142779 | Ga0070672_1001427792 | 127 |
| 133 | 3300005543 | Ga0070672_100254968 | Ga0070672_1002549682 | 127 |
| 134 | 3300005543 | Ga0070672_101212177 | Ga0070672_1012121772 | 127 |
| 135 | 3300005544 | Ga0070686_100154751 | Ga0070686_1001547512 | 127 |
| 136 | 3300005547 | Ga0070693_100558878 | Ga0070693_1005588781 | 127 |
| 137 | 3300005548 | Ga0070665_100127782 | Ga0070665_1001277824 | 127 |
| 138 | 3300005564 | Ga0070664_100284181 | Ga0070664_1002841812 | 127 |
| 139 | 3300005564 | Ga0070664_100394467 | Ga0070664_1003944672 | 127 |
| 140 | 3300005564 | Ga0070664_100614614 | Ga0070664_1006146142 | 127 |
| 141 | 3300005564 | Ga0070664_100823375 | Ga0070664_1008233752 | 127 |
| 142 | 3300005578 | Ga0068854_100045930 | Ga0068854_1000459304 | 127 |
| 143 | 3300005578 | Ga0068854_100167639 | Ga0068854_1001676391 | 127 |
| 144 | 3300005615 | Ga0070702_100416260 | Ga0070702_1004162602 | 127 |
| 145 | 3300005616 | Ga0068852_100016022 | Ga0068852_1000160223 | 127 |
| 146 | 3300005616 | Ga0068852_100420960 | Ga0068852_1004209602 | 127 |
| 147 | 3300005616 | Ga0068852_100704648 | Ga0068852_1007046482 | 127 |
| 148 | 3300005617 | Ga0068859_100074580 | Ga0068859_1000745803 | 127 |
| 149 | 3300005618 | Ga0068864_100067378 | Ga0068864_1000673784 | 127 |
| 150 | 3300005618 | Ga0068864_100083122 | Ga0068864_1000831223 | 127 |
| 151 | 3300005618 | Ga0068864_100174367 | Ga0068864_1001743672 | 127 |
| 152 | 3300005618 | Ga0068864_101278927 | Ga0068864_1012789272 | 127 |
| 153 | 3300005618 | Ga0068864_101429708 | Ga0068864_1014297082 | 127 |
| 154 | 3300005718 | Ga0068866_10001406 | Ga0068866_1000140610 | 127 |
| 155 | 3300005719 | Ga0068861_100012705 | Ga0068861_1000127056 | 127 |
| 156 | 3300005834 | Ga0068851_10138278 | Ga0068851_101382782 | 127 |
| 157 | 3300005840 | Ga0068870_10148876 | Ga0068870_101488762 | 127 |
| 158 | 3300005840 | Ga0068870_10491230 | Ga0068870_104912302 | 127 |
| 159 | 3300005841 | Ga0068863_100029990 | Ga0068863_1000299903 | 127 |
| 160 | 3300005841 | Ga0068863_100034799 | Ga0068863_1000347996 | 127 |
| 161 | 3300005841 | Ga0068863_100112741 | Ga0068863_1001127414 | 127 |
| 162 | 3300005842 | Ga0068858_100009363 | Ga0068858_10000936310 | 127 |
| 163 | 3300005843 | Ga0068860_100002496 | Ga0068860_10000249610 | 127 |
| 164 | 3300005985 | Ga0081539_10000320 | Ga0081539_10000320100 | 127 |
| 165 | 3300006163 | Ga0070715_10051676 | Ga0070715_100516762 | 127 |
| 166 | 3300006237 | Ga0097621_100019914 | Ga0097621_1000199142 | 127 |
| 167 | 3300006237 | Ga0097621_100101459 | Ga0097621_1001014592 | 127 |
| 168 | 3300006237 | Ga0097621_100587855 | Ga0097621_1005878552 | 127 |
| 169 | 3300006358 | Ga0068871_100031428 | Ga0068871_1000314282 | 127 |
| 170 | 3300006358 | Ga0068871_100059216 | Ga0068871_1000592164 | 127 |
| 171 | 3300006358 | Ga0068871_100262925 | Ga0068871_1002629252 | 127 |
| 172 | 3300006881 | Ga0068865_100003788 | Ga0068865_1000037888 | 127 |
| 173 | 3300006931 | Ga0097620_100074582 | Ga0097620_1000745823 | 127 |
| 174 | 3300009094 | Ga0111539_10423266 | Ga0111539_104232662 | 127 |
| 175 | 3300009098 | Ga0105245_10130321 | Ga0105245_101303212 | 127 |
| 176 | 3300009148 | Ga0105243_10024982 | Ga0105243_100249823 | 127 |
| 177 | 3300009148 | Ga0105243_10594878 | Ga0105243_105948782 | 127 |
| 178 | 3300009148 | Ga0105243_11721443 | Ga0105243_117214432 | 127 |
| 179 | 3300009176 | Ga0105242_10025684 | Ga0105242_100256843 | 127 |
| 180 | 3300009177 | Ga0105248_10067988 | Ga0105248_100679884 | 127 |
| 181 | 3300009177 | Ga0105248_10073497 | Ga0105248_100734973 | 127 |
| 182 | 3300009177 | Ga0105248_10184852 | Ga0105248_101848522 | 127 |
| 183 | 3300009177 | Ga0105248_11565024 | Ga0105248_115650242 | 127 |
| 184 | 3300009177 | Ga0105248_12356011 | Ga0105248_123560112 | 127 |
| 185 | 3300009551 | Ga0105238_10338328 | Ga0105238_103383282 | 127 |
| 186 | 3300009553 | Ga0105249_10008866 | Ga0105249_100088669 | 127 |
| 187 | 3300009553 | Ga0105249_10436145 | Ga0105249_104361452 | 127 |
| 188 | 3300009553 | Ga0105249_10598882 | Ga0105249_105988822 | 127 |
| 189 | 3300013102 | Ga0157371_10660194 | Ga0157371_106601942 | 127 |
| 190 | 3300013297 | Ga0157378_10340192 | Ga0157378_103401923 | 127 |
| 191 | 3300013306 | Ga0163162_10056904 | Ga0163162_100569044 | 127 |
| 192 | 3300013306 | Ga0163162_10372034 | Ga0163162_103720342 | 127 |
| 193 | 3300013306 | Ga0163162_10904687 | Ga0163162_109046872 | 127 |
| 194 | 3300013306 | Ga0163162_11888112 | Ga0163162_118881122 | 127 |
| 195 | 3300013308 | Ga0157375_10053665 | Ga0157375_100536653 | 127 |
| 196 | 3300013308 | Ga0157375_10059297 | Ga0157375_100592975 | 127 |
| 197 | 3300013308 | Ga0157375_10064588 | Ga0157375_100645885 | 127 |
| 198 | 3300013308 | Ga0157375_10393892 | Ga0157375_103938922 | 127 |
| 199 | 3300013308 | Ga0157375_11786477 | Ga0157375_117864771 | 127 |
| 200 | 3300014325 | Ga0163163_10155280 | Ga0163163_101552803 | 127 |
| 201 | 3300014325 | Ga0163163_10174885 | Ga0163163_101748853 | 127 |
| 202 | 3300014325 | Ga0163163_10714431 | Ga0163163_107144312 | 127 |
| 203 | 3300014326 | Ga0157380_10214973 | Ga0157380_102149732 | 127 |
| 204 | 3300014326 | Ga0157380_10549955 | Ga0157380_105499552 | 127 |
| 205 | 3300014968 | Ga0157379_10118027 | Ga0157379_101180272 | 127 |
| 206 | 3300014968 | Ga0157379_10279968 | Ga0157379_102799683 | 127 |
| 207 | 3300014968 | Ga0157379_10316046 | Ga0157379_103160462 | 127 |
| 208 | 3300014968 | Ga0157379_10801126 | Ga0157379_108011262 | 127 |
| 209 | 3300014969 | Ga0157376_10022462 | Ga0157376_100224624 | 127 |
| 210 | 3300014969 | Ga0157376_12566013 | Ga0157376_125660131 | 127 |
| 211 | 3300017792 | Ga0163161_10029256 | Ga0163161_100292563 | 127 |
| 212 | 3300017792 | Ga0163161_10295151 | Ga0163161_102951512 | 127 |
| 213 | 3300017792 | Ga0163161_11103790 | Ga0163161_111037902 | 127 |
| 214 | 3300025315 | Ga0207697_10043128 | Ga0207697_100431283 | 127 |
| 215 | 3300025321 | Ga0207656_10200983 | Ga0207656_102009832 | 127 |
| 216 | 3300025893 | Ga0207682_10007682 | Ga0207682_100076824 | 127 |
| 217 | 3300025893 | Ga0207682_10077238 | Ga0207682_100772383 | 127 |
| 218 | 3300025893 | Ga0207682_10172079 | Ga0207682_101720792 | 127 |
| 219 | 3300025893 | Ga0207682_10318607 | Ga0207682_103186072 | 127 |
| 220 | 3300025899 | Ga0207642_10014009 | Ga0207642_100140093 | 127 |
| 221 | 3300025901 | Ga0207688_10030668 | Ga0207688_100306683 | 127 |
| 222 | 3300025903 | Ga0207680_10001775 | Ga0207680_1000177511 | 127 |
| 223 | 3300025905 | Ga0207685_10037589 | Ga0207685_100375892 | 127 |
| 224 | 3300025907 | Ga0207645_10004050 | Ga0207645_100040502 | 127 |
| 225 | 3300025907 | Ga0207645_10018257 | Ga0207645_100182573 | 127 |
| 226 | 3300025907 | Ga0207645_10134112 | Ga0207645_101341122 | 127 |
| 227 | 3300025908 | Ga0207643_10086195 | Ga0207643_100861952 | 127 |
| 228 | 3300025918 | Ga0207662_10072493 | Ga0207662_100724933 | 127 |
| 229 | 3300025920 | Ga0207649_11167286 | Ga0207649_111672862 | 127 |
| 230 | 3300025923 | Ga0207681_10009146 | Ga0207681_100091463 | 127 |
| 231 | 3300025923 | Ga0207681_10170245 | Ga0207681_101702452 | 127 |
| 232 | 3300025925 | Ga0207650_10047025 | Ga0207650_100470252 | 127 |
| 233 | 3300025925 | Ga0207650_10053956 | Ga0207650_100539562 | 127 |
| 234 | 3300025925 | Ga0207650_10875745 | Ga0207650_108757452 | 127 |
| 235 | 3300025925 | Ga0207650_10882410 | Ga0207650_108824102 | 127 |
| 236 | 3300025925 | Ga0207650_11522256 | Ga0207650_115222561 | 127 |
| 237 | 3300025926 | Ga0207659_10055542 | Ga0207659_100555424 | 127 |
| 238 | 3300025926 | Ga0207659_10100787 | Ga0207659_101007873 | 127 |
| 239 | 3300025927 | Ga0207687_10153179 | Ga0207687_101531793 | 127 |
| 240 | 3300025927 | Ga0207687_10786305 | Ga0207687_107863052 | 127 |
| 241 | 3300025931 | Ga0207644_10001677 | Ga0207644_100016776 | 127 |
| 242 | 3300025931 | Ga0207644_10092785 | Ga0207644_100927853 | 127 |
| 243 | 3300025932 | Ga0207690_10247696 | Ga0207690_102476962 | 127 |
| 244 | 3300025933 | Ga0207706_10059142 | Ga0207706_100591423 | 127 |
| 245 | 3300025933 | Ga0207706_10216132 | Ga0207706_102161322 | 127 |
| 246 | 3300025934 | Ga0207686_10686817 | Ga0207686_106868172 | 127 |
| 247 | 3300025935 | Ga0207709_10010461 | Ga0207709_100104613 | 127 |
| 248 | 3300025936 | Ga0207670_10190642 | Ga0207670_101906422 | 127 |
| 249 | 3300025937 | Ga0207669_10002216 | Ga0207669_100022168 | 127 |
| 250 | 3300025937 | Ga0207669_10833720 | Ga0207669_108337201 | 127 |
| 251 | 3300025938 | Ga0207704_10002464 | Ga0207704_100024649 | 127 |
| 252 | 3300025938 | Ga0207704_10076123 | Ga0207704_100761232 | 127 |
| 253 | 3300025940 | Ga0207691_10041764 | Ga0207691_100417643 | 127 |
| 254 | 3300025940 | Ga0207691_10073151 | Ga0207691_100731513 | 127 |
| 255 | 3300025940 | Ga0207691_10092215 | Ga0207691_100922152 | 127 |
| 256 | 3300025940 | Ga0207691_10122192 | Ga0207691_101221923 | 127 |
| 257 | 3300025940 | Ga0207691_10128231 | Ga0207691_101282313 | 127 |
| 258 | 3300025940 | Ga0207691_10692546 | Ga0207691_106925462 | 127 |
| 259 | 3300025941 | Ga0207711_10009406 | Ga0207711_100094064 | 127 |
| 260 | 3300025941 | Ga0207711_10060000 | Ga0207711_100600002 | 127 |
| 261 | 3300025941 | Ga0207711_10079407 | Ga0207711_100794073 | 127 |
| 262 | 3300025941 | Ga0207711_10764149 | Ga0207711_107641492 | 127 |
| 263 | 3300025942 | Ga0207689_10055228 | Ga0207689_100552284 | 127 |
| 264 | 3300025942 | Ga0207689_10389685 | Ga0207689_103896852 | 127 |
| 265 | 3300025945 | Ga0207679_10161207 | Ga0207679_101612072 | 127 |
| 266 | 3300025945 | Ga0207679_10667015 | Ga0207679_106670152 | 127 |
| 267 | 3300025945 | Ga0207679_10718409 | Ga0207679_107184092 | 127 |
| 268 | 3300025945 | Ga0207679_10749790 | Ga0207679_107497902 | 127 |
| 269 | 3300025960 | Ga0207651_10105367 | Ga0207651_101053673 | 127 |
| 270 | 3300025960 | Ga0207651_10111973 | Ga0207651_101119732 | 127 |
| 271 | 3300025960 | Ga0207651_10165585 | Ga0207651_101655853 | 127 |
| 272 | 3300025960 | Ga0207651_10768595 | Ga0207651_107685952 | 127 |
| 273 | 3300025961 | Ga0207712_10018757 | Ga0207712_100187575 | 127 |
| 274 | 3300025972 | Ga0207668_10007368 | Ga0207668_100073686 | 127 |
| 275 | 3300025981 | Ga0207640_10280285 | Ga0207640_102802852 | 127 |
| 276 | 3300025981 | Ga0207640_10384838 | Ga0207640_103848382 | 127 |
| 277 | 3300025986 | Ga0207658_10000764 | Ga0207658_1000076414 | 127 |
| 278 | 3300025986 | Ga0207658_10200684 | Ga0207658_102006843 | 127 |
| 279 | 3300026023 | Ga0207677_10083343 | Ga0207677_100833433 | 127 |
| 280 | 3300026023 | Ga0207677_10100244 | Ga0207677_101002443 | 127 |
| 281 | 3300026035 | Ga0207703_10005845 | Ga0207703_100058453 | 127 |
| 282 | 3300026067 | Ga0207678_10226886 | Ga0207678_102268862 | 127 |
| 283 | 3300026075 | Ga0207708_10006866 | Ga0207708_100068665 | 127 |
| 284 | 3300026088 | Ga0207641_10002081 | Ga0207641_100020813 | 127 |
| 285 | 3300026088 | Ga0207641_10052603 | Ga0207641_100526032 | 127 |
| 286 | 3300026088 | Ga0207641_10094168 | Ga0207641_100941681 | 127 |
| 287 | 3300026089 | Ga0207648_10009660 | Ga0207648_1000966010 | 127 |
| 288 | 3300026089 | Ga0207648_10032136 | Ga0207648_100321364 | 127 |
| 289 | 3300026089 | Ga0207648_10523453 | Ga0207648_105234532 | 127 |
| 290 | 3300026095 | Ga0207676_10017436 | Ga0207676_100174365 | 127 |
| 291 | 3300026095 | Ga0207676_10189558 | Ga0207676_101895583 | 127 |
| 292 | 3300026095 | Ga0207676_10388766 | Ga0207676_103887662 | 127 |
| 293 | 3300026095 | Ga0207676_10681449 | Ga0207676_106814492 | 127 |
| 294 | 3300026095 | Ga0207676_11678536 | Ga0207676_116785362 | 127 |
| 295 | 3300026118 | Ga0207675_100057248 | Ga0207675_1000572482 | 127 |
| 296 | 3300026118 | Ga0207675_100258581 | Ga0207675_1002585812 | 127 |
| 297 | 3300026121 | Ga0207683_10103903 | Ga0207683_101039033 | 127 |
| 298 | 3300026121 | Ga0207683_10355572 | Ga0207683_103555723 | 127 |
| 299 | 3300026142 | Ga0207698_10014208 | Ga0207698_100142085 | 127 |
| 300 | 3300026142 | Ga0207698_10392681 | Ga0207698_103926812 | 127 |
| 301 | 3300028380 | Ga0268265_11276640 | Ga0268265_112766402 | 127 |
| 302 | 3300028381 | Ga0268264_10001240 | Ga0268264_1000124010 | 127 |
| 303 | 3300031456 | Ga0307513_10358310 | Ga0307513_103583103 | 127 |
| 304 | 3300031995 | Ga0307409_100400591 | Ga0307409_1004005912 | 127 |
| 305 | 3300035113 | Ga0373936_0070311 | Ga0373936_0070311_455_844 | 127 |
| 306 | 3300035116 | Ga0373945_0171082 | Ga0373945_0171082_193_579 | 127 |
| 307 | 3300035695 | Ga0373927_0159292 | Ga0373927_0159292_792_1175 | 127 |
| 308 | 3300036401 | Ga0373937_0218681 | Ga0373937_0218681_220_606 | 127 |
| 309 | 3300036401 | Ga0373937_0513718 | Ga0373937_0513718_427_813 | 127 |
| 310 | 3300037068 | Ga0373925_0241618 | Ga0373925_0241618_756_1142 | 127 |
| 311 | 3300041491 | Ga0451833_0839225 | Ga0451833_0839225_45_431 | 127 |
| 312 | 3300041512 | Ga0451853_0817173 | Ga0451853_0817173_291_677 | 127 |
| 313 | 3300042144 | Ga0450889_009208 | Ga0450889_009208_500_889 | 127 |
| 314 | 3300046459 | Ga0495629_0586031 | Ga0495629_0586031_247_633 | 127 |
| 315 | 3300046472 | Ga0495580_0233221 | Ga0495580_0233221_226_612 | 127 |
| 316 | 3300046537 | Ga0495598_0165177 | Ga0495598_0165177_87_473 | 127 |
| 317 | 3300046543 | Ga0495645_0021522 | Ga0495645_0021522_1766_2149 | 127 |
| 318 | 3300046543 | Ga0495645_0089809 | Ga0495645_0089809_1421_1807 | 127 |
| 319 | 3300046678 | Ga0495599_0207682 | Ga0495599_0207682_81_467 | 127 |
| 320 | 3300046681 | Ga0495647_0102851 | Ga0495647_0102851_210_596 | 127 |
| 321 | 3300046683 | Ga0495658_0033869 | Ga0495658_0033869_427_813 | 127 |
| 322 | 3300046683 | Ga0495658_0397552 | Ga0495658_0397552_113_499 | 127 |
| 323 | 3300046683 | Ga0495658_0489227 | Ga0495658_0489227_218_604 | 127 |
| 324 | 3300046691 | Ga0495670_0438956 | Ga0495670_0438956_73_459 | 127 |
| 325 | 3300047322 | Ga0495680_1106836 | Ga0495680_1106836_57_443 | 127 |
| 326 | 3300047470 | Ga0495681_0188980 | Ga0495681_0188980_52_435 | 127 |
| 327 | 3300048090 | Ga0495615_0091114 | Ga0495615_0091114_142_528 | 127 |
| 328 | 3300048903 | Ga0496100_1061635 | Ga0496100_1061635_205_597 | 127 |
| 329 | 3300048908 | Ga0496105_0342263 | Ga0496105_0342263_154_540 | 127 |
| 330 | 3300048908 | Ga0496105_0703686 | Ga0496105_0703686_201_587 | 127 |
| 331 | 3300048911 | Ga0496108_0098332 | Ga0496108_0098332_1309_1695 | 127 |
| 332 | 3300048912 | Ga0496109_0045433 | Ga0496109_0045433_1757_2143 | 127 |
| 333 | 3300048913 | Ga0496110_0264960 | Ga0496110_0264960_673_1059 | 127 |
| 334 | 3300048917 | Ga0496114_1491139 | Ga0496114_1491139_86_472 | 127 |
| 335 | 3300048924 | Ga0496121_0159703 | Ga0496121_0159703_49_432 | 127 |
| 336 | 3300048925 | Ga0496122_0284322 | Ga0496122_0284322_491_874 | 127 |
| 337 | 3300048927 | Ga0496124_0000024 | Ga0496124_0000024_292146_292529 | 127 |
| 338 | 3300049585 | Ga0501069_0117712 | Ga0501069_0117712_292_678 | 127 |
| 339 | 3300049586 | Ga0501070_0412502 | Ga0501070_0412502_40_426 | 127 |
| 340 | 3300049663 | Ga0501223_045638 | Ga0501223_045638_78_461 | 127 |
| 341 | 3300049686 | Ga0501257_014251 | Ga0501257_014251_1360_1743 | 127 |
| 342 | 3300049823 | Ga0501044_0235273 | Ga0501044_0235273_669_1055 | 127 |
| 343 | 3300050511 | nmdc:mga08y16_479996_c1 | nmdc:mga08y16_479996_c1_594_980 | 127 |
| 344 | 3300053118 | Ga0500594_0212333 | Ga0500594_0212333_165_551 | 127 |
| 345 | 3300053128 | Ga0500626_254608 | Ga0500626_254608_111_497 | 127 |
| 346 | 3300053139 | Ga0500568_0246431 | Ga0500568_0246431_97_483 | 127 |
| 347 | 3300060353 | Ga0501082_0086604 | Ga0501082_0086604_936_1322 | 127 |
| 348 | 3300025960 | Ga0207651_10343828 | Ga0207651_103438282 | 128 |
| 349 | 3300009148 | Ga0105243_10826337 | Ga0105243_108263372 | 129 |
| 350 | 3300009174 | Ga0105241_12069392 | Ga0105241_120693922 | 129 |
| 351 | 3300013297 | Ga0157378_10080517 | Ga0157378_100805172 | 129 |
| 352 | 3300013306 | Ga0163162_10376407 | Ga0163162_103764073 | 129 |
| 353 | 3300013308 | Ga0157375_10567190 | Ga0157375_105671902 | 129 |
| 354 | 3300025907 | Ga0207645_10247693 | Ga0207645_102476932 | 129 |
| 355 | 3300046694 | Ga0495649_0023242 | Ga0495649_0023242_1024_1446 | 129 |
| 356 | 3300005444 | Ga0070694_100039963 | Ga0070694_1000399632 | 130 |
| 357 | 3300005536 | Ga0070697_101148350 | Ga0070697_1011483501 | 130 |
| 358 | 3300005545 | Ga0070695_100110428 | Ga0070695_1001104283 | 130 |
| 359 | 3300005577 | Ga0068857_102484380 | Ga0068857_1024843801 | 130 |
| 360 | 3300005617 | Ga0068859_100185512 | Ga0068859_1001855122 | 130 |
| 361 | 3300006931 | Ga0097620_100185502 | Ga0097620_1001855022 | 130 |
| 362 | 3300025911 | Ga0207654_10889562 | Ga0207654_108895622 | 130 |
| 363 | 3300025917 | Ga0207660_10010796 | Ga0207660_100107962 | 130 |
| 364 | 3300026035 | Ga0207703_12364626 | Ga0207703_123646261 | 130 |
| 365 | 3300034816 | Ga0373930_0010070 | Ga0373930_0010070_633_1028 | 130 |
| 366 | 3300034817 | Ga0373948_0038566 | Ga0373948_0038566_479_874 | 130 |
| 367 | 3300035112 | Ga0373932_0024912 | Ga0373932_0024912_863_1255 | 130 |
| 368 | 3300035691 | Ga0373931_0007102 | Ga0373931_0007102_1291_1686 | 130 |
| 369 | 3300042876 | Ga0451577_0190936 | Ga0451577_0190936_369_764 | 130 |
| 370 | 3300044712 | Ga0453684_0354646 | Ga0453684_0354646_965_1357 | 130 |
| 371 | 3300048904 | Ga0496101_0968986 | Ga0496101_0968986_157_552 | 130 |
| 372 | 3300048905 | Ga0496102_0005344 | Ga0496102_0005344_3597_3992 | 130 |
| 373 | 3300048906 | Ga0496103_0102530 | Ga0496103_0102530_860_1255 | 130 |
| 374 | 3300048909 | Ga0496106_0378704 | Ga0496106_0378704_680_1075 | 130 |
| 375 | 3300048912 | Ga0496109_1099907 | Ga0496109_1099907_131_526 | 130 |
| 376 | 3300003203 | JGI25406J46586_10009248 | JGI25406J46586_100092484 | 131 |
| 377 | 3300005406 | Ga0070703_10359549 | Ga0070703_103595491 | 131 |
| 378 | 3300005437 | Ga0070710_10131213 | Ga0070710_101312132 | 131 |
| 379 | 3300005440 | Ga0070705_100061334 | Ga0070705_1000613342 | 131 |
| 380 | 3300005440 | Ga0070705_100205020 | Ga0070705_1002050202 | 131 |
| 381 | 3300005445 | Ga0070708_100189125 | Ga0070708_1001891252 | 131 |
| 382 | 3300005445 | Ga0070708_100889194 | Ga0070708_1008891941 | 131 |
| 383 | 3300005467 | Ga0070706_100166339 | Ga0070706_1001663393 | 131 |
| 384 | 3300005468 | Ga0070707_100404469 | Ga0070707_1004044692 | 131 |
| 385 | 3300005471 | Ga0070698_100066979 | Ga0070698_1000669794 | 131 |
| 386 | 3300005518 | Ga0070699_100442127 | Ga0070699_1004421272 | 131 |
| 387 | 3300005536 | Ga0070697_100057753 | Ga0070697_1000577533 | 131 |
| 388 | 3300005546 | Ga0070696_100176885 | Ga0070696_1001768852 | 131 |
| 389 | 3300005985 | Ga0081539_10000044 | Ga0081539_10000044243 | 131 |
| 390 | 3300006844 | Ga0075428_100062337 | Ga0075428_1000623372 | 131 |
| 391 | 3300006846 | Ga0075430_101657496 | Ga0075430_1016574961 | 131 |
| 392 | 3300006847 | Ga0075431_100017871 | Ga0075431_1000178712 | 131 |
| 393 | 3300006847 | Ga0075431_101616657 | Ga0075431_1016166572 | 131 |
| 394 | 3300006852 | Ga0075433_10019149 | Ga0075433_100191493 | 131 |
| 395 | 3300007265 | Ga0099794_10002456 | Ga0099794_100024563 | 131 |
| 396 | 3300009147 | Ga0114129_10000507 | Ga0114129_1000050744 | 131 |
| 397 | 3300025910 | Ga0207684_10006213 | Ga0207684_100062133 | 131 |
| 398 | 3300025922 | Ga0207646_10180396 | Ga0207646_101803962 | 131 |
| 399 | 3300026089 | Ga0207648_11246776 | Ga0207648_112467761 | 131 |
| 400 | 3300031548 | Ga0307408_101246520 | Ga0307408_1012465201 | 131 |
| 401 | 3300031852 | Ga0307410_10273316 | Ga0307410_102733163 | 131 |
| 402 | 3300037418 | Ga0395900_0516600 | Ga0395900_0516600_155_550 | 131 |
| 403 | 3300037471 | Ga0395905_0591670 | Ga0395905_0591670_511_906 | 131 |
| 404 | 3300045051 | Ga0451576_0004324 | Ga0451576_0004324_8113_8520 | 131 |
| 405 | 3300047318 | Ga0495636_0200990 | Ga0495636_0200990_240_698 | 131 |
| 406 | 3300049570 | Ga0501033_0141443 | Ga0501033_0141443_278_682 | 131 |
| 407 | 3300049572 | Ga0501036_0051217 | Ga0501036_0051217_2497_2901 | 131 |
| 408 | 3300049573 | Ga0501037_0159058 | Ga0501037_0159058_43_447 | 131 |
| 409 | 3300049574 | Ga0501038_0020030 | Ga0501038_0020030_1505_1909 | 131 |
| 410 | 3300049576 | Ga0501040_0011471 | Ga0501040_0011471_3950_4354 | 131 |
| 411 | 3300049577 | Ga0501041_0044240 | Ga0501041_0044240_355_759 | 131 |
| 412 | 3300049579 | Ga0501043_0251870 | Ga0501043_0251870_588_992 | 131 |
| 413 | 3300049580 | Ga0501046_0369862 | Ga0501046_0369862_25_429 | 131 |
| 414 | 3300049588 | Ga0501072_0051947 | Ga0501072_0051947_2423_2827 | 131 |
| 415 | 3300049590 | Ga0501074_0399753 | Ga0501074_0399753_323_727 | 131 |
| 416 | 3300049591 | Ga0501075_0077015 | Ga0501075_0077015_1944_2348 | 131 |
| 417 | 3300049592 | Ga0501076_0089938 | Ga0501076_0089938_1818_2222 | 131 |
| 418 | 3300049593 | Ga0501077_0010748 | Ga0501077_0010748_3388_3792 | 131 |
| 419 | 3300049741 | Ga0501079_0002133 | Ga0501079_0002133_6846_7250 | 131 |
| 420 | 3300049744 | Ga0501083_0059987 | Ga0501083_0059987_1880_2284 | 131 |
| 421 | 3300049824 | Ga0501045_0067106 | Ga0501045_0067106_177_581 | 131 |
| 422 | 3300050507 | nmdc:mga05p37_36371_c1 | nmdc:mga05p37_36371_c1_5218_5613 | 131 |
| 423 | 3300050507 | nmdc:mga05p37_7843_c1 | nmdc:mga05p37_7843_c1_90_485 | 131 |
| 424 | 3300050509 | nmdc:mga0qj67_1267571_c1 | nmdc:mga0qj67_1267571_c1_60_455 | 131 |
| 425 | 3300050510 | nmdc:mga06r32_16918_c1 | nmdc:mga06r32_16918_c1_5213_5608 | 131 |
| 426 | 3300050512 | nmdc:mga0n895_146322_c1 | nmdc:mga0n895_146322_c1_1883_2278 | 131 |
| 427 | 3300050513 | nmdc:mga0rr50_69721_c1 | nmdc:mga0rr50_69721_c1_193_588 | 131 |
| 428 | 3300050514 | nmdc:mga08x19_7383_c1 | nmdc:mga08x19_7383_c1_4262_4657 | 131 |
| 429 | 3300050515 | nmdc:mga0a205_17962_c1 | nmdc:mga0a205_17962_c1_1736_2131 | 131 |
| 430 | 3300053177 | Ga0500636_0288831 | Ga0500636_0288831_62_466 | 131 |
| 431 | 3300054114 | Ga0501084_0002259 | Ga0501084_0002259_6298_6702 | 131 |
| 432 | 3300059421 | Ga0590071_027388 | Ga0590071_027388_173_577 | 131 |
| 433 | 3300059423 | Ga0590074_029636 | Ga0590074_029636_480_884 | 131 |
| 434 | 3300060353 | Ga0501082_0043672 | Ga0501082_0043672_2574_2978 | 131 |
| 435 | 3300061734 | Ga0530510_0006560 | Ga0530510_0006560_3001_3405 | 131 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6d63-assembly2.cif.gz_D | the structure of atzh: a little known member of the atrazine breakdown pathway | 0.9802 | 3 | 128 |
| 6d63-assembly2.cif.gz_D | the structure of atzh: a little known member of the atrazine breakdown pathway | 0.9719 | 3 | 128 |
| 6bju-assembly2.cif.gz_D | the structure of atzh: a little known member of the atrazine breakdown pathway | 0.9703 | 5 | 128 |
| 6bju-assembly1.cif.gz_B | the structure of atzh: a little known member of the atrazine breakdown pathway | 0.9696 | 5 | 128 |
| 6d63-assembly6.cif.gz_K | the structure of atzh: a little known member of the atrazine breakdown pathway | 0.9677 | 3 | 128 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6d63G00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9649 | 3 | 128 | 3.10.450.50 |
| 6bjtB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9526 | 5 | 130 | 3.10.450.50 |
| 6d63G00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9485 | 3 | 128 | 3.10.450.50 |
| 2owpB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9329 | 4 | 129 | 3.10.450.50 |
| 2owpB00 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; | 0.9186 | 4 | 129 | 3.10.450.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F2ZWR8-F1-model_v4 | DUF4440 domain-containing protein | 1.001 | 2 | 117 |
|
| AF-A0A420WPF1-F1-model_v4 | Uncharacterized protein DUF3225 | 0.9918 | 1 | 131 |
|
| AF-A0A1I7L147-F1-model_v4 | DUF4440 domain-containing protein | 0.9891 | 1 | 131 |
|
| AF-A0A2U9UAY7-F1-model_v4 | deleted | 0.988 | 3 | 131 |
|
| AF-A0A420WPF1-F1-model_v4 | Uncharacterized protein DUF3225 | 0.9844 | 1 | 131 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar