F443321

General Info

Members Datasets Scaffolds Average Seq Length
435 263 433 128

Family's Representative Sequence

Representative Sequence 3300009174|Ga0105241_12069392|Ga0105241_120693922
Length 141
Sequence MNDPEINLPDVVAEVTAVFARYEDALVRNRIDVLDELFWASPATVRYGAGENLVGIDAIRAFRAARPSTGLARTLAATVITTFGRDFANAMTEFRRDGDPAVGRQSQTWVRFAAGWRVVAAHVRLTCWALMPRTSPVNRSG

Samples

Sample ID Description Type Environment
1 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
2 2857542790 Achromobacter sp. R-72367 Isolate Unclassified
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
75 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
83 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
148 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
152 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
153 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
154 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
161 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
162 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
174 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
175 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
176 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
181 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
182 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
185 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
198 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
199 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
200 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
201 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
211 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
212 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
213 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
214 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
215 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
219 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
220 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
221 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
224 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
230 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
236 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
237 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
240 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
242 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
252 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
253 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
254 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
255 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
256 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
257 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
258 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
261 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
262 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
263 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.54
Metatranscriptomes 0
Isolates 0.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.53
Nodule 0.46
Rhizoplane 3.45
Rhizosphere 88.74
Stem 0
Stem Tuber 0
Unclassified 4.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10009248 3300003203 Bacteria 4418
2 JGI25406J46586_10010273 3300003203 Bacteria 4158
3 Ga0070658_11519242 3300005327 Bacteria 581
4 Ga0070676_10002242 3300005328 Bacteria 9867
5 Ga0070676_10058322 3300005328 Bacteria 2287
6 Ga0070690_100038855 3300005330 Bacteria 3005
7 Ga0070670_100051863 3300005331 Bacteria 3522
8 Ga0070670_100131484 3300005331 Bacteria 2161
9 Ga0070670_100378774 3300005331 Bacteria 1246
10 Ga0070670_100585410 3300005331 Bacteria 997
11 Ga0070670_101885340 3300005331 Bacteria 550
12 Ga0070677_10019645 3300005333 Bacteria 2450
13 Ga0068869_100003090 3300005334 Bacteria 10142
14 Ga0070666_10022076 3300005335 Bacteria 4130
15 Ga0070682_100393387 3300005337 Bacteria 1046
16 Ga0068868_100017805 3300005338 Bacteria 5299
17 Ga0068868_100130948 3300005338 Bacteria 2052
18 Ga0068868_100390782 3300005338 Bacteria 1199
19 Ga0070687_100039551 3300005343 Bacteria 2371
20 Ga0070661_100623375 3300005344 Bacteria 873
21 Ga0070668_100062059 3300005347 Bacteria 2895
22 Ga0070668_100224482 3300005347 Bacteria 1551
23 Ga0070668_101157773 3300005347 Bacteria 699
24 Ga0070669_100001206 3300005353 Bacteria 18816
25 Ga0070669_100328958 3300005353 Bacteria 1236
26 Ga0070669_100668894 3300005353 Bacteria 875
27 Ga0070675_100017822 3300005354 Bacteria 5649
28 Ga0070675_100033820 3300005354 Bacteria 4145
29 Ga0070675_100619331 3300005354 Bacteria 982
30 Ga0070675_100805022 3300005354 Bacteria 859
31 Ga0070671_100032040 3300005355 Bacteria 4346
32 Ga0070671_100043160 3300005355 Bacteria 3748
33 Ga0070671_100205891 3300005355 Bacteria 1668
34 Ga0070671_100711825 3300005355 Bacteria 871
35 Ga0070671_101512995 3300005355 Bacteria 594
36 Ga0070671_101550603 3300005355 Bacteria 587
37 Ga0070674_100014161 3300005356 Bacteria 4952
38 Ga0070673_100204149 3300005364 Bacteria 1703
39 Ga0070673_100475066 3300005364 Bacteria 1128
40 Ga0070673_100500869 3300005364 Bacteria 1098
41 Ga0070688_101170838 3300005365 Bacteria 617
42 Ga0070659_100463780 3300005366 Bacteria 1076
43 Ga0070667_100002633 3300005367 Bacteria 15542
44 Ga0070667_100021138 3300005367 Bacteria 5407
45 Ga0070667_100887339 3300005367 Bacteria 830
46 Ga0070667_101170002 3300005367 Bacteria 719
47 Ga0070703_10359549 3300005406 Bacteria 624
48 Ga0070710_10131213 3300005437 Bacteria 1528
49 Ga0070705_100061334 3300005440 Bacteria 2234
50 Ga0070705_100205020 3300005440 Bacteria 1355
51 Ga0070700_100052200 3300005441 Bacteria 2548
52 Ga0070700_100654928 3300005441 Bacteria 830
53 Ga0070694_100039963 3300005444 Bacteria 3125
54 Ga0070708_100189125 3300005445 Bacteria 1925
55 Ga0070708_100889194 3300005445 Bacteria 836
56 Ga0070663_100051669 3300005455 Bacteria 2929
57 Ga0070663_100400065 3300005455 Bacteria 1122
58 Ga0070678_100030734 3300005456 Bacteria 3695
59 Ga0070678_100074609 3300005456 Bacteria 2550
60 Ga0070678_100324617 3300005456 Bacteria 1315
61 Ga0070678_100400392 3300005456 Bacteria 1192
62 Ga0070678_100963576 3300005456 Bacteria 783
63 Ga0070678_101671779 3300005456 Unclassified 599
64 Ga0070662_100023758 3300005457 Bacteria 4215
65 Ga0068867_100021275 3300005459 Bacteria 4629
66 Ga0068867_100039799 3300005459 Bacteria 3428
67 Ga0068867_100171805 3300005459 Bacteria 1717
68 Ga0068867_100384636 3300005459 Bacteria 1179
69 Ga0070706_100166339 3300005467 Bacteria 2059
70 Ga0070707_100404469 3300005468 Bacteria 1325
71 Ga0070698_100066979 3300005471 Bacteria 3612
72 Ga0070699_100442127 3300005518 Bacteria 1178
73 Ga0070697_100057753 3300005536 Bacteria 3157
74 Ga0070697_101148350 3300005536 Bacteria 692
75 Ga0068853_100082427 3300005539 Bacteria 2817
76 Ga0070672_100017686 3300005543 Bacteria 5136
77 Ga0070672_100032502 3300005543 Bacteria 3938
78 Ga0070672_100073820 3300005543 Bacteria 2719
79 Ga0070672_100075948 3300005543 Bacteria 2683
80 Ga0070672_100126400 3300005543 Bacteria 2097
81 Ga0070672_100142779 3300005543 Bacteria 1976
82 Ga0070672_100254968 3300005543 Bacteria 1478
83 Ga0070672_101212177 3300005543 Bacteria 673
84 Ga0070686_100154751 3300005544 Bacteria 1609
85 Ga0070695_100110428 3300005545 Bacteria 1865
86 Ga0070696_100176885 3300005546 Bacteria 1581
87 Ga0070693_100558878 3300005547 Bacteria 820
88 Ga0070665_100127782 3300005548 Bacteria 2544
89 Ga0068855_100002197 3300005563 Bacteria 24123
90 Ga0070664_100284181 3300005564 Bacteria 1492
91 Ga0070664_100394467 3300005564 Bacteria 1265
92 Ga0070664_100614614 3300005564 Bacteria 1008
93 Ga0070664_100823375 3300005564 Bacteria 869
94 Ga0068857_102484380 3300005577 Bacteria 509
95 Ga0068854_100045930 3300005578 Bacteria 3108
96 Ga0068854_100167639 3300005578 Bacteria 1706
97 Ga0068856_100027049 3300005614 Bacteria 5596
98 Ga0070702_100416260 3300005615 Bacteria 966
99 Ga0068852_100016022 3300005616 Bacteria 5836
100 Ga0068852_100420960 3300005616 Bacteria 1317
101 Ga0068852_100704648 3300005616 Bacteria 1020
102 Ga0068859_100074580 3300005617 Bacteria 3432
103 Ga0068859_100185512 3300005617 Bacteria 2164
104 Ga0068864_100067378 3300005618 Bacteria 3108
105 Ga0068864_100083122 3300005618 Bacteria 2811
106 Ga0068864_100174367 3300005618 Bacteria 1962
107 Ga0068864_101278927 3300005618 Bacteria 734
108 Ga0068864_101429708 3300005618 Bacteria 694
109 Ga0068866_10001406 3300005718 Bacteria 10360
110 Ga0068861_100012705 3300005719 Bacteria 5876
111 Ga0068851_10138278 3300005834 Bacteria 1323
112 Ga0068870_10148876 3300005840 Bacteria 1377
113 Ga0068870_10491230 3300005840 Bacteria 816
114 Ga0068863_100029990 3300005841 Bacteria 5195
115 Ga0068863_100034799 3300005841 Bacteria 4797
116 Ga0068863_100112741 3300005841 Bacteria 2589
117 Ga0068858_100009363 3300005842 Bacteria 9350
118 Ga0068860_100002496 3300005843 Bacteria 19308
119 Ga0081539_10000044 3300005985 Bacteria 284021
120 Ga0081539_10000320 3300005985 Bacteria 106935
121 Ga0070717_10455452 3300006028 Bacteria 1153
122 Ga0075364_10025958 3300006051 Bacteria 3733
123 Ga0070715_10051676 3300006163 Bacteria 1770
124 Ga0097621_100019914 3300006237 Bacteria 5162
125 Ga0097621_100101459 3300006237 Bacteria 2421
126 Ga0097621_100587855 3300006237 Bacteria 1016
127 Ga0068871_100031428 3300006358 Bacteria 4188
128 Ga0068871_100059216 3300006358 Bacteria 3120
129 Ga0068871_100262925 3300006358 Bacteria 1505
130 Ga0075428_100062337 3300006844 Bacteria 4082
131 Ga0075430_101657496 3300006846 Bacteria 525
132 Ga0075431_100017871 3300006847 Bacteria 7212
133 Ga0075431_101616657 3300006847 Bacteria 605
134 Ga0075433_10019149 3300006852 Bacteria 5695
135 Ga0068865_100003788 3300006881 Bacteria 9081
136 Ga0097620_100074582 3300006931 Bacteria 3432
137 Ga0097620_100185502 3300006931 Bacteria 2164
138 Ga0079104_1000388 3300006946 Bacteria 51046
139 Ga0099794_10002456 3300007265 Bacteria 6836
140 Ga0105240_10024203 3300009093 Bacteria 8013
141 Ga0111539_10423266 3300009094 Bacteria 1551
142 Ga0105245_10130321 3300009098 Bacteria 2358
143 Ga0114129_10000507 3300009147 Bacteria 47550
144 Ga0105243_10024982 3300009148 Bacteria 4562
145 Ga0105243_10202186 3300009148 Bacteria 1743
146 Ga0105243_10594878 3300009148 Bacteria 1064
147 Ga0105243_10826337 3300009148 Bacteria 915
148 Ga0105243_11721443 3300009148 Bacteria 656
149 Ga0105241_12069392 3300009174 Bacteria 562
150 Ga0105242_10025684 3300009176 Bacteria 4664
151 Ga0105248_10067988 3300009177 Bacteria 4000
152 Ga0105248_10073497 3300009177 Bacteria 3842
153 Ga0105248_10184852 3300009177 Bacteria 2349
154 Ga0105248_11565024 3300009177 Bacteria 747
155 Ga0105248_12356011 3300009177 Bacteria 606
156 Ga0105238_10053165 3300009551 Bacteria 4070
157 Ga0105238_10338328 3300009551 Unclassified 1493
158 Ga0105249_10008866 3300009553 Bacteria 8785
159 Ga0105249_10436145 3300009553 Bacteria 1347
160 Ga0105249_10598882 3300009553 Bacteria 1157
161 Ga0105239_10643293 3300010375 Bacteria 1211
162 Ga0157371_10660194 3300013102 Bacteria 781
163 Ga0157378_10080517 3300013297 Bacteria 2942
164 Ga0157378_10340192 3300013297 Bacteria 1463
165 Ga0163162_10056904 3300013306 Bacteria 3938
166 Ga0163162_10372034 3300013306 Bacteria 1562
167 Ga0163162_10376407 3300013306 Bacteria 1553
168 Ga0163162_10904687 3300013306 Bacteria 995
169 Ga0163162_11888112 3300013306 Bacteria 684
170 Ga0157375_10053665 3300013308 Bacteria 3967
171 Ga0157375_10059297 3300013308 Bacteria 3791
172 Ga0157375_10064588 3300013308 Bacteria 3645
173 Ga0157375_10393892 3300013308 Bacteria 1552
174 Ga0157375_10567190 3300013308 Bacteria 1296
175 Ga0157375_11786477 3300013308 Bacteria 729
176 Ga0163163_10155280 3300014325 Bacteria 2333
177 Ga0163163_10174885 3300014325 Bacteria 2193
178 Ga0163163_10714431 3300014325 Bacteria 1066
179 Ga0157380_10214973 3300014326 Bacteria 1716
180 Ga0157380_10549955 3300014326 Bacteria 1132
181 Ga0157379_10118027 3300014968 Bacteria 2386
182 Ga0157379_10250597 3300014968 Bacteria 1607
183 Ga0157379_10279968 3300014968 Bacteria 1518
184 Ga0157379_10316046 3300014968 Bacteria 1425
185 Ga0157379_10801126 3300014968 Bacteria 889
186 Ga0157376_10022462 3300014969 Bacteria 4919
187 Ga0157376_12566013 3300014969 Bacteria 549
188 Ga0163161_10029256 3300017792 Bacteria 3916
189 Ga0163161_10295151 3300017792 Bacteria 1275
190 Ga0163161_11103790 3300017792 Bacteria 682
191 Ga0207697_10043128 3300025315 Bacteria 1855
192 Ga0207656_10200983 3300025321 Bacteria 963
193 Ga0207682_10007682 3300025893 Bacteria 4291
194 Ga0207682_10077238 3300025893 Bacteria 1420
195 Ga0207682_10172079 3300025893 Bacteria 985
196 Ga0207682_10318607 3300025893 Bacteria 730
197 Ga0207642_10014009 3300025899 Bacteria 2944
198 Ga0207688_10030668 3300025901 Bacteria 2966
199 Ga0207680_10001775 3300025903 Bacteria 10181
200 Ga0207685_10037589 3300025905 Bacteria 1784
201 Ga0207645_10004050 3300025907 Bacteria 10921
202 Ga0207645_10018257 3300025907 Bacteria 4619
203 Ga0207645_10134112 3300025907 Bacteria 1612
204 Ga0207645_10247693 3300025907 Bacteria 1178
205 Ga0207643_10086195 3300025908 Bacteria 1825
206 Ga0207684_10006213 3300025910 Bacteria 10907
207 Ga0207654_10889562 3300025911 Bacteria 645
208 Ga0207660_10010796 3300025917 Bacteria 5936
209 Ga0207662_10072493 3300025918 Bacteria 2087
210 Ga0207649_11167286 3300025920 Bacteria 608
211 Ga0207646_10180396 3300025922 Bacteria 1907
212 Ga0207681_10009146 3300025923 Bacteria 6050
213 Ga0207681_10170245 3300025923 Bacteria 1650
214 Ga0207650_10047025 3300025925 Bacteria 3178
215 Ga0207650_10053956 3300025925 Bacteria 2980
216 Ga0207650_10875745 3300025925 Bacteria 762
217 Ga0207650_10882410 3300025925 Bacteria 759
218 Ga0207650_11522256 3300025925 Bacteria 568
219 Ga0207659_10055542 3300025926 Bacteria 2833
220 Ga0207659_10100787 3300025926 Bacteria 2176
221 Ga0207687_10153179 3300025927 Bacteria 1761
222 Ga0207687_10786305 3300025927 Bacteria 811
223 Ga0207644_10001677 3300025931 Bacteria 14280
224 Ga0207644_10092785 3300025931 Bacteria 2253
225 Ga0207690_10247696 3300025932 Bacteria 1375
226 Ga0207706_10059142 3300025933 Bacteria 3375
227 Ga0207706_10216132 3300025933 Bacteria 1679
228 Ga0207686_10686817 3300025934 Bacteria 813
229 Ga0207709_10010461 3300025935 Bacteria 5106
230 Ga0207709_10384815 3300025935 Bacteria 1068
231 Ga0207670_10190642 3300025936 Bacteria 1551
232 Ga0207669_10002216 3300025937 Bacteria 8257
233 Ga0207669_10833720 3300025937 Bacteria 766
234 Ga0207704_10002464 3300025938 Bacteria 8336
235 Ga0207704_10076123 3300025938 Bacteria 2149
236 Ga0207691_10041764 3300025940 Bacteria 4232
237 Ga0207691_10073151 3300025940 Bacteria 3091
238 Ga0207691_10092215 3300025940 Bacteria 2712
239 Ga0207691_10122192 3300025940 Bacteria 2306
240 Ga0207691_10128231 3300025940 Bacteria 2243
241 Ga0207691_10692546 3300025940 Bacteria 860
242 Ga0207711_10009406 3300025941 Bacteria 8160
243 Ga0207711_10060000 3300025941 Bacteria 3277
244 Ga0207711_10079407 3300025941 Bacteria 2864
245 Ga0207711_10764149 3300025941 Bacteria 901
246 Ga0207689_10055228 3300025942 Bacteria 3269
247 Ga0207689_10389685 3300025942 Bacteria 1161
248 Ga0207679_10161207 3300025945 Bacteria 1836
249 Ga0207679_10667015 3300025945 Bacteria 942
250 Ga0207679_10718409 3300025945 Bacteria 907
251 Ga0207679_10749790 3300025945 Bacteria 888
252 Ga0207667_10011668 3300025949 Bacteria 10195
253 Ga0207651_10105367 3300025960 Bacteria 2103
254 Ga0207651_10111973 3300025960 Bacteria 2051
255 Ga0207651_10165585 3300025960 Bacteria 1738
256 Ga0207651_10196189 3300025960 Bacteria 1614
257 Ga0207651_10343828 3300025960 Bacteria 1254
258 Ga0207651_10768595 3300025960 Bacteria 852
259 Ga0207712_10018757 3300025961 Bacteria 4510
260 Ga0207668_10007368 3300025972 Bacteria 6539
261 Ga0207640_10280285 3300025981 Bacteria 1309
262 Ga0207640_10384838 3300025981 Bacteria 1138
263 Ga0207658_10000764 3300025986 Bacteria 27551
264 Ga0207658_10014317 3300025986 Bacteria 5432
265 Ga0207658_10200684 3300025986 Bacteria 1665
266 Ga0207677_10083343 3300026023 Bacteria 2301
267 Ga0207677_10100244 3300026023 Bacteria 2129
268 Ga0207703_10005845 3300026035 Bacteria 9852
269 Ga0207703_12364626 3300026035 Bacteria 507
270 Ga0207639_10065441 3300026041 Bacteria 2822
271 Ga0207678_10226886 3300026067 Bacteria 1599
272 Ga0207708_10006866 3300026075 Bacteria 8419
273 Ga0207641_10002081 3300026088 Bacteria 18972
274 Ga0207641_10052603 3300026088 Bacteria 3449
275 Ga0207641_10094168 3300026088 Bacteria 2626
276 Ga0207648_10009660 3300026089 Bacteria 9225
277 Ga0207648_10032136 3300026089 Bacteria 4637
278 Ga0207648_10286788 3300026089 Bacteria 1473
279 Ga0207648_10523453 3300026089 Bacteria 1087
280 Ga0207648_11246776 3300026089 Bacteria 698
281 Ga0207676_10017436 3300026095 Bacteria 5203
282 Ga0207676_10189558 3300026095 Bacteria 1808
283 Ga0207676_10388766 3300026095 Bacteria 1300
284 Ga0207676_10681449 3300026095 Bacteria 994
285 Ga0207676_11678536 3300026095 Bacteria 633
286 Ga0207675_100057248 3300026118 Bacteria 3637
287 Ga0207675_100258581 3300026118 Bacteria 1687
288 Ga0207683_10103903 3300026121 Bacteria 2538
289 Ga0207683_10355572 3300026121 Bacteria 1345
290 Ga0207698_10014208 3300026142 Bacteria 5284
291 Ga0207698_10392681 3300026142 Bacteria 1323
292 Ga0209281_1000093 3300027111 Bacteria 240724
293 Ga0268265_11276640 3300028380 Bacteria 734
294 Ga0268264_10001240 3300028381 Bacteria 24403
295 Ga0307512_10146976 3300030522 Bacteria 1422
296 Ga0307513_10358310 3300031456 Bacteria 1204
297 Ga0307509_10007099 3300031507 Bacteria 14778
298 Ga0307408_100256156 3300031548 Bacteria 1446
299 Ga0307408_101246520 3300031548 Bacteria 695
300 Ga0307514_10047161 3300031649 Bacteria 3364
301 Ga0307405_11053478 3300031731 Bacteria 697
302 Ga0307518_10199172 3300031838 Bacteria 1332
303 Ga0307410_10273316 3300031852 Bacteria 1323
304 Ga0307406_10799138 3300031901 Bacteria 796
305 Ga0307407_11280572 3300031903 Bacteria 575
306 Ga0307409_100400591 3300031995 Bacteria 1311
307 Ga0307411_10089223 3300032005 Bacteria 2147
308 Ga0307510_10026478 3300033180 Bacteria 6663
309 Ga0373930_0010070 3300034816 Bacteria 1682
310 Ga0373948_0038566 3300034817 Bacteria 991
311 Ga0373944_0294824 3300035089 Bacteria 608
312 Ga0373932_0024912 3300035112 Bacteria 1615
313 Ga0373936_0017536 3300035113 Unclassified 2758
314 Ga0373936_0070311 3300035113 Bacteria 1441
315 Ga0373945_0171082 3300035116 Bacteria 890
316 Ga0373953_0322960 3300035117 Bacteria 675
317 Ga0373943_0397944 3300035170 Bacteria 795
318 Ga0373931_0007102 3300035691 Bacteria 5266
319 Ga0373935_0526214 3300035692 Bacteria 860
320 Ga0373927_0159292 3300035695 Bacteria 1479
321 Ga0373933_0281439 3300035724 Bacteria 1075
322 Ga0373937_0218681 3300036401 Bacteria 1793
323 Ga0373937_0368832 3300036401 Bacteria 1361
324 Ga0373937_0513718 3300036401 Bacteria 1138
325 Ga0373925_0205625 3300037068 Bacteria 1567
326 Ga0373925_0241618 3300037068 Bacteria 1446
327 Ga0395900_0516600 3300037418 Bacteria 1143
328 Ga0395905_0591670 3300037471 Bacteria 1011
329 Ga0451833_0839225 3300041491 Bacteria 864
330 Ga0451853_0817173 3300041512 Bacteria 790
331 Ga0450889_009208 3300042144 Bacteria 1010
332 Ga0451577_0190936 3300042876 Bacteria 1848
333 Ga0453684_0354646 3300044712 Bacteria 1653
334 Ga0451576_0004324 3300045051 Bacteria 18558
335 Ga0495592_0001645 3300046454 Bacteria 15657
336 Ga0495629_0586031 3300046459 Bacteria 747
337 Ga0495580_0233221 3300046472 Bacteria 1263
338 Ga0495628_0895111 3300046516 Bacteria 616
339 Ga0495598_0165177 3300046537 Bacteria 781
340 Ga0495645_0021522 3300046543 Bacteria 4659
341 Ga0495645_0089809 3300046543 Bacteria 2197
342 Ga0495645_0855922 3300046543 Bacteria 542
343 Ga0495668_0119697 3300046616 Bacteria 1440
344 Ga0495599_0207682 3300046678 Bacteria 1202
345 Ga0495646_0124907 3300046680 Bacteria 1453
346 Ga0495647_0102851 3300046681 Bacteria 1185
347 Ga0495647_0383316 3300046681 Bacteria 644
348 Ga0495658_0033869 3300046683 Bacteria 2800
349 Ga0495658_0397552 3300046683 Bacteria 878
350 Ga0495658_0489227 3300046683 Bacteria 787
351 Ga0495670_0438956 3300046691 Bacteria 707
352 Ga0495649_0023242 3300046694 Bacteria 3464
353 Ga0495600_0447332 3300046809 Bacteria 799
354 Ga0495636_0200990 3300047318 Unclassified 910
355 Ga0495680_1106836 3300047322 Bacteria 500
356 Ga0495681_0188980 3300047470 Bacteria 842
357 Ga0495686_0001156 3300047472 Bacteria 30978
358 Ga0495686_0285326 3300047472 Bacteria 916
359 Ga0495615_0091114 3300048090 Bacteria 850
360 Ga0496100_1061635 3300048903 Bacteria 638
361 Ga0496101_0968986 3300048904 Bacteria 669
362 Ga0496102_0005344 3300048905 Bacteria 10902
363 Ga0496102_0042380 3300048905 Bacteria 4124
364 Ga0496103_0102530 3300048906 Bacteria 1812
365 Ga0496103_0403241 3300048906 Unclassified 878
366 Ga0496105_0342263 3300048908 Bacteria 1196
367 Ga0496105_0703686 3300048908 Bacteria 775
368 Ga0496106_0378704 3300048909 Bacteria 1137
369 Ga0496108_0098332 3300048911 Bacteria 2494
370 Ga0496109_0045433 3300048912 Bacteria 3986
371 Ga0496109_1099907 3300048912 Bacteria 732
372 Ga0496110_0264960 3300048913 Bacteria 1564
373 Ga0496114_0529341 3300048917 Unclassified 1042
374 Ga0496114_1491139 3300048917 Bacteria 564
375 Ga0496116_0012893 3300048919 Bacteria 6785
376 Ga0496117_0000067 3300048920 Bacteria 249348
377 Ga0496118_0000021 3300048921 Bacteria 444988
378 Ga0496119_0144079 3300048922 Unclassified 1283
379 Ga0496120_0077532 3300048923 Unclassified 1808
380 Ga0496121_0029428 3300048924 Bacteria 5078
381 Ga0496121_0159703 3300048924 Bacteria 1650
382 Ga0496122_0284322 3300048925 Unclassified 902
383 Ga0496124_0000024 3300048927 Bacteria 414291
384 Ga0496124_0217109 3300048927 Unclassified 1441
385 Ga0496125_0016059 3300048928 Bacteria 7208
386 Ga0496126_0089871 3300048929 Bacteria 2702
387 Ga0501033_0141443 3300049570 Bacteria 1739
388 Ga0501036_0051217 3300049572 Bacteria 3496
389 Ga0501036_1533956 3300049572 Bacteria 539
390 Ga0501037_0159058 3300049573 Bacteria 1611
391 Ga0501038_0020030 3300049574 Bacteria 6022
392 Ga0501040_0011471 3300049576 Bacteria 5803
393 Ga0501041_0044240 3300049577 Bacteria 2707
394 Ga0501043_0251870 3300049579 Bacteria 1360
395 Ga0501046_0369862 3300049580 Bacteria 1039
396 Ga0501069_0117712 3300049585 Bacteria 1516
397 Ga0501070_0412502 3300049586 Bacteria 1091
398 Ga0501072_0051947 3300049588 Bacteria 3227
399 Ga0501074_0399753 3300049590 Bacteria 974
400 Ga0501075_0077015 3300049591 Bacteria 2523
401 Ga0501076_0089938 3300049592 Bacteria 2468
402 Ga0501077_0010748 3300049593 Bacteria 5700
403 Ga0501223_045638 3300049663 Bacteria 850
404 Ga0501257_014251 3300049686 Bacteria 1826
405 Ga0501079_0002133 3300049741 Bacteria 14228
406 Ga0501083_0059987 3300049744 Bacteria 2543
407 Ga0501044_0235273 3300049823 Bacteria 1778
408 Ga0501045_0067106 3300049824 Bacteria 2634
409 nmdc:mga00v17_75515_c1 3300050491 Bacteria 2096
410 nmdc:mga05p37_36371_c1 3300050507 Bacteria 6041
411 nmdc:mga05p37_7843_c1 3300050507 Bacteria 12601
412 nmdc:mga0qj67_1267571_c1 3300050509 Bacteria 572
413 nmdc:mga06r32_16918_c1 3300050510 Bacteria 6653
414 nmdc:mga08y16_479996_c1 3300050511 Bacteria 1265
415 nmdc:mga0n895_146322_c1 3300050512 Bacteria 2393
416 nmdc:mga0rr50_69721_c1 3300050513 Bacteria 2677
417 nmdc:mga08x19_7383_c1 3300050514 Bacteria 6529
418 nmdc:mga0a205_17962_c1 3300050515 Bacteria 6642
419 Ga0500644_0004926 3300053088 Bacteria 3358
420 Ga0500651_0278727 3300053093 Bacteria 965
421 Ga0500594_0001115 3300053118 Bacteria 5765
422 Ga0500594_0212333 3300053118 Bacteria 638
423 Ga0500626_254608 3300053128 Bacteria 652
424 Ga0500564_114915 3300053138 Bacteria 1178
425 Ga0500568_0246431 3300053139 Bacteria 651
426 Ga0500619_045955 3300053154 Bacteria 1398
427 Ga0500636_0288831 3300053177 Bacteria 814
428 Ga0501084_0002259 3300054114 Bacteria 15478
429 Ga0590071_027388 3300059421 Bacteria 1353
430 Ga0590074_029636 3300059423 Bacteria 964
431 Ga0501082_0043672 3300060353 Bacteria 3865
432 Ga0501082_0086604 3300060353 Bacteria 2702
433 Ga0530510_0006560 3300061734 Bacteria 8109

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009148 Ga0105243_10202186 Ga0105243_102021862 112
2 3300025935 Ga0207709_10384815 Ga0207709_103848152 112
3 3300026089 Ga0207648_10286788 Ga0207648_102867882 112
4 3300046809 Ga0495600_0447332 Ga0495600_0447332_351_731 112
5 3300031901 Ga0307406_10799138 Ga0307406_107991382 117
6 3300005353 Ga0070669_100328958 Ga0070669_1003289582 118
7 3300005354 Ga0070675_100805022 Ga0070675_1008050222 118
8 3300005355 Ga0070671_101512995 Ga0070671_1015129952 118
9 3300005364 Ga0070673_100475066 Ga0070673_1004750662 118
10 3300025960 Ga0207651_10196189 Ga0207651_101961892 118
11 3300031548 Ga0307408_100256156 Ga0307408_1002561562 118
12 3300031731 Ga0307405_11053478 Ga0307405_110534782 118
13 3300031903 Ga0307407_11280572 Ga0307407_112805722 118
14 3300032005 Ga0307411_10089223 Ga0307411_100892232 118
15 3300049572 Ga0501036_1533956 Ga0501036_1533956_52_456 119
16 3300006028 Ga0070717_10455452 Ga0070717_104554521 122
17 3300005563 Ga0068855_100002197 Ga0068855_10000219718 123
18 3300005614 Ga0068856_100027049 Ga0068856_1000270495 123
19 3300009093 Ga0105240_10024203 Ga0105240_100242039 123
20 3300009551 Ga0105238_10053165 Ga0105238_100531652 123
21 3300010375 Ga0105239_10643293 Ga0105239_106432932 123
22 3300014968 Ga0157379_10250597 Ga0157379_102505972 123
23 3300025949 Ga0207667_10011668 Ga0207667_100116688 123
24 iso_pu_bacteria 2675903059 2676479621 123
25 iso_pu_bacteria 2857542790 2857545047 123
26 3300030522 Ga0307512_10146976 Ga0307512_101469762 125
27 3300033180 Ga0307510_10026478 Ga0307510_100264782 125
28 3300035089 Ga0373944_0294824 Ga0373944_0294824_182_559 125
29 3300035117 Ga0373953_0322960 Ga0373953_0322960_68_445 125
30 3300035170 Ga0373943_0397944 Ga0373943_0397944_17_394 125
31 3300035692 Ga0373935_0526214 Ga0373935_0526214_71_448 125
32 3300035724 Ga0373933_0281439 Ga0373933_0281439_152_529 125
33 3300036401 Ga0373937_0368832 Ga0373937_0368832_270_647 125
34 3300037068 Ga0373925_0205625 Ga0373925_0205625_556_933 125
35 3300046516 Ga0495628_0895111 Ga0495628_0895111_164_541 125
36 3300046543 Ga0495645_0855922 Ga0495645_0855922_15_392 125
37 3300046616 Ga0495668_0119697 Ga0495668_0119697_827_1204 125
38 3300046681 Ga0495647_0383316 Ga0495647_0383316_217_594 125
39 3300005367 Ga0070667_100021138 Ga0070667_1000211382 126
40 3300005539 Ga0068853_100082427 Ga0068853_1000824274 126
41 3300006051 Ga0075364_10025958 Ga0075364_100259582 126
42 3300006946 Ga0079104_1000388 Ga0079104_100038833 126
43 3300025986 Ga0207658_10014317 Ga0207658_100143172 126
44 3300026041 Ga0207639_10065441 Ga0207639_100654412 126
45 3300027111 Ga0209281_1000093 Ga0209281_1000093212 126
46 3300031507 Ga0307509_10007099 Ga0307509_100070994 126
47 3300031649 Ga0307514_10047161 Ga0307514_100471612 126
48 3300031838 Ga0307518_10199172 Ga0307518_101991722 126
49 3300035113 Ga0373936_0017536 Ga0373936_0017536_1345_1725 126
50 3300046454 Ga0495592_0001645 Ga0495592_0001645_2084_2464 126
51 3300046680 Ga0495646_0124907 Ga0495646_0124907_21_401 126
52 3300047472 Ga0495686_0001156 Ga0495686_0001156_8825_9220 126
53 3300047472 Ga0495686_0285326 Ga0495686_0285326_385_780 126
54 3300048905 Ga0496102_0042380 Ga0496102_0042380_3457_3837 126
55 3300048906 Ga0496103_0403241 Ga0496103_0403241_424_804 126
56 3300048917 Ga0496114_0529341 Ga0496114_0529341_24_404 126
57 3300048919 Ga0496116_0012893 Ga0496116_0012893_585_965 126
58 3300048920 Ga0496117_0000067 Ga0496117_0000067_232445_232825 126
59 3300048921 Ga0496118_0000021 Ga0496118_0000021_98928_99308 126
60 3300048922 Ga0496119_0144079 Ga0496119_0144079_745_1125 126
61 3300048923 Ga0496120_0077532 Ga0496120_0077532_639_1019 126
62 3300048924 Ga0496121_0029428 Ga0496121_0029428_353_733 126
63 3300048927 Ga0496124_0217109 Ga0496124_0217109_982_1362 126
64 3300048928 Ga0496125_0016059 Ga0496125_0016059_1111_1491 126
65 3300048929 Ga0496126_0089871 Ga0496126_0089871_1466_1846 126
66 3300050491 nmdc:mga00v17_75515_c1 nmdc:mga00v17_75515_c1_955_1335 126
67 3300053088 Ga0500644_0004926 Ga0500644_0004926_1334_1714 126
68 3300053093 Ga0500651_0278727 Ga0500651_0278727_444_824 126
69 3300053118 Ga0500594_0001115 Ga0500594_0001115_4875_5255 126
70 3300053138 Ga0500564_114915 Ga0500564_114915_602_982 126
71 3300053154 Ga0500619_045955 Ga0500619_045955_549_929 126
72 3300003203 JGI25406J46586_10010273 JGI25406J46586_100102731 127
73 3300005327 Ga0070658_11519242 Ga0070658_115192422 127
74 3300005328 Ga0070676_10002242 Ga0070676_100022425 127
75 3300005328 Ga0070676_10058322 Ga0070676_100583222 127
76 3300005330 Ga0070690_100038855 Ga0070690_1000388553 127
77 3300005331 Ga0070670_100051863 Ga0070670_1000518632 127
78 3300005331 Ga0070670_100131484 Ga0070670_1001314843 127
79 3300005331 Ga0070670_100378774 Ga0070670_1003787742 127
80 3300005331 Ga0070670_100585410 Ga0070670_1005854101 127
81 3300005331 Ga0070670_101885340 Ga0070670_1018853401 127
82 3300005333 Ga0070677_10019645 Ga0070677_100196452 127
83 3300005334 Ga0068869_100003090 Ga0068869_1000030904 127
84 3300005335 Ga0070666_10022076 Ga0070666_100220764 127
85 3300005337 Ga0070682_100393387 Ga0070682_1003933872 127
86 3300005338 Ga0068868_100017805 Ga0068868_1000178053 127
87 3300005338 Ga0068868_100130948 Ga0068868_1001309482 127
88 3300005338 Ga0068868_100390782 Ga0068868_1003907822 127
89 3300005343 Ga0070687_100039551 Ga0070687_1000395513 127
90 3300005344 Ga0070661_100623375 Ga0070661_1006233752 127
91 3300005347 Ga0070668_100062059 Ga0070668_1000620593 127
92 3300005347 Ga0070668_100224482 Ga0070668_1002244823 127
93 3300005347 Ga0070668_101157773 Ga0070668_1011577732 127
94 3300005353 Ga0070669_100001206 Ga0070669_1000012069 127
95 3300005353 Ga0070669_100668894 Ga0070669_1006688942 127
96 3300005354 Ga0070675_100017822 Ga0070675_1000178224 127
97 3300005354 Ga0070675_100033820 Ga0070675_1000338203 127
98 3300005354 Ga0070675_100619331 Ga0070675_1006193312 127
99 3300005355 Ga0070671_100032040 Ga0070671_1000320404 127
100 3300005355 Ga0070671_100043160 Ga0070671_1000431602 127
101 3300005355 Ga0070671_100205891 Ga0070671_1002058912 127
102 3300005355 Ga0070671_100711825 Ga0070671_1007118252 127
103 3300005355 Ga0070671_101550603 Ga0070671_1015506032 127
104 3300005356 Ga0070674_100014161 Ga0070674_1000141613 127
105 3300005364 Ga0070673_100204149 Ga0070673_1002041492 127
106 3300005364 Ga0070673_100500869 Ga0070673_1005008692 127
107 3300005365 Ga0070688_101170838 Ga0070688_1011708381 127
108 3300005366 Ga0070659_100463780 Ga0070659_1004637801 127
109 3300005367 Ga0070667_100002633 Ga0070667_10000263315 127
110 3300005367 Ga0070667_100887339 Ga0070667_1008873391 127
111 3300005367 Ga0070667_101170002 Ga0070667_1011700022 127
112 3300005441 Ga0070700_100052200 Ga0070700_1000522001 127
113 3300005441 Ga0070700_100654928 Ga0070700_1006549282 127
114 3300005455 Ga0070663_100051669 Ga0070663_1000516692 127
115 3300005455 Ga0070663_100400065 Ga0070663_1004000652 127
116 3300005456 Ga0070678_100030734 Ga0070678_1000307345 127
117 3300005456 Ga0070678_100074609 Ga0070678_1000746093 127
118 3300005456 Ga0070678_100324617 Ga0070678_1003246172 127
119 3300005456 Ga0070678_100400392 Ga0070678_1004003922 127
120 3300005456 Ga0070678_100963576 Ga0070678_1009635762 127
121 3300005456 Ga0070678_101671779 Ga0070678_1016717791 127
122 3300005457 Ga0070662_100023758 Ga0070662_1000237584 127
123 3300005459 Ga0068867_100021275 Ga0068867_1000212753 127
124 3300005459 Ga0068867_100039799 Ga0068867_1000397993 127
125 3300005459 Ga0068867_100171805 Ga0068867_1001718052 127
126 3300005459 Ga0068867_100384636 Ga0068867_1003846362 127
127 3300005543 Ga0070672_100017686 Ga0070672_1000176863 127
128 3300005543 Ga0070672_100032502 Ga0070672_1000325024 127
129 3300005543 Ga0070672_100073820 Ga0070672_1000738204 127
130 3300005543 Ga0070672_100075948 Ga0070672_1000759482 127
131 3300005543 Ga0070672_100126400 Ga0070672_1001264002 127
132 3300005543 Ga0070672_100142779 Ga0070672_1001427792 127
133 3300005543 Ga0070672_100254968 Ga0070672_1002549682 127
134 3300005543 Ga0070672_101212177 Ga0070672_1012121772 127
135 3300005544 Ga0070686_100154751 Ga0070686_1001547512 127
136 3300005547 Ga0070693_100558878 Ga0070693_1005588781 127
137 3300005548 Ga0070665_100127782 Ga0070665_1001277824 127
138 3300005564 Ga0070664_100284181 Ga0070664_1002841812 127
139 3300005564 Ga0070664_100394467 Ga0070664_1003944672 127
140 3300005564 Ga0070664_100614614 Ga0070664_1006146142 127
141 3300005564 Ga0070664_100823375 Ga0070664_1008233752 127
142 3300005578 Ga0068854_100045930 Ga0068854_1000459304 127
143 3300005578 Ga0068854_100167639 Ga0068854_1001676391 127
144 3300005615 Ga0070702_100416260 Ga0070702_1004162602 127
145 3300005616 Ga0068852_100016022 Ga0068852_1000160223 127
146 3300005616 Ga0068852_100420960 Ga0068852_1004209602 127
147 3300005616 Ga0068852_100704648 Ga0068852_1007046482 127
148 3300005617 Ga0068859_100074580 Ga0068859_1000745803 127
149 3300005618 Ga0068864_100067378 Ga0068864_1000673784 127
150 3300005618 Ga0068864_100083122 Ga0068864_1000831223 127
151 3300005618 Ga0068864_100174367 Ga0068864_1001743672 127
152 3300005618 Ga0068864_101278927 Ga0068864_1012789272 127
153 3300005618 Ga0068864_101429708 Ga0068864_1014297082 127
154 3300005718 Ga0068866_10001406 Ga0068866_1000140610 127
155 3300005719 Ga0068861_100012705 Ga0068861_1000127056 127
156 3300005834 Ga0068851_10138278 Ga0068851_101382782 127
157 3300005840 Ga0068870_10148876 Ga0068870_101488762 127
158 3300005840 Ga0068870_10491230 Ga0068870_104912302 127
159 3300005841 Ga0068863_100029990 Ga0068863_1000299903 127
160 3300005841 Ga0068863_100034799 Ga0068863_1000347996 127
161 3300005841 Ga0068863_100112741 Ga0068863_1001127414 127
162 3300005842 Ga0068858_100009363 Ga0068858_10000936310 127
163 3300005843 Ga0068860_100002496 Ga0068860_10000249610 127
164 3300005985 Ga0081539_10000320 Ga0081539_10000320100 127
165 3300006163 Ga0070715_10051676 Ga0070715_100516762 127
166 3300006237 Ga0097621_100019914 Ga0097621_1000199142 127
167 3300006237 Ga0097621_100101459 Ga0097621_1001014592 127
168 3300006237 Ga0097621_100587855 Ga0097621_1005878552 127
169 3300006358 Ga0068871_100031428 Ga0068871_1000314282 127
170 3300006358 Ga0068871_100059216 Ga0068871_1000592164 127
171 3300006358 Ga0068871_100262925 Ga0068871_1002629252 127
172 3300006881 Ga0068865_100003788 Ga0068865_1000037888 127
173 3300006931 Ga0097620_100074582 Ga0097620_1000745823 127
174 3300009094 Ga0111539_10423266 Ga0111539_104232662 127
175 3300009098 Ga0105245_10130321 Ga0105245_101303212 127
176 3300009148 Ga0105243_10024982 Ga0105243_100249823 127
177 3300009148 Ga0105243_10594878 Ga0105243_105948782 127
178 3300009148 Ga0105243_11721443 Ga0105243_117214432 127
179 3300009176 Ga0105242_10025684 Ga0105242_100256843 127
180 3300009177 Ga0105248_10067988 Ga0105248_100679884 127
181 3300009177 Ga0105248_10073497 Ga0105248_100734973 127
182 3300009177 Ga0105248_10184852 Ga0105248_101848522 127
183 3300009177 Ga0105248_11565024 Ga0105248_115650242 127
184 3300009177 Ga0105248_12356011 Ga0105248_123560112 127
185 3300009551 Ga0105238_10338328 Ga0105238_103383282 127
186 3300009553 Ga0105249_10008866 Ga0105249_100088669 127
187 3300009553 Ga0105249_10436145 Ga0105249_104361452 127
188 3300009553 Ga0105249_10598882 Ga0105249_105988822 127
189 3300013102 Ga0157371_10660194 Ga0157371_106601942 127
190 3300013297 Ga0157378_10340192 Ga0157378_103401923 127
191 3300013306 Ga0163162_10056904 Ga0163162_100569044 127
192 3300013306 Ga0163162_10372034 Ga0163162_103720342 127
193 3300013306 Ga0163162_10904687 Ga0163162_109046872 127
194 3300013306 Ga0163162_11888112 Ga0163162_118881122 127
195 3300013308 Ga0157375_10053665 Ga0157375_100536653 127
196 3300013308 Ga0157375_10059297 Ga0157375_100592975 127
197 3300013308 Ga0157375_10064588 Ga0157375_100645885 127
198 3300013308 Ga0157375_10393892 Ga0157375_103938922 127
199 3300013308 Ga0157375_11786477 Ga0157375_117864771 127
200 3300014325 Ga0163163_10155280 Ga0163163_101552803 127
201 3300014325 Ga0163163_10174885 Ga0163163_101748853 127
202 3300014325 Ga0163163_10714431 Ga0163163_107144312 127
203 3300014326 Ga0157380_10214973 Ga0157380_102149732 127
204 3300014326 Ga0157380_10549955 Ga0157380_105499552 127
205 3300014968 Ga0157379_10118027 Ga0157379_101180272 127
206 3300014968 Ga0157379_10279968 Ga0157379_102799683 127
207 3300014968 Ga0157379_10316046 Ga0157379_103160462 127
208 3300014968 Ga0157379_10801126 Ga0157379_108011262 127
209 3300014969 Ga0157376_10022462 Ga0157376_100224624 127
210 3300014969 Ga0157376_12566013 Ga0157376_125660131 127
211 3300017792 Ga0163161_10029256 Ga0163161_100292563 127
212 3300017792 Ga0163161_10295151 Ga0163161_102951512 127
213 3300017792 Ga0163161_11103790 Ga0163161_111037902 127
214 3300025315 Ga0207697_10043128 Ga0207697_100431283 127
215 3300025321 Ga0207656_10200983 Ga0207656_102009832 127
216 3300025893 Ga0207682_10007682 Ga0207682_100076824 127
217 3300025893 Ga0207682_10077238 Ga0207682_100772383 127
218 3300025893 Ga0207682_10172079 Ga0207682_101720792 127
219 3300025893 Ga0207682_10318607 Ga0207682_103186072 127
220 3300025899 Ga0207642_10014009 Ga0207642_100140093 127
221 3300025901 Ga0207688_10030668 Ga0207688_100306683 127
222 3300025903 Ga0207680_10001775 Ga0207680_1000177511 127
223 3300025905 Ga0207685_10037589 Ga0207685_100375892 127
224 3300025907 Ga0207645_10004050 Ga0207645_100040502 127
225 3300025907 Ga0207645_10018257 Ga0207645_100182573 127
226 3300025907 Ga0207645_10134112 Ga0207645_101341122 127
227 3300025908 Ga0207643_10086195 Ga0207643_100861952 127
228 3300025918 Ga0207662_10072493 Ga0207662_100724933 127
229 3300025920 Ga0207649_11167286 Ga0207649_111672862 127
230 3300025923 Ga0207681_10009146 Ga0207681_100091463 127
231 3300025923 Ga0207681_10170245 Ga0207681_101702452 127
232 3300025925 Ga0207650_10047025 Ga0207650_100470252 127
233 3300025925 Ga0207650_10053956 Ga0207650_100539562 127
234 3300025925 Ga0207650_10875745 Ga0207650_108757452 127
235 3300025925 Ga0207650_10882410 Ga0207650_108824102 127
236 3300025925 Ga0207650_11522256 Ga0207650_115222561 127
237 3300025926 Ga0207659_10055542 Ga0207659_100555424 127
238 3300025926 Ga0207659_10100787 Ga0207659_101007873 127
239 3300025927 Ga0207687_10153179 Ga0207687_101531793 127
240 3300025927 Ga0207687_10786305 Ga0207687_107863052 127
241 3300025931 Ga0207644_10001677 Ga0207644_100016776 127
242 3300025931 Ga0207644_10092785 Ga0207644_100927853 127
243 3300025932 Ga0207690_10247696 Ga0207690_102476962 127
244 3300025933 Ga0207706_10059142 Ga0207706_100591423 127
245 3300025933 Ga0207706_10216132 Ga0207706_102161322 127
246 3300025934 Ga0207686_10686817 Ga0207686_106868172 127
247 3300025935 Ga0207709_10010461 Ga0207709_100104613 127
248 3300025936 Ga0207670_10190642 Ga0207670_101906422 127
249 3300025937 Ga0207669_10002216 Ga0207669_100022168 127
250 3300025937 Ga0207669_10833720 Ga0207669_108337201 127
251 3300025938 Ga0207704_10002464 Ga0207704_100024649 127
252 3300025938 Ga0207704_10076123 Ga0207704_100761232 127
253 3300025940 Ga0207691_10041764 Ga0207691_100417643 127
254 3300025940 Ga0207691_10073151 Ga0207691_100731513 127
255 3300025940 Ga0207691_10092215 Ga0207691_100922152 127
256 3300025940 Ga0207691_10122192 Ga0207691_101221923 127
257 3300025940 Ga0207691_10128231 Ga0207691_101282313 127
258 3300025940 Ga0207691_10692546 Ga0207691_106925462 127
259 3300025941 Ga0207711_10009406 Ga0207711_100094064 127
260 3300025941 Ga0207711_10060000 Ga0207711_100600002 127
261 3300025941 Ga0207711_10079407 Ga0207711_100794073 127
262 3300025941 Ga0207711_10764149 Ga0207711_107641492 127
263 3300025942 Ga0207689_10055228 Ga0207689_100552284 127
264 3300025942 Ga0207689_10389685 Ga0207689_103896852 127
265 3300025945 Ga0207679_10161207 Ga0207679_101612072 127
266 3300025945 Ga0207679_10667015 Ga0207679_106670152 127
267 3300025945 Ga0207679_10718409 Ga0207679_107184092 127
268 3300025945 Ga0207679_10749790 Ga0207679_107497902 127
269 3300025960 Ga0207651_10105367 Ga0207651_101053673 127
270 3300025960 Ga0207651_10111973 Ga0207651_101119732 127
271 3300025960 Ga0207651_10165585 Ga0207651_101655853 127
272 3300025960 Ga0207651_10768595 Ga0207651_107685952 127
273 3300025961 Ga0207712_10018757 Ga0207712_100187575 127
274 3300025972 Ga0207668_10007368 Ga0207668_100073686 127
275 3300025981 Ga0207640_10280285 Ga0207640_102802852 127
276 3300025981 Ga0207640_10384838 Ga0207640_103848382 127
277 3300025986 Ga0207658_10000764 Ga0207658_1000076414 127
278 3300025986 Ga0207658_10200684 Ga0207658_102006843 127
279 3300026023 Ga0207677_10083343 Ga0207677_100833433 127
280 3300026023 Ga0207677_10100244 Ga0207677_101002443 127
281 3300026035 Ga0207703_10005845 Ga0207703_100058453 127
282 3300026067 Ga0207678_10226886 Ga0207678_102268862 127
283 3300026075 Ga0207708_10006866 Ga0207708_100068665 127
284 3300026088 Ga0207641_10002081 Ga0207641_100020813 127
285 3300026088 Ga0207641_10052603 Ga0207641_100526032 127
286 3300026088 Ga0207641_10094168 Ga0207641_100941681 127
287 3300026089 Ga0207648_10009660 Ga0207648_1000966010 127
288 3300026089 Ga0207648_10032136 Ga0207648_100321364 127
289 3300026089 Ga0207648_10523453 Ga0207648_105234532 127
290 3300026095 Ga0207676_10017436 Ga0207676_100174365 127
291 3300026095 Ga0207676_10189558 Ga0207676_101895583 127
292 3300026095 Ga0207676_10388766 Ga0207676_103887662 127
293 3300026095 Ga0207676_10681449 Ga0207676_106814492 127
294 3300026095 Ga0207676_11678536 Ga0207676_116785362 127
295 3300026118 Ga0207675_100057248 Ga0207675_1000572482 127
296 3300026118 Ga0207675_100258581 Ga0207675_1002585812 127
297 3300026121 Ga0207683_10103903 Ga0207683_101039033 127
298 3300026121 Ga0207683_10355572 Ga0207683_103555723 127
299 3300026142 Ga0207698_10014208 Ga0207698_100142085 127
300 3300026142 Ga0207698_10392681 Ga0207698_103926812 127
301 3300028380 Ga0268265_11276640 Ga0268265_112766402 127
302 3300028381 Ga0268264_10001240 Ga0268264_1000124010 127
303 3300031456 Ga0307513_10358310 Ga0307513_103583103 127
304 3300031995 Ga0307409_100400591 Ga0307409_1004005912 127
305 3300035113 Ga0373936_0070311 Ga0373936_0070311_455_844 127
306 3300035116 Ga0373945_0171082 Ga0373945_0171082_193_579 127
307 3300035695 Ga0373927_0159292 Ga0373927_0159292_792_1175 127
308 3300036401 Ga0373937_0218681 Ga0373937_0218681_220_606 127
309 3300036401 Ga0373937_0513718 Ga0373937_0513718_427_813 127
310 3300037068 Ga0373925_0241618 Ga0373925_0241618_756_1142 127
311 3300041491 Ga0451833_0839225 Ga0451833_0839225_45_431 127
312 3300041512 Ga0451853_0817173 Ga0451853_0817173_291_677 127
313 3300042144 Ga0450889_009208 Ga0450889_009208_500_889 127
314 3300046459 Ga0495629_0586031 Ga0495629_0586031_247_633 127
315 3300046472 Ga0495580_0233221 Ga0495580_0233221_226_612 127
316 3300046537 Ga0495598_0165177 Ga0495598_0165177_87_473 127
317 3300046543 Ga0495645_0021522 Ga0495645_0021522_1766_2149 127
318 3300046543 Ga0495645_0089809 Ga0495645_0089809_1421_1807 127
319 3300046678 Ga0495599_0207682 Ga0495599_0207682_81_467 127
320 3300046681 Ga0495647_0102851 Ga0495647_0102851_210_596 127
321 3300046683 Ga0495658_0033869 Ga0495658_0033869_427_813 127
322 3300046683 Ga0495658_0397552 Ga0495658_0397552_113_499 127
323 3300046683 Ga0495658_0489227 Ga0495658_0489227_218_604 127
324 3300046691 Ga0495670_0438956 Ga0495670_0438956_73_459 127
325 3300047322 Ga0495680_1106836 Ga0495680_1106836_57_443 127
326 3300047470 Ga0495681_0188980 Ga0495681_0188980_52_435 127
327 3300048090 Ga0495615_0091114 Ga0495615_0091114_142_528 127
328 3300048903 Ga0496100_1061635 Ga0496100_1061635_205_597 127
329 3300048908 Ga0496105_0342263 Ga0496105_0342263_154_540 127
330 3300048908 Ga0496105_0703686 Ga0496105_0703686_201_587 127
331 3300048911 Ga0496108_0098332 Ga0496108_0098332_1309_1695 127
332 3300048912 Ga0496109_0045433 Ga0496109_0045433_1757_2143 127
333 3300048913 Ga0496110_0264960 Ga0496110_0264960_673_1059 127
334 3300048917 Ga0496114_1491139 Ga0496114_1491139_86_472 127
335 3300048924 Ga0496121_0159703 Ga0496121_0159703_49_432 127
336 3300048925 Ga0496122_0284322 Ga0496122_0284322_491_874 127
337 3300048927 Ga0496124_0000024 Ga0496124_0000024_292146_292529 127
338 3300049585 Ga0501069_0117712 Ga0501069_0117712_292_678 127
339 3300049586 Ga0501070_0412502 Ga0501070_0412502_40_426 127
340 3300049663 Ga0501223_045638 Ga0501223_045638_78_461 127
341 3300049686 Ga0501257_014251 Ga0501257_014251_1360_1743 127
342 3300049823 Ga0501044_0235273 Ga0501044_0235273_669_1055 127
343 3300050511 nmdc:mga08y16_479996_c1 nmdc:mga08y16_479996_c1_594_980 127
344 3300053118 Ga0500594_0212333 Ga0500594_0212333_165_551 127
345 3300053128 Ga0500626_254608 Ga0500626_254608_111_497 127
346 3300053139 Ga0500568_0246431 Ga0500568_0246431_97_483 127
347 3300060353 Ga0501082_0086604 Ga0501082_0086604_936_1322 127
348 3300025960 Ga0207651_10343828 Ga0207651_103438282 128
349 3300009148 Ga0105243_10826337 Ga0105243_108263372 129
350 3300009174 Ga0105241_12069392 Ga0105241_120693922 129
351 3300013297 Ga0157378_10080517 Ga0157378_100805172 129
352 3300013306 Ga0163162_10376407 Ga0163162_103764073 129
353 3300013308 Ga0157375_10567190 Ga0157375_105671902 129
354 3300025907 Ga0207645_10247693 Ga0207645_102476932 129
355 3300046694 Ga0495649_0023242 Ga0495649_0023242_1024_1446 129
356 3300005444 Ga0070694_100039963 Ga0070694_1000399632 130
357 3300005536 Ga0070697_101148350 Ga0070697_1011483501 130
358 3300005545 Ga0070695_100110428 Ga0070695_1001104283 130
359 3300005577 Ga0068857_102484380 Ga0068857_1024843801 130
360 3300005617 Ga0068859_100185512 Ga0068859_1001855122 130
361 3300006931 Ga0097620_100185502 Ga0097620_1001855022 130
362 3300025911 Ga0207654_10889562 Ga0207654_108895622 130
363 3300025917 Ga0207660_10010796 Ga0207660_100107962 130
364 3300026035 Ga0207703_12364626 Ga0207703_123646261 130
365 3300034816 Ga0373930_0010070 Ga0373930_0010070_633_1028 130
366 3300034817 Ga0373948_0038566 Ga0373948_0038566_479_874 130
367 3300035112 Ga0373932_0024912 Ga0373932_0024912_863_1255 130
368 3300035691 Ga0373931_0007102 Ga0373931_0007102_1291_1686 130
369 3300042876 Ga0451577_0190936 Ga0451577_0190936_369_764 130
370 3300044712 Ga0453684_0354646 Ga0453684_0354646_965_1357 130
371 3300048904 Ga0496101_0968986 Ga0496101_0968986_157_552 130
372 3300048905 Ga0496102_0005344 Ga0496102_0005344_3597_3992 130
373 3300048906 Ga0496103_0102530 Ga0496103_0102530_860_1255 130
374 3300048909 Ga0496106_0378704 Ga0496106_0378704_680_1075 130
375 3300048912 Ga0496109_1099907 Ga0496109_1099907_131_526 130
376 3300003203 JGI25406J46586_10009248 JGI25406J46586_100092484 131
377 3300005406 Ga0070703_10359549 Ga0070703_103595491 131
378 3300005437 Ga0070710_10131213 Ga0070710_101312132 131
379 3300005440 Ga0070705_100061334 Ga0070705_1000613342 131
380 3300005440 Ga0070705_100205020 Ga0070705_1002050202 131
381 3300005445 Ga0070708_100189125 Ga0070708_1001891252 131
382 3300005445 Ga0070708_100889194 Ga0070708_1008891941 131
383 3300005467 Ga0070706_100166339 Ga0070706_1001663393 131
384 3300005468 Ga0070707_100404469 Ga0070707_1004044692 131
385 3300005471 Ga0070698_100066979 Ga0070698_1000669794 131
386 3300005518 Ga0070699_100442127 Ga0070699_1004421272 131
387 3300005536 Ga0070697_100057753 Ga0070697_1000577533 131
388 3300005546 Ga0070696_100176885 Ga0070696_1001768852 131
389 3300005985 Ga0081539_10000044 Ga0081539_10000044243 131
390 3300006844 Ga0075428_100062337 Ga0075428_1000623372 131
391 3300006846 Ga0075430_101657496 Ga0075430_1016574961 131
392 3300006847 Ga0075431_100017871 Ga0075431_1000178712 131
393 3300006847 Ga0075431_101616657 Ga0075431_1016166572 131
394 3300006852 Ga0075433_10019149 Ga0075433_100191493 131
395 3300007265 Ga0099794_10002456 Ga0099794_100024563 131
396 3300009147 Ga0114129_10000507 Ga0114129_1000050744 131
397 3300025910 Ga0207684_10006213 Ga0207684_100062133 131
398 3300025922 Ga0207646_10180396 Ga0207646_101803962 131
399 3300026089 Ga0207648_11246776 Ga0207648_112467761 131
400 3300031548 Ga0307408_101246520 Ga0307408_1012465201 131
401 3300031852 Ga0307410_10273316 Ga0307410_102733163 131
402 3300037418 Ga0395900_0516600 Ga0395900_0516600_155_550 131
403 3300037471 Ga0395905_0591670 Ga0395905_0591670_511_906 131
404 3300045051 Ga0451576_0004324 Ga0451576_0004324_8113_8520 131
405 3300047318 Ga0495636_0200990 Ga0495636_0200990_240_698 131
406 3300049570 Ga0501033_0141443 Ga0501033_0141443_278_682 131
407 3300049572 Ga0501036_0051217 Ga0501036_0051217_2497_2901 131
408 3300049573 Ga0501037_0159058 Ga0501037_0159058_43_447 131
409 3300049574 Ga0501038_0020030 Ga0501038_0020030_1505_1909 131
410 3300049576 Ga0501040_0011471 Ga0501040_0011471_3950_4354 131
411 3300049577 Ga0501041_0044240 Ga0501041_0044240_355_759 131
412 3300049579 Ga0501043_0251870 Ga0501043_0251870_588_992 131
413 3300049580 Ga0501046_0369862 Ga0501046_0369862_25_429 131
414 3300049588 Ga0501072_0051947 Ga0501072_0051947_2423_2827 131
415 3300049590 Ga0501074_0399753 Ga0501074_0399753_323_727 131
416 3300049591 Ga0501075_0077015 Ga0501075_0077015_1944_2348 131
417 3300049592 Ga0501076_0089938 Ga0501076_0089938_1818_2222 131
418 3300049593 Ga0501077_0010748 Ga0501077_0010748_3388_3792 131
419 3300049741 Ga0501079_0002133 Ga0501079_0002133_6846_7250 131
420 3300049744 Ga0501083_0059987 Ga0501083_0059987_1880_2284 131
421 3300049824 Ga0501045_0067106 Ga0501045_0067106_177_581 131
422 3300050507 nmdc:mga05p37_36371_c1 nmdc:mga05p37_36371_c1_5218_5613 131
423 3300050507 nmdc:mga05p37_7843_c1 nmdc:mga05p37_7843_c1_90_485 131
424 3300050509 nmdc:mga0qj67_1267571_c1 nmdc:mga0qj67_1267571_c1_60_455 131
425 3300050510 nmdc:mga06r32_16918_c1 nmdc:mga06r32_16918_c1_5213_5608 131
426 3300050512 nmdc:mga0n895_146322_c1 nmdc:mga0n895_146322_c1_1883_2278 131
427 3300050513 nmdc:mga0rr50_69721_c1 nmdc:mga0rr50_69721_c1_193_588 131
428 3300050514 nmdc:mga08x19_7383_c1 nmdc:mga08x19_7383_c1_4262_4657 131
429 3300050515 nmdc:mga0a205_17962_c1 nmdc:mga0a205_17962_c1_1736_2131 131
430 3300053177 Ga0500636_0288831 Ga0500636_0288831_62_466 131
431 3300054114 Ga0501084_0002259 Ga0501084_0002259_6298_6702 131
432 3300059421 Ga0590071_027388 Ga0590071_027388_173_577 131
433 3300059423 Ga0590074_029636 Ga0590074_029636_480_884 131
434 3300060353 Ga0501082_0043672 Ga0501082_0043672_2574_2978 131
435 3300061734 Ga0530510_0006560 Ga0530510_0006560_3001_3405 131

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11533

AtzH-like

AtzH-like

4

127

0.98

PF14534

DUF4440

Domain of unknown function (DUF4440)

15

118

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6d63-assembly2.cif.gz_D the structure of atzh: a little known member of the atrazine breakdown pathway 0.9802 3 128
6d63-assembly2.cif.gz_D the structure of atzh: a little known member of the atrazine breakdown pathway 0.9719 3 128
6bju-assembly2.cif.gz_D the structure of atzh: a little known member of the atrazine breakdown pathway 0.9703 5 128
6bju-assembly1.cif.gz_B the structure of atzh: a little known member of the atrazine breakdown pathway 0.9696 5 128
6d63-assembly6.cif.gz_K the structure of atzh: a little known member of the atrazine breakdown pathway 0.9677 3 128
ID Description Score Start End Superfamily
6d63G00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9649 3 128 3.10.450.50
6bjtB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9526 5 130 3.10.450.50
6d63G00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9485 3 128 3.10.450.50
2owpB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9329 4 129 3.10.450.50
2owpB00 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9186 4 129 3.10.450.50
ID Description Score Start End GO Terms
AF-A0A1F2ZWR8-F1-model_v4 DUF4440 domain-containing protein 1.001 2 117
AF-A0A420WPF1-F1-model_v4 Uncharacterized protein DUF3225 0.9918 1 131
AF-A0A1I7L147-F1-model_v4 DUF4440 domain-containing protein 0.9891 1 131
AF-A0A2U9UAY7-F1-model_v4 deleted 0.988 3 131
AF-A0A420WPF1-F1-model_v4 Uncharacterized protein DUF3225 0.9844 1 131

Feature Viewer

pLDDT pTM Quality
94.47 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map