F443256

General Info

Members Datasets Scaffolds Average Seq Length
435 250 870 128

Family's Representative Sequence

Representative Sequence 3300005327|Ga0070658_11614839|Ga0070658_116148391
Length 152
Sequence MDRIPILQMGRFLLVTIQVDMHDRLALALQDDLTARITQVQAKGVLIDISSLEMVDSFIGRMLANIASMSRILDAQTVVVGMRPAVAITLVELGLGLRGIRTALNLEFGLEMLRRLRAAELTWSAGTDAETDGDEPGQRQPDDQARGLVGRL

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
131 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
132 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
154 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
155 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
156 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
157 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
158 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
159 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
160 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
161 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
162 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
163 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
164 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
165 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
166 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
167 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
168 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
169 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
170 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
176 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
177 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
178 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
203 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
204 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
210 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
211 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
212 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
213 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
214 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
215 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
216 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
226 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
229 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
230 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
231 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
232 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
233 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
234 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
235 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
236 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
237 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
238 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
239 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
240 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
241 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
244 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
248 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
249 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.46
Nodule 0
Rhizoplane 2.53
Rhizosphere 96.32
Stem 0
Stem Tuber 0
Unclassified 0.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_11614839 3300005327 Bacteria 562
2 Ga0065712_10014308 3300005290 Bacteria 2000
3 Ga0065715_10010344 3300005293 Bacteria 5051
4 Ga0065715_10079481 3300005293 Bacteria 634
5 Ga0065715_10102924 3300005293 Bacteria 3062
6 Ga0065715_10292091 3300005293 Bacteria 1061
7 Ga0065707_10117214 3300005295 Bacteria 2217
8 Ga0065707_10120424 3300005295 Bacteria 2135
9 Ga0070690_100075211 3300005330 Bacteria 2202
10 Ga0070670_100023820 3300005331 Bacteria 5267
11 Ga0070670_100078622 3300005331 Bacteria 2834
12 Ga0068869_100017585 3300005334 Bacteria 4849
13 Ga0070666_10122529 3300005335 Bacteria 1804
14 Ga0070680_100058904 3300005336 Bacteria 3141
15 Ga0068868_100014680 3300005338 Bacteria 5776
16 Ga0068868_100540273 3300005338 Bacteria 1026
17 Ga0070689_100032687 3300005340 Bacteria 3958
18 Ga0070689_101620850 3300005340 Bacteria 588
19 Ga0070687_100004909 3300005343 Bacteria 5367
20 Ga0070661_100060438 3300005344 Bacteria 2781
21 Ga0070661_100532927 3300005344 Bacteria 943
22 Ga0070692_11291939 3300005345 Bacteria 523
23 Ga0070668_101284704 3300005347 Bacteria 665
24 Ga0070669_100019313 3300005353 Bacteria 4867
25 Ga0070675_100082352 3300005354 Bacteria 2685
26 Ga0070675_100571063 3300005354 Bacteria 1024
27 Ga0070673_100005505 3300005364 Bacteria 8110
28 Ga0070688_100041768 3300005365 Bacteria 2817
29 Ga0070688_100129292 3300005365 Bacteria 1702
30 Ga0070688_100481415 3300005365 Bacteria 933
31 Ga0070705_100074238 3300005440 Bacteria 2067
32 Ga0070694_100479004 3300005444 Bacteria 987
33 Ga0070708_100040713 3300005445 Bacteria 4070
34 Ga0070662_100052379 3300005457 Bacteria 2950
35 Ga0070662_100497866 3300005457 Bacteria 1016
36 Ga0070681_10076213 3300005458 Bacteria 3313
37 Ga0068867_100706838 3300005459 Bacteria 890
38 Ga0070685_10044395 3300005466 Bacteria 2544
39 Ga0070706_100056149 3300005467 Bacteria 3634
40 Ga0070707_100048960 3300005468 Bacteria 4050
41 Ga0070698_100036705 3300005471 Bacteria 5059
42 Ga0070698_100741753 3300005471 Bacteria 925
43 Ga0070699_100002531 3300005518 Bacteria 16420
44 Ga0070679_100007180 3300005530 Bacteria 10401
45 Ga0070679_100398674 3300005530 Bacteria 1322
46 Ga0070684_100114948 3300005535 Bacteria 2416
47 Ga0070697_100009772 3300005536 Bacteria 7483
48 Ga0070672_100491381 3300005543 Bacteria 1061
49 Ga0070672_100530840 3300005543 Bacteria 1020
50 Ga0070686_100073887 3300005544 Bacteria 2239
51 Ga0070686_101362948 3300005544 Bacteria 594
52 Ga0070696_101104100 3300005546 Bacteria 667
53 Ga0070665_100053098 3300005548 Bacteria 4064
54 Ga0070704_100052543 3300005549 Bacteria 2875
55 Ga0068855_101744513 3300005563 Bacteria 634
56 Ga0070664_100412244 3300005564 Bacteria 1236
57 Ga0070664_100480651 3300005564 Bacteria 1143
58 Ga0068857_100014076 3300005577 Bacteria 6962
59 Ga0068857_100073108 3300005577 Bacteria 3054
60 Ga0068857_100150438 3300005577 Bacteria 2108
61 Ga0070702_100068207 3300005615 Bacteria 2092
62 Ga0068852_101242984 3300005616 Bacteria 766
63 Ga0068852_101868163 3300005616 Bacteria 623
64 Ga0068864_102391914 3300005618 Bacteria 534
65 Ga0068861_100006487 3300005719 Bacteria 7973
66 Ga0068861_100080756 3300005719 Bacteria 2544
67 Ga0068870_10205051 3300005840 Bacteria 1198
68 Ga0068863_100003263 3300005841 Bacteria 16015
69 Ga0068858_100050900 3300005842 Bacteria 3833
70 Ga0068860_100268245 3300005843 Bacteria 1665
71 Ga0068862_100001779 3300005844 Bacteria 19491
72 Ga0068862_100787032 3300005844 Bacteria 928
73 Ga0068862_100877307 3300005844 Bacteria 881
74 Ga0068862_102154278 3300005844 Bacteria 569
75 Ga0097621_100131779 3300006237 Bacteria 2129
76 Ga0068871_100285460 3300006358 Bacteria 1445
77 Ga0068871_101592057 3300006358 Bacteria 618
78 Ga0068871_101841111 3300006358 Bacteria 575
79 Ga0075428_100000226 3300006844 Bacteria 54970
80 Ga0075428_100002063 3300006844 Bacteria 21669
81 Ga0075428_100010057 3300006844 Bacteria 10510
82 Ga0075428_100096905 3300006844 Bacteria 3215
83 Ga0075428_100107532 3300006844 Bacteria 3040
84 Ga0075428_100768218 3300006844 Bacteria 1025
85 Ga0075430_100005123 3300006846 Bacteria 11033
86 Ga0075430_100008957 3300006846 Bacteria 8454
87 Ga0075430_100060890 3300006846 Bacteria 3173
88 Ga0075430_100153398 3300006846 Bacteria 1918
89 Ga0075430_100164329 3300006846 Bacteria 1847
90 Ga0075431_100005012 3300006847 Bacteria 13026
91 Ga0075431_100006379 3300006847 Bacteria 11705
92 Ga0075431_100010437 3300006847 Bacteria 9337
93 Ga0075431_100029987 3300006847 Bacteria 5602
94 Ga0075431_100051099 3300006847 Bacteria 4264
95 Ga0075431_100092388 3300006847 Bacteria 3123
96 Ga0075431_100239236 3300006847 Bacteria 1847
97 Ga0075431_100929547 3300006847 Bacteria 838
98 Ga0075433_10106362 3300006852 Bacteria 2487
99 Ga0075433_10287666 3300006852 Bacteria 1456
100 Ga0075433_11460827 3300006852 Bacteria 591
101 Ga0075434_100299328 3300006871 Bacteria 1629
102 Ga0075434_101892003 3300006871 Bacteria 603
103 Ga0075429_100009079 3300006880 Bacteria 8634
104 Ga0075429_100014576 3300006880 Bacteria 6812
105 Ga0075429_100017301 3300006880 Bacteria 6234
106 Ga0075429_100420202 3300006880 Bacteria 1171
107 Ga0075436_100619746 3300006914 Bacteria 798
108 Ga0097620_101339920 3300006931 Bacteria 789
109 Ga0075435_100063778 3300007076 Bacteria 2993
110 Ga0075435_100515904 3300007076 Bacteria 1034
111 Ga0099794_10007224 3300007265 Bacteria 4548
112 Ga0105240_11022332 3300009093 Bacteria 883
113 Ga0105240_11285574 3300009093 Bacteria 772
114 Ga0111539_10001326 3300009094 Bacteria 32991
115 Ga0111539_10001413 3300009094 Bacteria 31978
116 Ga0111539_10002174 3300009094 Bacteria 26216
117 Ga0111539_10129519 3300009094 Bacteria 2955
118 Ga0111539_10303698 3300009094 Bacteria 1857
119 Ga0111539_10501883 3300009094 Bacteria 1413
120 Ga0105247_10588906 3300009101 Bacteria 823
121 Ga0105247_11151637 3300009101 Bacteria 615
122 Ga0114129_10002134 3300009147 Bacteria 27265
123 Ga0114129_10021544 3300009147 Bacteria 9150
124 Ga0114129_10056761 3300009147 Bacteria 5483
125 Ga0114129_10066695 3300009147 Bacteria 5019
126 Ga0114129_10165204 3300009147 Bacteria 3021
127 Ga0114129_10232907 3300009147 Bacteria 2480
128 Ga0105243_10185690 3300009148 Bacteria 1812
129 Ga0105241_10061614 3300009174 Unclassified 2890
130 Ga0105248_10012207 3300009177 Bacteria 9478
131 Ga0105248_10824013 3300009177 Bacteria 1047
132 Ga0105237_10462738 3300009545 Bacteria 1274
133 Ga0105237_11218521 3300009545 Bacteria 759
134 Ga0105238_10846051 3300009551 Bacteria 932
135 Ga0105249_10008197 3300009553 Bacteria 9106
136 Ga0105239_10716452 3300010375 Bacteria 1144
137 Ga0157369_11840421 3300013105 Bacteria 615
138 Ga0157374_10412097 3300013296 Bacteria 1349
139 Ga0157374_11179714 3300013296 Bacteria 787
140 Ga0157378_12232795 3300013297 Bacteria 599
141 Ga0163162_10115243 3300013306 Bacteria 2787
142 Ga0163162_11869027 3300013306 Bacteria 687
143 Ga0157372_11348318 3300013307 Unclassified 823
144 Ga0157375_10590212 3300013308 Bacteria 1271
145 Ga0157375_11180816 3300013308 Bacteria 897
146 Ga0163163_10699084 3300014325 Bacteria 1077
147 Ga0157377_10122088 3300014745 Bacteria 1580
148 Ga0157377_10364874 3300014745 Bacteria 973
149 Ga0157379_10035566 3300014968 Bacteria 4441
150 Ga0157379_10185200 3300014968 Bacteria 1881
151 Ga0157376_10378822 3300014969 Bacteria 1362
152 Ga0157376_10955616 3300014969 Bacteria 878
153 Ga0163161_10041125 3300017792 Bacteria 3321
154 Ga0207688_10113183 3300025901 Bacteria 1577
155 Ga0207688_10220240 3300025901 Bacteria 1143
156 Ga0207645_10501349 3300025907 Bacteria 822
157 Ga0207643_10039638 3300025908 Bacteria 2650
158 Ga0207643_10164483 3300025908 Bacteria 1336
159 Ga0207684_10050434 3300025910 Bacteria 3530
160 Ga0207684_10153583 3300025910 Bacteria 1981
161 Ga0207707_10236654 3300025912 Bacteria 1588
162 Ga0207695_10713659 3300025913 Bacteria 883
163 Ga0207660_10168547 3300025917 Bacteria 1694
164 Ga0207660_10376602 3300025917 Bacteria 1141
165 Ga0207662_10001631 3300025918 Bacteria 10974
166 Ga0207649_10402752 3300025920 Bacteria 1024
167 Ga0207652_10014548 3300025921 Bacteria 6375
168 Ga0207646_10043001 3300025922 Bacteria 4058
169 Ga0207681_10382933 3300025923 Bacteria 1132
170 Ga0207650_10014798 3300025925 Bacteria 5425
171 Ga0207659_10330968 3300025926 Bacteria 1259
172 Ga0207659_10412949 3300025926 Bacteria 1131
173 Ga0207700_10382698 3300025928 Bacteria 1231
174 Ga0207706_10041179 3300025933 Bacteria 4096
175 Ga0207706_10562964 3300025933 Bacteria 981
176 Ga0207706_11506810 3300025933 Bacteria 548
177 Ga0207670_10065231 3300025936 Bacteria 2498
178 Ga0207691_10051723 3300025940 Bacteria 3754
179 Ga0207689_10006617 3300025942 Bacteria 10221
180 Ga0207661_10730884 3300025944 Bacteria 911
181 Ga0207679_11005632 3300025945 Bacteria 764
182 Ga0207651_10380170 3300025960 Bacteria 1196
183 Ga0207712_10004837 3300025961 Bacteria 8511
184 Ga0207712_10031712 3300025961 Bacteria 3562
185 Ga0207668_10261330 3300025972 Bacteria 1411
186 Ga0207640_10712625 3300025981 Bacteria 861
187 Ga0207640_10816216 3300025981 Bacteria 809
188 Ga0207677_10429043 3300026023 Bacteria 1128
189 Ga0207639_10000009 3300026041 Bacteria 432727
190 Ga0207639_10806507 3300026041 Bacteria 875
191 Ga0207708_10203101 3300026075 Bacteria 1582
192 Ga0207702_10179509 3300026078 Bacteria 1949
193 Ga0207702_10305102 3300026078 Bacteria 1512
194 Ga0207641_10050513 3300026088 Bacteria 3518
195 Ga0207648_10043475 3300026089 Bacteria 3943
196 Ga0207674_10046982 3300026116 Bacteria 4429
197 Ga0207674_10051086 3300026116 Bacteria 4220
198 Ga0207674_10071063 3300026116 Bacteria 3498
199 Ga0207675_100576204 3300026118 Bacteria 1127
200 Ga0207675_101439943 3300026118 Bacteria 710
201 Ga0207675_102589247 3300026118 Bacteria 517
202 Ga0207698_12016288 3300026142 Bacteria 591
203 Ga0209995_1018343 3300027471 Bacteria 1154
204 Ga0209588_1018897 3300027671 Bacteria 2147
205 Ga0209813_10010932 3300027866 Bacteria 2360
206 Ga0209974_10403223 3300027876 Bacteria 537
207 Ga0207428_10003651 3300027907 Bacteria 14834
208 Ga0207428_10016876 3300027907 Bacteria 6274
209 Ga0207428_10023676 3300027907 Bacteria 5160
210 Ga0207428_10356035 3300027907 Bacteria 1076
211 Ga0207428_10466549 3300027907 Bacteria 919
212 Ga0268265_10057311 3300028380 Bacteria 2968
213 Ga0268265_10133025 3300028380 Bacteria 2070
214 Ga0268265_11159430 3300028380 Bacteria 769
215 Ga0268264_10873665 3300028381 Bacteria 901
216 Ga0307509_10081840 3300031507 Bacteria 3333
217 Ga0307408_100001599 3300031548 Bacteria 16743
218 Ga0307408_100017916 3300031548 Bacteria 4748
219 Ga0307408_100103445 3300031548 Bacteria 2174
220 Ga0307405_10066608 3300031731 Bacteria 2297
221 Ga0307405_11107246 3300031731 Bacteria 681
222 Ga0307405_11899230 3300031731 Bacteria 531
223 Ga0307413_10005626 3300031824 Bacteria 5618
224 Ga0307413_10048805 3300031824 Bacteria 2533
225 Ga0307413_10097577 3300031824 Bacteria 1932
226 Ga0307413_11330946 3300031824 Bacteria 629
227 Ga0307413_12184461 3300031824 Bacteria 502
228 Ga0307410_10046647 3300031852 Bacteria 2891
229 Ga0307410_10056191 3300031852 Bacteria 2675
230 Ga0307406_10072647 3300031901 Bacteria 2259
231 Ga0307406_10693990 3300031901 Bacteria 849
232 Ga0307407_10007769 3300031903 Bacteria 4878
233 Ga0307407_10022207 3300031903 Bacteria 3288
234 Ga0307412_10060242 3300031911 Bacteria 2547
235 Ga0307412_10075045 3300031911 Bacteria 2318
236 Ga0307412_10115174 3300031911 Bacteria 1926
237 Ga0307412_11060528 3300031911 Bacteria 719
238 Ga0307409_100009261 3300031995 Bacteria 6039
239 Ga0307409_100010211 3300031995 Bacteria 5820
240 Ga0307409_101052886 3300031995 Bacteria 833
241 Ga0307409_101153759 3300031995 Bacteria 797
242 Ga0307409_101568652 3300031995 Bacteria 686
243 Ga0307416_100015437 3300032002 Bacteria 5277
244 Ga0307416_100030441 3300032002 Bacteria 4049
245 Ga0307416_100080835 3300032002 Bacteria 2745
246 Ga0307416_100654790 3300032002 Bacteria 1135
247 Ga0307416_101341525 3300032002 Bacteria 821
248 Ga0307414_10039231 3300032004 Bacteria 3188
249 Ga0307414_10093961 3300032004 Bacteria 2237
250 Ga0307414_10260349 3300032004 Bacteria 1447
251 Ga0307411_10005558 3300032005 Bacteria 6206
252 Ga0307411_10032856 3300032005 Bacteria 3211
253 Ga0307411_10110515 3300032005 Bacteria 1965
254 Ga0307411_10357072 3300032005 Bacteria 1193
255 Ga0307415_100002599 3300032126 Bacteria 9010
256 Ga0307415_100074666 3300032126 Bacteria 2397
257 Ga0307415_100559222 3300032126 Bacteria 1011
258 Ga0307415_101364202 3300032126 Bacteria 674
259 Ga0373926_0406784 3300035083 Bacteria 538
260 Ga0373934_0187161 3300035086 Bacteria 851
261 Ga0373940_0032210 3300035088 Bacteria 1404
262 Ga0373951_0072741 3300035091 Bacteria 878
263 Ga0373932_0123147 3300035112 Bacteria 867
264 Ga0373941_0291647 3300035115 Bacteria 648
265 Ga0373956_0057883 3300035119 Bacteria 1752
266 Ga0373955_0325192 3300035172 Bacteria 929
267 Ga0373931_0065156 3300035691 Bacteria 1974
268 Ga0373935_0398911 3300035692 Bacteria 988
269 Ga0373933_0263823 3300035724 Bacteria 1111
270 Ga0373933_1064465 3300035724 Bacteria 533
271 Ga0373937_0075695 3300036401 Bacteria 3108
272 Ga0373925_0106771 3300037068 Bacteria 2159
273 Ga0373925_0504187 3300037068 Bacteria 994
274 Ga0436364_0888291 3300037853 Bacteria 516
275 Ga0451851_0433205 3300041507 Bacteria 539
276 Ga0439448_0024359 3300042005 Bacteria 1892
277 Ga0439449_0053243 3300042007 Bacteria 1496
278 Ga0439450_002777 3300042008 Bacteria 2805
279 Ga0439444_0122920 3300042437 Bacteria 607
280 Ga0439464_0094699 3300042439 Bacteria 903
281 Ga0439460_0142243 3300042461 Bacteria 796
282 Ga0453684_1095279 3300044712 Bacteria 842
283 Ga0451576_0042920 3300045051 Bacteria 4774
284 Ga0466958_0835910 3300045836 Bacteria 601
285 Ga0466967_1389974 3300045976 Bacteria 699
286 Ga0495638_0371938 3300046460 Bacteria 749
287 Ga0495651_0012574 3300046462 Bacteria 6533
288 Ga0495653_0055694 3300046463 Bacteria 3017
289 Ga0495580_0046966 3300046472 Bacteria 3062
290 Ga0495582_0014672 3300046473 Bacteria 4305
291 Ga0495639_0001884 3300046475 Bacteria 9301
292 Ga0495662_0022114 3300046476 Bacteria 3073
293 Ga0495664_0015651 3300046477 Bacteria 4314
294 Ga0495584_0457989 3300046491 Bacteria 649
295 Ga0495594_0003447 3300046499 Bacteria 8165
296 Ga0495628_0050428 3300046516 Bacteria 3292
297 Ga0495666_0009926 3300046526 Bacteria 4756
298 Ga0495652_0027881 3300046529 Bacteria 4974
299 Ga0495665_0008395 3300046531 Bacteria 5604
300 Ga0495640_0001962 3300046533 Bacteria 16415
301 Ga0495640_0553353 3300046533 Bacteria 697
302 Ga0495586_0026707 3300046535 Bacteria 3090
303 Ga0495587_0202552 3300046536 Bacteria 1122
304 Ga0495645_0002282 3300046543 Bacteria 13044
305 Ga0495645_0526915 3300046543 Bacteria 735
306 Ga0495667_0014591 3300046559 Bacteria 5307
307 Ga0495667_0078063 3300046559 Bacteria 2153
308 Ga0495634_0007149 3300046642 Bacteria 8418
309 Ga0495634_0745484 3300046642 Bacteria 561
310 Ga0495635_0006220 3300046663 Bacteria 8318
311 Ga0495659_0044204 3300046664 Bacteria 1601
312 Ga0495588_0266237 3300046674 Bacteria 903
313 Ga0495599_0011265 3300046678 Bacteria 5493
314 Ga0495623_0334103 3300046679 Bacteria 829
315 Ga0495623_0394916 3300046679 Bacteria 745
316 Ga0495646_0031263 3300046680 Bacteria 3318
317 Ga0495658_0034011 3300046683 Bacteria 2795
318 Ga0495658_0398973 3300046683 Bacteria 877
319 Ga0495669_0033170 3300046684 Bacteria 2272
320 Ga0495613_0023610 3300046689 Bacteria 4583
321 Ga0495624_0002190 3300046690 Bacteria 14918
322 Ga0495600_0042171 3300046809 Bacteria 2975
323 Ga0495581_0004366 3300047315 Bacteria 8166
324 Ga0495604_0007975 3300047317 Bacteria 8387
325 Ga0495674_0010642 3300047319 Bacteria 8703
326 Ga0495674_0336166 3300047319 Bacteria 1228
327 Ga0495676_0003074 3300047321 Bacteria 15092
328 Ga0495680_0031622 3300047322 Bacteria 4304
329 Ga0495675_0007090 3300047444 Bacteria 6896
330 Ga0495675_0067030 3300047444 Bacteria 2269
331 Ga0495684_0195243 3300047471 Bacteria 1494
332 Ga0495684_1064074 3300047471 Bacteria 510
333 Ga0495686_0016465 3300047472 Bacteria 5012
334 Ga0495602_0590766 3300048088 Bacteria 765
335 Ga0495614_0002505 3300048089 Bacteria 8164
336 Ga0496100_0235110 3300048903 Bacteria 1350
337 Ga0496101_1585314 3300048904 Bacteria 509
338 Ga0496104_0268414 3300048907 Bacteria 1619
339 Ga0496106_0809795 3300048909 Bacteria 743
340 Ga0496107_0588690 3300048910 Bacteria 823
341 Ga0496109_1310687 3300048912 Bacteria 660
342 Ga0496110_0200744 3300048913 Bacteria 1812
343 Ga0496111_0394898 3300048914 Bacteria 1022
344 Ga0496112_0038510 3300048915 Bacteria 4669
345 Ga0496112_0654882 3300048915 Bacteria 980
346 Ga0496113_0630329 3300048916 Bacteria 858
347 Ga0501291_055478 3300049514 Bacteria 732
348 Ga0501299_095614 3300049522 Bacteria 682
349 Ga0501034_0012017 3300049571 Bacteria 8949
350 Ga0501036_0103141 3300049572 Bacteria 2413
351 Ga0501037_1015397 3300049573 Bacteria 540
352 Ga0501038_0754505 3300049574 Bacteria 726
353 Ga0501038_0918497 3300049574 Bacteria 646
354 Ga0501040_0271596 3300049576 Bacteria 1211
355 Ga0501040_0957758 3300049576 Bacteria 620
356 Ga0501041_0686357 3300049577 Bacteria 655
357 Ga0501042_0397421 3300049578 Bacteria 998
358 Ga0501046_0564709 3300049580 Bacteria 810
359 Ga0501071_0041824 3300049587 Bacteria 3282
360 Ga0501071_0244591 3300049587 Bacteria 1353
361 Ga0501071_0896631 3300049587 Bacteria 684
362 Ga0501071_0951589 3300049587 Bacteria 663
363 Ga0501071_1029922 3300049587 Bacteria 636
364 Ga0501072_0002493 3300049588 Bacteria 13788
365 Ga0501072_0155321 3300049588 Bacteria 1825
366 Ga0501072_0164699 3300049588 Bacteria 1769
367 Ga0501072_0691678 3300049588 Bacteria 802
368 Ga0501072_0811187 3300049588 Bacteria 733
369 Ga0501072_0821410 3300049588 Bacteria 727
370 Ga0501075_0145483 3300049591 Bacteria 1806
371 Ga0501075_0310926 3300049591 Bacteria 1201
372 Ga0501077_0297470 3300049593 Bacteria 1028
373 Ga0501077_0692786 3300049593 Bacteria 655
374 Ga0501216_007626 3300049660 Bacteria 1688
375 Ga0501248_026536 3300049678 Bacteria 636
376 Ga0501261_031285 3300049690 Bacteria 806
377 Ga0501221_117347 3300049704 Bacteria 676
378 Ga0501079_0041145 3300049741 Bacteria 3566
379 Ga0501079_0228185 3300049741 Bacteria 1455
380 Ga0501079_0567290 3300049741 Bacteria 893
381 Ga0501080_1225973 3300049742 Bacteria 644
382 Ga0501080_1631315 3300049742 Bacteria 545
383 Ga0501081_0258896 3300049743 Bacteria 1271
384 Ga0501081_0400022 3300049743 Bacteria 1017
385 Ga0501273_006438 3300049770 Bacteria 1359
386 Ga0501273_026521 3300049770 Bacteria 808
387 Ga0501044_0098552 3300049823 Bacteria 2943
388 Ga0501044_0462834 3300049823 Bacteria 1173
389 nmdc:mga04h51_12834_c1 3300050495 Bacteria 2360
390 nmdc:mga05p37_1298914_c1 3300050507 Bacteria 742
391 nmdc:mga05p37_219368_c1 3300050507 Bacteria 2296
392 nmdc:mga05p37_23172_c1 3300050507 Bacteria 7533
393 nmdc:mga05p37_325752_c1 3300050507 Bacteria 1817
394 nmdc:mga05p37_3645_c1 3300050507 Bacteria 18011
395 nmdc:mga05p37_7832_c1 3300050507 Bacteria 12609
396 nmdc:mga09592_15120_c1 3300050508 Bacteria 6306
397 nmdc:mga09592_16051_c1 3300050508 Bacteria 6122
398 nmdc:mga09592_388873_c1 3300050508 Bacteria 1206
399 nmdc:mga09592_4810_c1 3300050508 Bacteria 10942
400 nmdc:mga0qj67_1006_c1 3300050509 Bacteria 19464
401 nmdc:mga0qj67_166967_c1 3300050509 Bacteria 1787
402 nmdc:mga0qj67_1871_c1 3300050509 Bacteria 14927
403 nmdc:mga0qj67_369694_c1 3300050509 Bacteria 1158
404 nmdc:mga0qj67_42292_c1 3300050509 Bacteria 3587
405 nmdc:mga0qj67_685324_c1 3300050509 Bacteria 816
406 nmdc:mga06r32_12069_c1 3300050510 Bacteria 7788
407 nmdc:mga06r32_214_c1 3300050510 Bacteria 47006
408 nmdc:mga06r32_27835_c1 3300050510 Bacteria 5284
409 nmdc:mga06r32_567009_c1 3300050510 Bacteria 1108
410 nmdc:mga06r32_64417_c1 3300050510 Bacteria 3535
411 nmdc:mga06r32_739725_c1 3300050510 Bacteria 947
412 nmdc:mga06r32_9978_c1 3300050510 Bacteria 8567
413 nmdc:mga06r32_99971_c1 3300050510 Bacteria 2845
414 nmdc:mga08y16_132767_c1 3300050511 Bacteria 2588
415 nmdc:mga08y16_195621_c1 3300050511 Bacteria 2096
416 nmdc:mga08y16_215167_c1 3300050511 Bacteria 1990
417 nmdc:mga08y16_5750_c1 3300050511 Bacteria 12989
418 nmdc:mga08y16_6491_c1 3300050511 Bacteria 12266
419 nmdc:mga08y16_929968_c1 3300050511 Bacteria 854
420 nmdc:mga08y16_993_c1 3300050511 Bacteria 27651
421 nmdc:mga0n895_2098639_c1 3300050512 Bacteria 522
422 nmdc:mga0n895_41187_c1 3300050512 Bacteria 4489
423 nmdc:mga0a205_111008_c1 3300050515 Bacteria 2641
424 Ga0501084_0026883 3300054114 Bacteria 4807
425 Ga0501084_0052150 3300054114 Bacteria 3423
426 Ga0501084_0449378 3300054114 Bacteria 1090
427 Ga0501084_0566263 3300054114 Bacteria 960
428 Ga0590074_046836 3300059423 Bacteria 786
429 Ga0590075_056169 3300059424 Bacteria 1012
430 Ga0501082_0066915 3300060353 Bacteria 3094
431 Ga0501082_0404855 3300060353 Bacteria 1191
432 Ga0501082_0877854 3300060353 Bacteria 785
433 Ga0530510_0001687 3300061734 Bacteria 14960
434 Ga0530510_0258908 3300061734 Bacteria 1297
435 Ga0530510_0407938 3300061734 Bacteria 1025
436 Ga0070658_11614839
437 Ga0065712_10014308
438 Ga0065715_10010344
439 Ga0065715_10079481
440 Ga0065715_10102924
441 Ga0065715_10292091
442 Ga0065707_10117214
443 Ga0065707_10120424
444 Ga0070690_100075211
445 Ga0070670_100023820
446 Ga0070670_100078622
447 Ga0068869_100017585
448 Ga0070666_10122529
449 Ga0070680_100058904
450 Ga0068868_100014680
451 Ga0068868_100540273
452 Ga0070689_100032687
453 Ga0070689_101620850
454 Ga0070687_100004909
455 Ga0070661_100060438
456 Ga0070661_100532927
457 Ga0070692_11291939
458 Ga0070668_101284704
459 Ga0070669_100019313
460 Ga0070675_100082352
461 Ga0070675_100571063
462 Ga0070673_100005505
463 Ga0070688_100041768
464 Ga0070688_100129292
465 Ga0070688_100481415
466 Ga0070705_100074238
467 Ga0070694_100479004
468 Ga0070708_100040713
469 Ga0070662_100052379
470 Ga0070662_100497866
471 Ga0070681_10076213
472 Ga0068867_100706838
473 Ga0070685_10044395
474 Ga0070706_100056149
475 Ga0070707_100048960
476 Ga0070698_100036705
477 Ga0070698_100741753
478 Ga0070699_100002531
479 Ga0070679_100007180
480 Ga0070679_100398674
481 Ga0070684_100114948
482 Ga0070697_100009772
483 Ga0070672_100491381
484 Ga0070672_100530840
485 Ga0070686_100073887
486 Ga0070686_101362948
487 Ga0070696_101104100
488 Ga0070665_100053098
489 Ga0070704_100052543
490 Ga0068855_101744513
491 Ga0070664_100412244
492 Ga0070664_100480651
493 Ga0068857_100014076
494 Ga0068857_100073108
495 Ga0068857_100150438
496 Ga0070702_100068207
497 Ga0068852_101242984
498 Ga0068852_101868163
499 Ga0068864_102391914
500 Ga0068861_100006487
501 Ga0068861_100080756
502 Ga0068870_10205051
503 Ga0068863_100003263
504 Ga0068858_100050900
505 Ga0068860_100268245
506 Ga0068862_100001779
507 Ga0068862_100787032
508 Ga0068862_100877307
509 Ga0068862_102154278
510 Ga0097621_100131779
511 Ga0068871_100285460
512 Ga0068871_101592057
513 Ga0068871_101841111
514 Ga0075428_100000226
515 Ga0075428_100002063
516 Ga0075428_100010057
517 Ga0075428_100096905
518 Ga0075428_100107532
519 Ga0075428_100768218
520 Ga0075430_100005123
521 Ga0075430_100008957
522 Ga0075430_100060890
523 Ga0075430_100153398
524 Ga0075430_100164329
525 Ga0075431_100005012
526 Ga0075431_100006379
527 Ga0075431_100010437
528 Ga0075431_100029987
529 Ga0075431_100051099
530 Ga0075431_100092388
531 Ga0075431_100239236
532 Ga0075431_100929547
533 Ga0075433_10106362
534 Ga0075433_10287666
535 Ga0075433_11460827
536 Ga0075434_100299328
537 Ga0075434_101892003
538 Ga0075429_100009079
539 Ga0075429_100014576
540 Ga0075429_100017301
541 Ga0075429_100420202
542 Ga0075436_100619746
543 Ga0097620_101339920
544 Ga0075435_100063778
545 Ga0075435_100515904
546 Ga0099794_10007224
547 Ga0105240_11022332
548 Ga0105240_11285574
549 Ga0111539_10001326
550 Ga0111539_10001413
551 Ga0111539_10002174
552 Ga0111539_10129519
553 Ga0111539_10303698
554 Ga0111539_10501883
555 Ga0105247_10588906
556 Ga0105247_11151637
557 Ga0114129_10002134
558 Ga0114129_10021544
559 Ga0114129_10056761
560 Ga0114129_10066695
561 Ga0114129_10165204
562 Ga0114129_10232907
563 Ga0105243_10185690
564 Ga0105241_10061614
565 Ga0105248_10012207
566 Ga0105248_10824013
567 Ga0105237_10462738
568 Ga0105237_11218521
569 Ga0105238_10846051
570 Ga0105249_10008197
571 Ga0105239_10716452
572 Ga0157369_11840421
573 Ga0157374_10412097
574 Ga0157374_11179714
575 Ga0157378_12232795
576 Ga0163162_10115243
577 Ga0163162_11869027
578 Ga0157372_11348318
579 Ga0157375_10590212
580 Ga0157375_11180816
581 Ga0163163_10699084
582 Ga0157377_10122088
583 Ga0157377_10364874
584 Ga0157379_10035566
585 Ga0157379_10185200
586 Ga0157376_10378822
587 Ga0157376_10955616
588 Ga0163161_10041125
589 Ga0207688_10113183
590 Ga0207688_10220240
591 Ga0207645_10501349
592 Ga0207643_10039638
593 Ga0207643_10164483
594 Ga0207684_10050434
595 Ga0207684_10153583
596 Ga0207707_10236654
597 Ga0207695_10713659
598 Ga0207660_10168547
599 Ga0207660_10376602
600 Ga0207662_10001631
601 Ga0207649_10402752
602 Ga0207652_10014548
603 Ga0207646_10043001
604 Ga0207681_10382933
605 Ga0207650_10014798
606 Ga0207659_10330968
607 Ga0207659_10412949
608 Ga0207700_10382698
609 Ga0207706_10041179
610 Ga0207706_10562964
611 Ga0207706_11506810
612 Ga0207670_10065231
613 Ga0207691_10051723
614 Ga0207689_10006617
615 Ga0207661_10730884
616 Ga0207679_11005632
617 Ga0207651_10380170
618 Ga0207712_10004837
619 Ga0207712_10031712
620 Ga0207668_10261330
621 Ga0207640_10712625
622 Ga0207640_10816216
623 Ga0207677_10429043
624 Ga0207639_10000009
625 Ga0207639_10806507
626 Ga0207708_10203101
627 Ga0207702_10179509
628 Ga0207702_10305102
629 Ga0207641_10050513
630 Ga0207648_10043475
631 Ga0207674_10046982
632 Ga0207674_10051086
633 Ga0207674_10071063
634 Ga0207675_100576204
635 Ga0207675_101439943
636 Ga0207675_102589247
637 Ga0207698_12016288
638 Ga0209995_1018343
639 Ga0209588_1018897
640 Ga0209813_10010932
641 Ga0209974_10403223
642 Ga0207428_10003651
643 Ga0207428_10016876
644 Ga0207428_10023676
645 Ga0207428_10356035
646 Ga0207428_10466549
647 Ga0268265_10057311
648 Ga0268265_10133025
649 Ga0268265_11159430
650 Ga0268264_10873665
651 Ga0307509_10081840
652 Ga0307408_100001599
653 Ga0307408_100017916
654 Ga0307408_100103445
655 Ga0307405_10066608
656 Ga0307405_11107246
657 Ga0307405_11899230
658 Ga0307413_10005626
659 Ga0307413_10048805
660 Ga0307413_10097577
661 Ga0307413_11330946
662 Ga0307413_12184461
663 Ga0307410_10046647
664 Ga0307410_10056191
665 Ga0307406_10072647
666 Ga0307406_10693990
667 Ga0307407_10007769
668 Ga0307407_10022207
669 Ga0307412_10060242
670 Ga0307412_10075045
671 Ga0307412_10115174
672 Ga0307412_11060528
673 Ga0307409_100009261
674 Ga0307409_100010211
675 Ga0307409_101052886
676 Ga0307409_101153759
677 Ga0307409_101568652
678 Ga0307416_100015437
679 Ga0307416_100030441
680 Ga0307416_100080835
681 Ga0307416_100654790
682 Ga0307416_101341525
683 Ga0307414_10039231
684 Ga0307414_10093961
685 Ga0307414_10260349
686 Ga0307411_10005558
687 Ga0307411_10032856
688 Ga0307411_10110515
689 Ga0307411_10357072
690 Ga0307415_100002599
691 Ga0307415_100074666
692 Ga0307415_100559222
693 Ga0307415_101364202
694 Ga0373926_0406784
695 Ga0373934_0187161
696 Ga0373940_0032210
697 Ga0373951_0072741
698 Ga0373932_0123147
699 Ga0373941_0291647
700 Ga0373956_0057883
701 Ga0373955_0325192
702 Ga0373931_0065156
703 Ga0373935_0398911
704 Ga0373933_0263823
705 Ga0373933_1064465
706 Ga0373937_0075695
707 Ga0373925_0106771
708 Ga0373925_0504187
709 Ga0436364_0888291
710 Ga0451851_0433205
711 Ga0439448_0024359
712 Ga0439449_0053243
713 Ga0439450_002777
714 Ga0439444_0122920
715 Ga0439464_0094699
716 Ga0439460_0142243
717 Ga0453684_1095279
718 Ga0451576_0042920
719 Ga0466958_0835910
720 Ga0466967_1389974
721 Ga0495638_0371938
722 Ga0495651_0012574
723 Ga0495653_0055694
724 Ga0495580_0046966
725 Ga0495582_0014672
726 Ga0495639_0001884
727 Ga0495662_0022114
728 Ga0495664_0015651
729 Ga0495584_0457989
730 Ga0495594_0003447
731 Ga0495628_0050428
732 Ga0495666_0009926
733 Ga0495652_0027881
734 Ga0495665_0008395
735 Ga0495640_0001962
736 Ga0495640_0553353
737 Ga0495586_0026707
738 Ga0495587_0202552
739 Ga0495645_0002282
740 Ga0495645_0526915
741 Ga0495667_0014591
742 Ga0495667_0078063
743 Ga0495634_0007149
744 Ga0495634_0745484
745 Ga0495635_0006220
746 Ga0495659_0044204
747 Ga0495588_0266237
748 Ga0495599_0011265
749 Ga0495623_0334103
750 Ga0495623_0394916
751 Ga0495646_0031263
752 Ga0495658_0034011
753 Ga0495658_0398973
754 Ga0495669_0033170
755 Ga0495613_0023610
756 Ga0495624_0002190
757 Ga0495600_0042171
758 Ga0495581_0004366
759 Ga0495604_0007975
760 Ga0495674_0010642
761 Ga0495674_0336166
762 Ga0495676_0003074
763 Ga0495680_0031622
764 Ga0495675_0007090
765 Ga0495675_0067030
766 Ga0495684_0195243
767 Ga0495684_1064074
768 Ga0495686_0016465
769 Ga0495602_0590766
770 Ga0495614_0002505
771 Ga0496100_0235110
772 Ga0496101_1585314
773 Ga0496104_0268414
774 Ga0496106_0809795
775 Ga0496107_0588690
776 Ga0496109_1310687
777 Ga0496110_0200744
778 Ga0496111_0394898
779 Ga0496112_0038510
780 Ga0496112_0654882
781 Ga0496113_0630329
782 Ga0501291_055478
783 Ga0501299_095614
784 Ga0501034_0012017
785 Ga0501036_0103141
786 Ga0501037_1015397
787 Ga0501038_0754505
788 Ga0501038_0918497
789 Ga0501040_0271596
790 Ga0501040_0957758
791 Ga0501041_0686357
792 Ga0501042_0397421
793 Ga0501046_0564709
794 Ga0501071_0041824
795 Ga0501071_0244591
796 Ga0501071_0896631
797 Ga0501071_0951589
798 Ga0501071_1029922
799 Ga0501072_0002493
800 Ga0501072_0155321
801 Ga0501072_0164699
802 Ga0501072_0691678
803 Ga0501072_0811187
804 Ga0501072_0821410
805 Ga0501075_0145483
806 Ga0501075_0310926
807 Ga0501077_0297470
808 Ga0501077_0692786
809 Ga0501216_007626
810 Ga0501248_026536
811 Ga0501261_031285
812 Ga0501221_117347
813 Ga0501079_0041145
814 Ga0501079_0228185
815 Ga0501079_0567290
816 Ga0501080_1225973
817 Ga0501080_1631315
818 Ga0501081_0258896
819 Ga0501081_0400022
820 Ga0501273_006438
821 Ga0501273_026521
822 Ga0501044_0098552
823 Ga0501044_0462834
824 nmdc:mga04h51_12834_c1
825 nmdc:mga05p37_1298914_c1
826 nmdc:mga05p37_219368_c1
827 nmdc:mga05p37_23172_c1
828 nmdc:mga05p37_325752_c1
829 nmdc:mga05p37_3645_c1
830 nmdc:mga05p37_7832_c1
831 nmdc:mga09592_15120_c1
832 nmdc:mga09592_16051_c1
833 nmdc:mga09592_388873_c1
834 nmdc:mga09592_4810_c1
835 nmdc:mga0qj67_1006_c1
836 nmdc:mga0qj67_166967_c1
837 nmdc:mga0qj67_1871_c1
838 nmdc:mga0qj67_369694_c1
839 nmdc:mga0qj67_42292_c1
840 nmdc:mga0qj67_685324_c1
841 nmdc:mga06r32_12069_c1
842 nmdc:mga06r32_214_c1
843 nmdc:mga06r32_27835_c1
844 nmdc:mga06r32_567009_c1
845 nmdc:mga06r32_64417_c1
846 nmdc:mga06r32_739725_c1
847 nmdc:mga06r32_9978_c1
848 nmdc:mga06r32_99971_c1
849 nmdc:mga08y16_132767_c1
850 nmdc:mga08y16_195621_c1
851 nmdc:mga08y16_215167_c1
852 nmdc:mga08y16_5750_c1
853 nmdc:mga08y16_6491_c1
854 nmdc:mga08y16_929968_c1
855 nmdc:mga08y16_993_c1
856 nmdc:mga0n895_2098639_c1
857 nmdc:mga0n895_41187_c1
858 nmdc:mga0a205_111008_c1
859 Ga0501084_0026883
860 Ga0501084_0052150
861 Ga0501084_0449378
862 Ga0501084_0566263
863 Ga0590074_046836
864 Ga0590075_056169
865 Ga0501082_0066915
866 Ga0501082_0404855
867 Ga0501082_0877854
868 Ga0530510_0001687
869 Ga0530510_0258908
870 Ga0530510_0407938

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01740

STAS

STAS domain

3

108

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qcm-assembly1.cif.gz_d cryo em structure of the listeria stressosome 0.9116 2 115
6jhk-assembly1.cif.gz_A crystal structure of bacillus subtilis rsbs 0.9015 2 113
3zxn-assembly2.cif.gz_B moorella thermoacetica rsbs s58e 0.8767 4 114
6qcm-assembly1.cif.gz_d cryo em structure of the listeria stressosome 0.8758 2 115
7b0u-assembly1.cif.gz_F stressosome complex from listeria innocua 0.8746 4 115
ID Description Score Start End Superfamily
2vy9B00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8581 5 114 3.30.750.24
2vy9B00 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8374 5 114 3.30.750.24
af_G5EDS5_481_631_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8112 8 112 3.30.750.24
3if5A02 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8082 6 83 3.30.750.24
af_P53273_654_785_3.30.750.24 Alpha Beta;2-Layer Sandwich;Transcription Regulator spoIIAA;STAS domain 0.8056 10 113 3.30.750.24
ID Description Score Start End GO Terms
AF-A0A4Q3YJ11-F1-model_v4 STAS domain-containing protein 0.9908 1 99
AF-A0A7W0CDW5-F1-model_v4 RsbT antagonist protein RsbS 0.9905 1 110
AF-A0A327U379-F1-model_v4 RsbT antagonist protein RsbS 0.9888 2 117
AF-A0A6G7XMQ4-F1-model_v4 STAS domain-containing protein 0.9885 1 117
AF-S5W0E4-F1-model_v4 Anti-sigma-factor antagonist 0.988 2 117

Map