F443178

General Info

Members Datasets Scaffolds Average Seq Length
434 283 868 211

Family's Representative Sequence

Representative Sequence 3300048919|Ga0496116_0020542|Ga0496116_0020542_3500_4189
Length 229
Sequence MAAPALAIHRQERQMKLWSKSFADNTPIPGEFAFCVPDADAHVALSSNRNPDLHWEDAPAQTRSFVLICHDRDVPSKGDDVNQEGREVPASLPRVDFYHWALVDIPPGLTTIAAGSHSDGVIARGKPGPEAAGGTATAGGLRHGINDYTGWFANDADMKGDYYGYDGPCPPWNDTLLHHYVFTVYALDLERVPLDGKFTGAQVLEAIRGHVLAQASLTGTYTLNPKVAG

Samples

Sample ID Description Type Environment
1 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
8 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
62 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
63 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
83 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
84 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
85 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
86 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
132 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
137 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
138 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
139 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
140 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
141 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
142 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
143 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
144 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
150 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
151 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
152 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
153 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
154 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
155 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
156 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
157 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
158 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
159 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
160 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
164 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
165 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
166 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
171 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
176 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
177 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
178 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
181 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
182 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
183 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
184 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
187 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
188 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
189 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
190 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
191 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
192 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
193 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
194 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
197 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
198 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
199 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
200 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
201 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
202 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
225 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
234 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
235 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
236 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
237 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
238 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
239 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
242 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
243 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
244 2526164512 Azovibrio restrictus DSM 23866 Isolate Unclassified
245 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
246 2643221609 Acidovorax sp. Root217 Isolate Unclassified
247 2643221611 Acidovorax sp. Root219 Isolate Unclassified
248 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
249 2721755523 Delftia sp. HK171 Isolate Unclassified
250 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
251 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
252 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
253 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
254 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
255 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
256 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
257 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
258 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
259 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
260 2834641062 Cupriavidus gilardii JZ4 Isolate Unclassified
261 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
262 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
263 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
264 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
265 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
266 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
267 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
268 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
269 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
270 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
271 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
272 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
273 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
274 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
275 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
276 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
277 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
278 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
279 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
280 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
281 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
282 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
283 8003400568 Cupriavidus gilardii USM5 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.86
Metatranscriptomes 0.23
Isolates 9.91

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.22
Nodule 1.84
Rhizoplane 0.69
Rhizosphere 75.81
Stem 0
Stem Tuber 0.46
Unclassified 1.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496116_0020542 3300048919 Bacteria 5012
2 JGI25151J46595_10004512 3300003187 Bacteria 7352
3 JGI25151J46595_10005793 3300003187 Bacteria 6324
4 JGI25151J46595_10015522 3300003187 Bacteria 3352
5 Ga0006777J48905_1052548 3300003308 Bacteria 835
6 rootL2_10095601 3300003322 Bacteria 2462
7 Ga0055526_1005208 3300003771 Bacteria 7552
8 Ga0055526_1005987 3300003771 Bacteria 6759
9 Ga0055526_1010584 3300003771 Bacteria 4272
10 Ga0055524_1000300 3300003775 Bacteria 47498
11 Ga0055524_1015271 3300003775 Bacteria 2807
12 Ga0055536_1000110 3300003781 Bacteria 72378
13 Ga0055534_1001581 3300003784 Bacteria 8839
14 Ga0055534_1007859 3300003784 Bacteria 2484
15 Ga0065704_10071295 3300005289 Bacteria 11904
16 Ga0070658_10017581 3300005327 Bacteria 5719
17 Ga0070658_10037948 3300005327 Bacteria 3885
18 Ga0070658_10203738 3300005327 Bacteria 1670
19 Ga0070658_10246959 3300005327 Bacteria 1514
20 Ga0070658_10741263 3300005327 Bacteria 853
21 Ga0070683_100128825 3300005329 Bacteria 2394
22 Ga0070683_101056302 3300005329 Bacteria 780
23 Ga0070690_100075367 3300005330 Bacteria 2199
24 Ga0070670_100416094 3300005331 Bacteria 1188
25 Ga0070666_10179043 3300005335 Bacteria 1486
26 Ga0070666_10597432 3300005335 Bacteria 805
27 Ga0070680_100235058 3300005336 Bacteria 1548
28 Ga0068868_100036824 3300005338 Bacteria 3790
29 Ga0070689_100150814 3300005340 Bacteria 1875
30 Ga0070661_100313870 3300005344 Bacteria 1223
31 Ga0070675_100032773 3300005354 Bacteria 4206
32 Ga0070675_100067655 3300005354 Bacteria 2956
33 Ga0070671_100393097 3300005355 Bacteria 1186
34 Ga0070673_100167541 3300005364 Bacteria 1873
35 Ga0070659_100033067 3300005366 Bacteria 4015
36 Ga0070667_100005751 3300005367 Bacteria 10363
37 Ga0070667_100029930 3300005367 Bacteria 4540
38 Ga0070709_10269279 3300005434 Bacteria 1234
39 Ga0070709_10784231 3300005434 Bacteria 747
40 Ga0070713_100274091 3300005436 Bacteria 1546
41 Ga0070711_100046867 3300005439 Bacteria 2948
42 Ga0070694_100147469 3300005444 Bacteria 1715
43 Ga0070708_100463235 3300005445 Bacteria 1196
44 Ga0070663_100000540 3300005455 Bacteria 20011
45 Ga0070663_100053044 3300005455 Bacteria 2893
46 Ga0070663_100499731 3300005455 Unclassified 1010
47 Ga0070678_100706184 3300005456 Bacteria 909
48 Ga0070662_100028285 3300005457 Bacteria 3900
49 Ga0070681_10056855 3300005458 Bacteria 3893
50 Ga0068867_100084484 3300005459 Bacteria 2398
51 Ga0070698_100400987 3300005471 Bacteria 1305
52 Ga0070679_100010161 3300005530 Bacteria 8923
53 Ga0070679_100040635 3300005530 Bacteria 4628
54 Ga0070679_100137113 3300005530 Bacteria 2428
55 Ga0070679_100916049 3300005530 Bacteria 820
56 Ga0070684_100315365 3300005535 Bacteria 1436
57 Ga0068853_100079311 3300005539 Bacteria 2871
58 Ga0070672_100556867 3300005543 Bacteria 996
59 Ga0070665_100000097 3300005548 Bacteria 166302
60 Ga0070665_100000807 3300005548 Bacteria 40948
61 Ga0070665_100053124 3300005548 Bacteria 4064
62 Ga0070665_100077988 3300005548 Bacteria 3319
63 Ga0070665_100692915 3300005548 Bacteria 1032
64 Ga0068855_100002320 3300005563 Bacteria 23525
65 Ga0068855_100023489 3300005563 Bacteria 7384
66 Ga0068855_100089882 3300005563 Bacteria 3545
67 Ga0068855_100138966 3300005563 Bacteria 2771
68 Ga0068855_100157616 3300005563 Bacteria 2578
69 Ga0068855_100286390 3300005563 Bacteria 1828
70 Ga0070664_100445119 3300005564 Bacteria 1189
71 Ga0068854_100007239 3300005578 Bacteria 7085
72 Ga0068854_100011534 3300005578 Bacteria 5760
73 Ga0068854_100095666 3300005578 Bacteria 2218
74 Ga0068856_100306155 3300005614 Bacteria 1607
75 Ga0068852_100016112 3300005616 Bacteria 5818
76 Ga0068852_100101293 3300005616 Bacteria 2600
77 Ga0068852_100163415 3300005616 Bacteria 2081
78 Ga0068852_100208096 3300005616 Bacteria 1854
79 Ga0068852_100844795 3300005616 Bacteria 931
80 Ga0068859_100922080 3300005617 Bacteria 958
81 Ga0068861_100110861 3300005719 Bacteria 2198
82 Ga0068861_100464223 3300005719 Bacteria 1137
83 Ga0068851_10000643 3300005834 Bacteria 14875
84 Ga0068858_100002671 3300005842 Bacteria 17949
85 Ga0068862_100008560 3300005844 Bacteria 8465
86 Ga0070717_10132587 3300006028 Bacteria 2144
87 Ga0075367_10215890 3300006178 Bacteria 1200
88 Ga0075366_10080060 3300006195 Bacteria 1951
89 Ga0097621_100281599 3300006237 Bacteria 1464
90 Ga0097621_100525267 3300006237 Unclassified 1075
91 Ga0068871_100031415 3300006358 Bacteria 4188
92 Ga0075430_100017875 3300006846 Bacteria 6035
93 Ga0075430_100022977 3300006846 Bacteria 5303
94 Ga0075430_100111527 3300006846 Bacteria 2281
95 Ga0075431_100001786 3300006847 Bacteria 20289
96 Ga0075431_100021028 3300006847 Bacteria 6669
97 Ga0075431_100471037 3300006847 Bacteria 1250
98 Ga0075434_100441038 3300006871 Bacteria 1323
99 Ga0068865_100052656 3300006881 Bacteria 2822
100 Ga0068865_100544180 3300006881 Bacteria 974
101 Ga0075436_100008444 3300006914 Bacteria 7039
102 Ga0075436_100333155 3300006914 Bacteria 1092
103 Ga0097620_100922089 3300006931 Bacteria 958
104 Ga0079104_1000058 3300006946 Bacteria 165039
105 Ga0099826_10000014 3300006948 Bacteria 258520
106 Ga0105250_10005842 3300009092 Bacteria 5460
107 Ga0105240_10000617 3300009093 Bacteria 65935
108 Ga0105240_10029444 3300009093 Bacteria 7153
109 Ga0105240_10049734 3300009093 Bacteria 5289
110 Ga0105240_10263719 3300009093 Bacteria 1986
111 Ga0105240_10266637 3300009093 Bacteria 1973
112 Ga0111539_10860995 3300009094 Bacteria 1054
113 Ga0105245_10154021 3300009098 Bacteria 2176
114 Ga0105245_10215296 3300009098 Bacteria 1851
115 Ga0105243_10000649 3300009148 Bacteria 34418
116 Ga0105243_10041686 3300009148 Bacteria 3590
117 Ga0105241_10010588 3300009174 Bacteria 6765
118 Ga0105242_10204206 3300009176 Bacteria 1757
119 Ga0105242_10351906 3300009176 Bacteria 1361
120 Ga0105248_10327013 3300009177 Bacteria 1727
121 Ga0105237_10003535 3300009545 Bacteria 18521
122 Ga0105237_10048105 3300009545 Bacteria 4287
123 Ga0105237_10071318 3300009545 Bacteria 3469
124 Ga0105237_10141792 3300009545 Bacteria 2397
125 Ga0105237_10272407 3300009545 Bacteria 1696
126 Ga0105238_10000004 3300009551 Bacteria 390514
127 Ga0105238_10001654 3300009551 Bacteria 22378
128 Ga0105238_10004524 3300009551 Bacteria 13773
129 Ga0105238_10108432 3300009551 Bacteria 2758
130 Ga0105238_10156230 3300009551 Bacteria 2256
131 Ga0105238_10282680 3300009551 Bacteria 1641
132 Ga0105238_10553244 3300009551 Bacteria 1155
133 Ga0105249_10012883 3300009553 Bacteria 7377
134 Ga0105239_10001658 3300010375 Bacteria 29346
135 Ga0105239_10666860 3300010375 Bacteria 1188
136 Ga0157370_10089621 3300013104 Bacteria 2889
137 Ga0157369_10010335 3300013105 Bacteria 10644
138 Ga0157369_10420662 3300013105 Bacteria 1385
139 Ga0157369_10537622 3300013105 Bacteria 1208
140 Ga0157369_11260410 3300013105 Bacteria 754
141 Ga0157374_10015724 3300013296 Bacteria 6644
142 Ga0163162_10051769 3300013306 Bacteria 4121
143 Ga0157372_10006809 3300013307 Bacteria 12153
144 Ga0157372_10249433 3300013307 Bacteria 2060
145 Ga0157372_10577538 3300013307 Bacteria 1310
146 Ga0157372_10765559 3300013307 Bacteria 1122
147 Ga0157375_10069958 3300013308 Bacteria 3517
148 Ga0157376_10777776 3300014969 Bacteria 968
149 Ga0182007_10015877 3300015262 Bacteria 2794
150 Ga0207425_1023219 3300025245 Bacteria 1300
151 Ga0209233_1001164 3300025261 Bacteria 10648
152 Ga0209565_1000045 3300025263 Bacteria 226864
153 Ga0209565_1001433 3300025263 Bacteria 10537
154 Ga0209673_1033363 3300025273 Bacteria 1571
155 Ga0209675_1000247 3300025291 Bacteria 53629
156 Ga0209675_1001062 3300025291 Bacteria 17035
157 Ga0209675_1007825 3300025291 Bacteria 4026
158 Ga0209676_1000064 3300025292 Bacteria 321700
159 Ga0209025_1000690 3300025294 Bacteria 57778
160 Ga0209025_1000899 3300025294 Bacteria 46148
161 Ga0209025_1001826 3300025294 Bacteria 25060
162 Ga0209025_1003032 3300025294 Bacteria 16573
163 Ga0209564_1000462 3300025295 Bacteria 68050
164 Ga0209564_1002165 3300025295 Bacteria 16560
165 Ga0209564_1002213 3300025295 Bacteria 16207
166 Ga0209758_1028384 3300025297 Bacteria 2368
167 Ga0209256_1000105 3300025299 Bacteria 188238
168 Ga0209256_1000193 3300025299 Bacteria 117486
169 Ga0209051_1068960 3300025303 Bacteria 1074
170 Ga0207656_10003682 3300025321 Bacteria 5304
171 Ga0207656_10096898 3300025321 Bacteria 1347
172 Ga0207696_1005060 3300025711 Bacteria 5537
173 Ga0207680_10007659 3300025903 Bacteria 5275
174 Ga0207680_10484436 3300025903 Bacteria 880
175 Ga0207647_10000124 3300025904 Bacteria 60056
176 Ga0207705_10016063 3300025909 Bacteria 5373
177 Ga0207705_10065715 3300025909 Bacteria 2623
178 Ga0207705_10130226 3300025909 Bacteria 1872
179 Ga0207705_10470001 3300025909 Bacteria 976
180 Ga0207654_10163956 3300025911 Bacteria 1438
181 Ga0207707_10150734 3300025912 Bacteria 2033
182 Ga0207695_10000032 3300025913 Bacteria 521283
183 Ga0207695_10000965 3300025913 Bacteria 51285
184 Ga0207695_10047688 3300025913 Bacteria 4530
185 Ga0207695_10181180 3300025913 Bacteria 2027
186 Ga0207671_10011604 3300025914 Bacteria 7153
187 Ga0207671_10038173 3300025914 Bacteria 3560
188 Ga0207671_10088588 3300025914 Bacteria 2328
189 Ga0207671_10101822 3300025914 Bacteria 2176
190 Ga0207649_10169962 3300025920 Bacteria 1518
191 Ga0207652_10012406 3300025921 Bacteria 6886
192 Ga0207652_10050590 3300025921 Bacteria 3561
193 Ga0207652_10146662 3300025921 Bacteria 2112
194 Ga0207694_10000021 3300025924 Bacteria 300246
195 Ga0207694_10014030 3300025924 Bacteria 6041
196 Ga0207694_10027478 3300025924 Bacteria 4334
197 Ga0207694_10078751 3300025924 Bacteria 2584
198 Ga0207694_10084061 3300025924 Bacteria 2503
199 Ga0207650_10077190 3300025925 Bacteria 2518
200 Ga0207650_10359641 3300025925 Bacteria 1199
201 Ga0207659_10067644 3300025926 Bacteria 2595
202 Ga0207687_10222138 3300025927 Bacteria 1488
203 Ga0207700_10778154 3300025928 Bacteria 856
204 Ga0207644_10331672 3300025931 Bacteria 1232
205 Ga0207690_10051025 3300025932 Bacteria 2764
206 Ga0207706_10046945 3300025933 Bacteria 3823
207 Ga0207709_10000160 3300025935 Bacteria 91486
208 Ga0207669_10172211 3300025937 Bacteria 1542
209 Ga0207691_10291538 3300025940 Bacteria 1403
210 Ga0207711_10310670 3300025941 Bacteria 1455
211 Ga0207667_10002387 3300025949 Bacteria 23501
212 Ga0207667_10118557 3300025949 Bacteria 2727
213 Ga0207667_10236749 3300025949 Bacteria 1869
214 Ga0207667_10246873 3300025949 Bacteria 1826
215 Ga0207667_10391151 3300025949 Bacteria 1416
216 Ga0207712_10001058 3300025961 Bacteria 19293
217 Ga0207640_10053934 3300025981 Bacteria 2626
218 Ga0207640_10070044 3300025981 Bacteria 2357
219 Ga0207640_10076093 3300025981 Bacteria 2277
220 Ga0207658_10024187 3300025986 Bacteria 4247
221 Ga0207658_10036475 3300025986 Bacteria 3525
222 Ga0207703_10001626 3300026035 Bacteria 20244
223 Ga0207639_10000465 3300026041 Bacteria 27917
224 Ga0207639_10083412 3300026041 Bacteria 2537
225 Ga0207639_10330790 3300026041 Bacteria 1355
226 Ga0207678_10019331 3300026067 Bacteria 5984
227 Ga0207678_10347445 3300026067 Unclassified 1279
228 Ga0207708_10556688 3300026075 Bacteria 967
229 Ga0207702_10100102 3300026078 Bacteria 2556
230 Ga0207641_10525908 3300026088 Bacteria 1151
231 Ga0207674_10245039 3300026116 Bacteria 1739
232 Ga0207675_100138639 3300026118 Bacteria 2309
233 Ga0207683_10087353 3300026121 Bacteria 2773
234 Ga0207698_10007687 3300026142 Bacteria 6761
235 Ga0207698_10068519 3300026142 Bacteria 2802
236 Ga0207698_10308405 3300026142 Bacteria 1477
237 Ga0209281_1000017 3300027111 Bacteria 583251
238 Ga0209999_1071625 3300027543 Bacteria 665
239 Ga0209282_1000048 3300027666 Bacteria 111312
240 Ga0268266_10000013 3300028379 Bacteria 649715
241 Ga0268266_10000101 3300028379 Bacteria 180443
242 Ga0268266_10001974 3300028379 Bacteria 22989
243 Ga0268266_10016915 3300028379 Bacteria 6231
244 Ga0265332_10004679 3300031238 Bacteria 6393
245 Ga0307509_10001212 3300031507 Bacteria 43898
246 Ga0316575_10209741 3300031665 Bacteria 812
247 Ga0316579_10013336 3300031691 Bacteria 3534
248 Ga0316576_10099662 3300031727 Bacteria 2170
249 Ga0316578_10389625 3300031728 Bacteria 826
250 Ga0316577_10149101 3300031733 Bacteria 1318
251 Ga0307510_10065980 3300033180 Bacteria 3659
252 Ga0373961_0022280 3300035241 Bacteria 1694
253 Ga0316574_0392465 3300035398 Bacteria 874
254 Ga0316584_0457115 3300036712 Bacteria 902
255 Ga0373925_0033307 3300037068 Bacteria 3797
256 Ga0395899_0026899 3300037312 Bacteria 4340
257 Ga0395901_0163685 3300038443 Bacteria 2336
258 Ga0400484_35443 3300038725 Bacteria 9637
259 Ga0400490_11309 3300038726 Bacteria 20129
260 Ga0400490_52900 3300038726 Bacteria 12224
261 Ga0400485_05427 3300038735 Bacteria 1133
262 Ga0400488_28143 3300038741 Bacteria 6909
263 Ga0400488_46495 3300038741 Bacteria 9704
264 Ga0400486_19673 3300038742 Bacteria 4654
265 Ga0400483_015255 3300039062 Bacteria 1260
266 Ga0400483_140320 3300039062 Bacteria 11136
267 Ga0400483_180622 3300039062 Bacteria 7852
268 Ga0400483_251677 3300039062 Bacteria 2930
269 Ga0400489_66897 3300039093 Bacteria 7322
270 Ga0400487_04555 3300039110 Bacteria 2169
271 Ga0400487_43028 3300039110 Bacteria 10971
272 Ga0436361_0317634 3300039447 Bacteria 2288
273 Ga0451833_1412915 3300041491 Bacteria 1242
274 Ga0451577_0848624 3300042876 Bacteria 824
275 Ga0466966_0035482 3300044684 Bacteria 3221
276 Ga0466961_0392107 3300044693 Bacteria 843
277 Ga0453684_0007370 3300044712 Bacteria 20286
278 Ga0453684_0341452 3300044712 Bacteria 1691
279 Ga0466957_0309042 3300044842 Unclassified 1064
280 Ga0466959_0252705 3300045049 Bacteria 1215
281 Ga0466958_0022254 3300045836 Bacteria 3712
282 Ga0495617_000493 3300046452 Bacteria 20873
283 Ga0495638_0014182 3300046460 Bacteria 5395
284 Ga0495650_0000029 3300046471 Bacteria 453466
285 Ga0495650_0076966 3300046471 Bacteria 1295
286 Ga0495580_0204841 3300046472 Bacteria 1358
287 Ga0495580_0479006 3300046472 Bacteria 833
288 Ga0495605_0004939 3300046474 Bacteria 7791
289 Ga0495605_0040742 3300046474 Bacteria 2317
290 Ga0495605_0267296 3300046474 Bacteria 729
291 Ga0495584_0142390 3300046491 Bacteria 1217
292 Ga0495585_0011939 3300046492 Bacteria 5129
293 Ga0495596_0006299 3300046500 Bacteria 5485
294 Ga0495607_0014138 3300046501 Bacteria 5208
295 Ga0495607_0071662 3300046501 Bacteria 1931
296 Ga0495607_0360869 3300046501 Bacteria 668
297 Ga0495583_0026568 3300046506 Bacteria 2866
298 Ga0495606_0113509 3300046507 Bacteria 1631
299 Ga0495610_0003749 3300046512 Bacteria 11632
300 Ga0495616_0010536 3300046513 Bacteria 5347
301 Ga0495666_0121084 3300046526 Bacteria 1225
302 Ga0495598_0102678 3300046537 Bacteria 948
303 Ga0495609_0015701 3300046538 Bacteria 3540
304 Ga0495597_0031451 3300046542 Bacteria 2415
305 Ga0495633_0000203 3300046558 Bacteria 75474
306 Ga0495656_0002580 3300046615 Bacteria 6039
307 Ga0495625_0268974 3300046660 Bacteria 1100
308 Ga0495661_0010776 3300046665 Bacteria 6222
309 Ga0495671_0002656 3300046692 Bacteria 11224
310 Ga0495671_0089574 3300046692 Bacteria 1506
311 Ga0495604_0026945 3300047317 Bacteria 4572
312 Ga0495672_0006673 3300047320 Bacteria 8866
313 Ga0495672_0016637 3300047320 Bacteria 4945
314 Ga0495683_0025684 3300047323 Bacteria 3018
315 Ga0495687_074106 3300047443 Bacteria 1354
316 Ga0495673_0012599 3300047469 Bacteria 4474
317 Ga0496102_0814280 3300048905 Bacteria 856
318 Ga0496104_0269041 3300048907 Bacteria 1617
319 Ga0496106_0633639 3300048909 Bacteria 855
320 Ga0496116_0008195 3300048919 Bacteria 9113
321 Ga0496121_0024269 3300048924 Bacteria 5808
322 Ga0496121_0028592 3300048924 Bacteria 5187
323 Ga0496121_0237107 3300048924 Bacteria 1274
324 Ga0496122_0005665 3300048925 Bacteria 14746
325 Ga0496122_0026992 3300048925 Bacteria 4928
326 Ga0496123_0006518 3300048926 Bacteria 11284
327 Ga0496123_0040880 3300048926 Bacteria 3222
328 Ga0496125_0000414 3300048928 Bacteria 79745
329 Ga0496126_0008908 3300048929 Bacteria 10745
330 Ga0496126_0146348 3300048929 Bacteria 2029
331 Ga0496126_0176334 3300048929 Unclassified 1818
332 Ga0496126_0440175 3300048929 Bacteria 1051
333 Ga0495682_0000013 3300049460 Bacteria 259670
334 Ga0501032_0002834 3300049569 Bacteria 13488
335 Ga0501032_0017216 3300049569 Bacteria 5075
336 Ga0501033_0005534 3300049570 Bacteria 9991
337 Ga0501034_0000385 3300049571 Bacteria 75496
338 Ga0501034_0004264 3300049571 Bacteria 15952
339 Ga0501034_0004470 3300049571 Bacteria 15547
340 Ga0501036_0011574 3300049572 Bacteria 7310
341 Ga0501036_0129972 3300049572 Bacteria 2126
342 Ga0501036_0443905 3300049572 Bacteria 1081
343 Ga0501037_0001771 3300049573 Bacteria 15679
344 Ga0501037_0097289 3300049573 Bacteria 2126
345 Ga0501038_0000845 3300049574 Bacteria 27143
346 Ga0501038_0070068 3300049574 Bacteria 2977
347 Ga0501039_0120170 3300049575 Bacteria 2058
348 Ga0501040_0096689 3300049576 Bacteria 2056
349 Ga0501042_0054275 3300049578 Bacteria 2858
350 Ga0501043_0002287 3300049579 Bacteria 16248
351 Ga0501046_0003523 3300049580 Bacteria 14334
352 Ga0501046_0004323 3300049580 Bacteria 12931
353 Ga0501047_0001407 3300049581 Bacteria 23589
354 Ga0501047_0323080 3300049581 Bacteria 1383
355 Ga0501047_0412485 3300049581 Bacteria 1183
356 Ga0501048_0016038 3300049582 Bacteria 5524
357 Ga0501068_0007188 3300049584 Bacteria 6166
358 Ga0501069_0003850 3300049585 Bacteria 7730
359 Ga0501070_0008052 3300049586 Bacteria 8919
360 Ga0501071_0000771 3300049587 Bacteria 16995
361 Ga0501073_0007303 3300049589 Bacteria 8225
362 Ga0501073_0014861 3300049589 Bacteria 5649
363 Ga0501074_0004270 3300049590 Bacteria 10196
364 Ga0501074_0327925 3300049590 Bacteria 1087
365 Ga0501076_0053618 3300049592 Bacteria 3196
366 Ga0501079_0014501 3300049741 Bacteria 6009
367 Ga0501080_0367416 3300049742 Bacteria 1297
368 Ga0501083_0013059 3300049744 Bacteria 5802
369 Ga0501035_0006281 3300049822 Bacteria 11175
370 Ga0501044_0014347 3300049823 Bacteria 8554
371 Ga0501044_0053474 3300049823 Bacteria 4154
372 Ga0501045_0013653 3300049824 Bacteria 5741
373 Ga0501045_0213032 3300049824 Bacteria 1439
374 Ga0501045_0327112 3300049824 Bacteria 1141
375 nmdc:mga05p37_190020_c1 3300050507 Bacteria 2494
376 nmdc:mga09592_89823_c1 3300050508 Bacteria 2624
377 nmdc:mga0qj67_14361_c1 3300050509 Bacteria 5987
378 nmdc:mga0qj67_35046_c1 3300050509 Bacteria 3923
379 nmdc:mga0qj67_38625_c1 3300050509 Bacteria 3746
380 nmdc:mga06r32_1134784_c1 3300050510 Bacteria 730
381 nmdc:mga06r32_14419_c1 3300050510 Bacteria 7173
382 nmdc:mga06r32_144405_c1 3300050510 Bacteria 2357
383 nmdc:mga08y16_1125533_c1 3300050511 Bacteria 759
384 Ga0500635_0064680 3300053080 Bacteria 1285
385 Ga0500643_038533 3300053087 Bacteria 1417
386 Ga0500651_0000008 3300053093 Bacteria 287738
387 Ga0500558_069558 3300053106 Bacteria 1455
388 Ga0500618_006772 3300053125 Bacteria 3334
389 Ga0500616_0014382 3300053153 Bacteria 4549
390 Ga0500661_000412 3300055283 Bacteria 7904
391 Ga0501082_0018892 3300060353 Bacteria 5938
392 2513953986 2513237150 Bacteria 6553639
393 2514040107 2513237165 Bacteria 6771773
394 2521561136 2521172590 Bacteria 5047645
395 2526213428 2526164512 Bacteria 4025691
396 2553005986 2551306416 Bacteria 6152985
397 2644061113 2643221609 Bacteria 6756331
398 2644071822 2643221611 Bacteria 6820941
399 2687578718 2687453129 Bacteria 4387428
400 2722881485 2721755523 Bacteria 6430384
401 2746087532 2744054900 Bacteria 8399525
402 2746095894 2744054901 Bacteria 8397047
403 2765567571 2765235838 Bacteria 5445269
404 2808968331 2808606384 Bacteria 8474373
405 2808982987 2808606386 Bacteria 4471946
406 2809003162 2808606390 Bacteria 8476311
407 2809010439 2808606391 Bacteria 8308166
408 2809130506 2808606415 Bacteria 4576710
409 2809150017 2808606419 Bacteria 4576925
410 2819617515 2818991449 Bacteria 5518009
411 2834641239 2834641062 Bacteria 5559922
412 2839099515 2839094727 Bacteria 5534556
413 2839141387 2839138175 Bacteria 6549354
414 2842720791 2842718218 Bacteria 4560148
415 2843693407 2843690924 Bacteria 5169057
416 2852621764 2852618963 Bacteria 4577824
417 2855199933 2855195626 Bacteria 4927512
418 2857580620 2857576091 Bacteria 5465855
419 2858467108 2858466076 Bacteria 4722413
420 2858692641 2858688981 Bacteria 8184122
421 2884216960 2884215851 Bacteria 4554841
422 2904442233 2904439833 Bacteria 5931679
423 2904481241 2904479285 Bacteria 5073931
424 2904533512 2904530477 Bacteria 5876334
425 2904586467 2904584206 Bacteria 6028872
426 2904591720 2904589729 Bacteria 6113573
427 2904602127 2904601388 Bacteria 5884906
428 2919051212 2919046199 Bacteria 5567169
429 2919083534 2919079590 Bacteria 5946433
430 2923514976 2923510766 Bacteria 5926163
431 2928133536 2928130867 Bacteria 5467269
432 3007396076 3007395558 Bacteria 6755444
433 644746778 644736347 Bacteria 6476522
434 8003401079 8003400568 Bacteria 5535898
435 Ga0496116_0020542
436 JGI25151J46595_10004512
437 JGI25151J46595_10005793
438 JGI25151J46595_10015522
439 Ga0006777J48905_1052548
440 rootL2_10095601
441 Ga0055526_1005208
442 Ga0055526_1005987
443 Ga0055526_1010584
444 Ga0055524_1000300
445 Ga0055524_1015271
446 Ga0055536_1000110
447 Ga0055534_1001581
448 Ga0055534_1007859
449 Ga0065704_10071295
450 Ga0070658_10017581
451 Ga0070658_10037948
452 Ga0070658_10203738
453 Ga0070658_10246959
454 Ga0070658_10741263
455 Ga0070683_100128825
456 Ga0070683_101056302
457 Ga0070690_100075367
458 Ga0070670_100416094
459 Ga0070666_10179043
460 Ga0070666_10597432
461 Ga0070680_100235058
462 Ga0068868_100036824
463 Ga0070689_100150814
464 Ga0070661_100313870
465 Ga0070675_100032773
466 Ga0070675_100067655
467 Ga0070671_100393097
468 Ga0070673_100167541
469 Ga0070659_100033067
470 Ga0070667_100005751
471 Ga0070667_100029930
472 Ga0070709_10269279
473 Ga0070709_10784231
474 Ga0070713_100274091
475 Ga0070711_100046867
476 Ga0070694_100147469
477 Ga0070708_100463235
478 Ga0070663_100000540
479 Ga0070663_100053044
480 Ga0070663_100499731
481 Ga0070678_100706184
482 Ga0070662_100028285
483 Ga0070681_10056855
484 Ga0068867_100084484
485 Ga0070698_100400987
486 Ga0070679_100010161
487 Ga0070679_100040635
488 Ga0070679_100137113
489 Ga0070679_100916049
490 Ga0070684_100315365
491 Ga0068853_100079311
492 Ga0070672_100556867
493 Ga0070665_100000097
494 Ga0070665_100000807
495 Ga0070665_100053124
496 Ga0070665_100077988
497 Ga0070665_100692915
498 Ga0068855_100002320
499 Ga0068855_100023489
500 Ga0068855_100089882
501 Ga0068855_100138966
502 Ga0068855_100157616
503 Ga0068855_100286390
504 Ga0070664_100445119
505 Ga0068854_100007239
506 Ga0068854_100011534
507 Ga0068854_100095666
508 Ga0068856_100306155
509 Ga0068852_100016112
510 Ga0068852_100101293
511 Ga0068852_100163415
512 Ga0068852_100208096
513 Ga0068852_100844795
514 Ga0068859_100922080
515 Ga0068861_100110861
516 Ga0068861_100464223
517 Ga0068851_10000643
518 Ga0068858_100002671
519 Ga0068862_100008560
520 Ga0070717_10132587
521 Ga0075367_10215890
522 Ga0075366_10080060
523 Ga0097621_100281599
524 Ga0097621_100525267
525 Ga0068871_100031415
526 Ga0075430_100017875
527 Ga0075430_100022977
528 Ga0075430_100111527
529 Ga0075431_100001786
530 Ga0075431_100021028
531 Ga0075431_100471037
532 Ga0075434_100441038
533 Ga0068865_100052656
534 Ga0068865_100544180
535 Ga0075436_100008444
536 Ga0075436_100333155
537 Ga0097620_100922089
538 Ga0079104_1000058
539 Ga0099826_10000014
540 Ga0105250_10005842
541 Ga0105240_10000617
542 Ga0105240_10029444
543 Ga0105240_10049734
544 Ga0105240_10263719
545 Ga0105240_10266637
546 Ga0111539_10860995
547 Ga0105245_10154021
548 Ga0105245_10215296
549 Ga0105243_10000649
550 Ga0105243_10041686
551 Ga0105241_10010588
552 Ga0105242_10204206
553 Ga0105242_10351906
554 Ga0105248_10327013
555 Ga0105237_10003535
556 Ga0105237_10048105
557 Ga0105237_10071318
558 Ga0105237_10141792
559 Ga0105237_10272407
560 Ga0105238_10000004
561 Ga0105238_10001654
562 Ga0105238_10004524
563 Ga0105238_10108432
564 Ga0105238_10156230
565 Ga0105238_10282680
566 Ga0105238_10553244
567 Ga0105249_10012883
568 Ga0105239_10001658
569 Ga0105239_10666860
570 Ga0157370_10089621
571 Ga0157369_10010335
572 Ga0157369_10420662
573 Ga0157369_10537622
574 Ga0157369_11260410
575 Ga0157374_10015724
576 Ga0163162_10051769
577 Ga0157372_10006809
578 Ga0157372_10249433
579 Ga0157372_10577538
580 Ga0157372_10765559
581 Ga0157375_10069958
582 Ga0157376_10777776
583 Ga0182007_10015877
584 Ga0207425_1023219
585 Ga0209233_1001164
586 Ga0209565_1000045
587 Ga0209565_1001433
588 Ga0209673_1033363
589 Ga0209675_1000247
590 Ga0209675_1001062
591 Ga0209675_1007825
592 Ga0209676_1000064
593 Ga0209025_1000690
594 Ga0209025_1000899
595 Ga0209025_1001826
596 Ga0209025_1003032
597 Ga0209564_1000462
598 Ga0209564_1002165
599 Ga0209564_1002213
600 Ga0209758_1028384
601 Ga0209256_1000105
602 Ga0209256_1000193
603 Ga0209051_1068960
604 Ga0207656_10003682
605 Ga0207656_10096898
606 Ga0207696_1005060
607 Ga0207680_10007659
608 Ga0207680_10484436
609 Ga0207647_10000124
610 Ga0207705_10016063
611 Ga0207705_10065715
612 Ga0207705_10130226
613 Ga0207705_10470001
614 Ga0207654_10163956
615 Ga0207707_10150734
616 Ga0207695_10000032
617 Ga0207695_10000965
618 Ga0207695_10047688
619 Ga0207695_10181180
620 Ga0207671_10011604
621 Ga0207671_10038173
622 Ga0207671_10088588
623 Ga0207671_10101822
624 Ga0207649_10169962
625 Ga0207652_10012406
626 Ga0207652_10050590
627 Ga0207652_10146662
628 Ga0207694_10000021
629 Ga0207694_10014030
630 Ga0207694_10027478
631 Ga0207694_10078751
632 Ga0207694_10084061
633 Ga0207650_10077190
634 Ga0207650_10359641
635 Ga0207659_10067644
636 Ga0207687_10222138
637 Ga0207700_10778154
638 Ga0207644_10331672
639 Ga0207690_10051025
640 Ga0207706_10046945
641 Ga0207709_10000160
642 Ga0207669_10172211
643 Ga0207691_10291538
644 Ga0207711_10310670
645 Ga0207667_10002387
646 Ga0207667_10118557
647 Ga0207667_10236749
648 Ga0207667_10246873
649 Ga0207667_10391151
650 Ga0207712_10001058
651 Ga0207640_10053934
652 Ga0207640_10070044
653 Ga0207640_10076093
654 Ga0207658_10024187
655 Ga0207658_10036475
656 Ga0207703_10001626
657 Ga0207639_10000465
658 Ga0207639_10083412
659 Ga0207639_10330790
660 Ga0207678_10019331
661 Ga0207678_10347445
662 Ga0207708_10556688
663 Ga0207702_10100102
664 Ga0207641_10525908
665 Ga0207674_10245039
666 Ga0207675_100138639
667 Ga0207683_10087353
668 Ga0207698_10007687
669 Ga0207698_10068519
670 Ga0207698_10308405
671 Ga0209281_1000017
672 Ga0209999_1071625
673 Ga0209282_1000048
674 Ga0268266_10000013
675 Ga0268266_10000101
676 Ga0268266_10001974
677 Ga0268266_10016915
678 Ga0265332_10004679
679 Ga0307509_10001212
680 Ga0316575_10209741
681 Ga0316579_10013336
682 Ga0316576_10099662
683 Ga0316578_10389625
684 Ga0316577_10149101
685 Ga0307510_10065980
686 Ga0373961_0022280
687 Ga0316574_0392465
688 Ga0316584_0457115
689 Ga0373925_0033307
690 Ga0395899_0026899
691 Ga0395901_0163685
692 Ga0400484_35443
693 Ga0400490_11309
694 Ga0400490_52900
695 Ga0400485_05427
696 Ga0400488_28143
697 Ga0400488_46495
698 Ga0400486_19673
699 Ga0400483_015255
700 Ga0400483_140320
701 Ga0400483_180622
702 Ga0400483_251677
703 Ga0400489_66897
704 Ga0400487_04555
705 Ga0400487_43028
706 Ga0436361_0317634
707 Ga0451833_1412915
708 Ga0451577_0848624
709 Ga0466966_0035482
710 Ga0466961_0392107
711 Ga0453684_0007370
712 Ga0453684_0341452
713 Ga0466957_0309042
714 Ga0466959_0252705
715 Ga0466958_0022254
716 Ga0495617_000493
717 Ga0495638_0014182
718 Ga0495650_0000029
719 Ga0495650_0076966
720 Ga0495580_0204841
721 Ga0495580_0479006
722 Ga0495605_0004939
723 Ga0495605_0040742
724 Ga0495605_0267296
725 Ga0495584_0142390
726 Ga0495585_0011939
727 Ga0495596_0006299
728 Ga0495607_0014138
729 Ga0495607_0071662
730 Ga0495607_0360869
731 Ga0495583_0026568
732 Ga0495606_0113509
733 Ga0495610_0003749
734 Ga0495616_0010536
735 Ga0495666_0121084
736 Ga0495598_0102678
737 Ga0495609_0015701
738 Ga0495597_0031451
739 Ga0495633_0000203
740 Ga0495656_0002580
741 Ga0495625_0268974
742 Ga0495661_0010776
743 Ga0495671_0002656
744 Ga0495671_0089574
745 Ga0495604_0026945
746 Ga0495672_0006673
747 Ga0495672_0016637
748 Ga0495683_0025684
749 Ga0495687_074106
750 Ga0495673_0012599
751 Ga0496102_0814280
752 Ga0496104_0269041
753 Ga0496106_0633639
754 Ga0496116_0008195
755 Ga0496121_0024269
756 Ga0496121_0028592
757 Ga0496121_0237107
758 Ga0496122_0005665
759 Ga0496122_0026992
760 Ga0496123_0006518
761 Ga0496123_0040880
762 Ga0496125_0000414
763 Ga0496126_0008908
764 Ga0496126_0146348
765 Ga0496126_0176334
766 Ga0496126_0440175
767 Ga0495682_0000013
768 Ga0501032_0002834
769 Ga0501032_0017216
770 Ga0501033_0005534
771 Ga0501034_0000385
772 Ga0501034_0004264
773 Ga0501034_0004470
774 Ga0501036_0011574
775 Ga0501036_0129972
776 Ga0501036_0443905
777 Ga0501037_0001771
778 Ga0501037_0097289
779 Ga0501038_0000845
780 Ga0501038_0070068
781 Ga0501039_0120170
782 Ga0501040_0096689
783 Ga0501042_0054275
784 Ga0501043_0002287
785 Ga0501046_0003523
786 Ga0501046_0004323
787 Ga0501047_0001407
788 Ga0501047_0323080
789 Ga0501047_0412485
790 Ga0501048_0016038
791 Ga0501068_0007188
792 Ga0501069_0003850
793 Ga0501070_0008052
794 Ga0501071_0000771
795 Ga0501073_0007303
796 Ga0501073_0014861
797 Ga0501074_0004270
798 Ga0501074_0327925
799 Ga0501076_0053618
800 Ga0501079_0014501
801 Ga0501080_0367416
802 Ga0501083_0013059
803 Ga0501035_0006281
804 Ga0501044_0014347
805 Ga0501044_0053474
806 Ga0501045_0013653
807 Ga0501045_0213032
808 Ga0501045_0327112
809 nmdc:mga05p37_190020_c1
810 nmdc:mga09592_89823_c1
811 nmdc:mga0qj67_14361_c1
812 nmdc:mga0qj67_35046_c1
813 nmdc:mga0qj67_38625_c1
814 nmdc:mga06r32_1134784_c1
815 nmdc:mga06r32_14419_c1
816 nmdc:mga06r32_144405_c1
817 nmdc:mga08y16_1125533_c1
818 Ga0500635_0064680
819 Ga0500643_038533
820 Ga0500651_0000008
821 Ga0500558_069558
822 Ga0500618_006772
823 Ga0500616_0014382
824 Ga0500661_000412
825 Ga0501082_0018892
826 2513953986
827 2514040107
828 2521561136
829 2526213428
830 2553005986
831 2644061113
832 2644071822
833 2687578718
834 2722881485
835 2746087532
836 2746095894
837 2765567571
838 2808968331
839 2808982987
840 2809003162
841 2809010439
842 2809130506
843 2809150017
844 2819617515
845 2834641239
846 2839099515
847 2839141387
848 2842720791
849 2843693407
850 2852621764
851 2855199933
852 2857580620
853 2858467108
854 2858692641
855 2884216960
856 2904442233
857 2904481241
858 2904533512
859 2904586467
860 2904591720
861 2904602127
862 2919051212
863 2919083534
864 2923514976
865 2928133536
866 3007396076
867 644746778
868 8003401079

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01161

PBP

Phosphatidylethanolamine-binding protein

27

221

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
1fux-assembly1.cif.gz_B crystal structure of e.coli ybcl, a new member of the mammalian pebp family 0.8977 2 208
1vi3-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.8975 2 208
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.8947 2 208
3n08-assembly1.cif.gz_B crystal structure of a putative phosphatidylethanolamine-binding protein (pebp) homolog ct736 from chlamydia trachomatis d/uw-3/cx 0.8822 2 207
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.879 2 208
ID Description Score Start End Superfamily
af_P77368_20_183_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8993 2 208 3.90.280.10
1fjjA00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8923 1 205 3.90.280.10
3n08A00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8898 2 207 3.90.280.10
1fjjA00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8757 1 205 3.90.280.10
4begB00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8731 2 208 3.90.280.10
ID Description Score Start End GO Terms
AF-A0A7I8ECA7-F1-model_v4 Phospholipid-binding protein 0.9875 1 213
AF-A0A257QJA4-F1-model_v4 Pyruvate, phosphate dikinase (Pyruvate, orthophosphate dikinase) 0.9844 25 214 GO:0006090
GO:0050242
AF-C3X4Y9-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9843 1 213
AF-I3U9P2-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9831 2 215
AF-A0A4Y6PTT7-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9827 1 211

Map