F443074

General Info

Members Datasets Scaffolds Average Seq Length
434 197 434 125

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10198708|Ga0105251_101987082
Length 133
Sequence MTGEFSLMQMQRSGERGSATLKFVIVMAILCSAAYAGYLYVPVAFQANTFKELMQHYADVAVAQGYPPSWAGEQLMKSAPEYEIPANAIITPAQRDNRIEIRVQYVRAIEFPGYTYNYEFDHTVKSTAFLAFK

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
53 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
137 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
138 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
147 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
148 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
149 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
150 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
151 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
152 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
153 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
154 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
155 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
156 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
157 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
158 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
159 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
160 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
170 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
171 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
172 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
173 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
174 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
175 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
176 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
177 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
178 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
179 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
180 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
181 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
182 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
183 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
184 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
185 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
186 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
187 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
188 3300049852 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control Metagenome Rhizosphere
189 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
190 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
191 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
192 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
193 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
194 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
195 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
196 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
197 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.46
Rhizosphere 96.54
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_11080 2162886007 Unclassified 3949
2 CNAas_1001197 3300000532 Bacteria 2333
3 JGI24751J29686_10000057 3300002459 Bacteria 62893
4 JGI24751J29686_10000130 3300002459 Bacteria 37822
5 Ga0065714_10002185 3300005288 Bacteria 199213
6 Ga0065704_10076258 3300005289 Bacteria 5200
7 Ga0065712_10010223 3300005290 Bacteria 2277
8 Ga0065712_10016005 3300005290 Bacteria 2896
9 Ga0065712_10118042 3300005290 Bacteria 1712
10 Ga0065712_10126780 3300005290 Bacteria 1598
11 Ga0065712_10210041 3300005290 Bacteria 1076
12 Ga0065715_10015971 3300005293 Bacteria 1997
13 Ga0065715_10016448 3300005293 Bacteria 1665
14 Ga0065715_10024804 3300005293 Bacteria 1260
15 Ga0065715_10077002 3300005293 Bacteria 546
16 Ga0065715_10119045 3300005293 Bacteria 2297
17 Ga0065715_10139570 3300005293 Bacteria 1866
18 Ga0065715_10155495 3300005293 Bacteria 1677
19 Ga0065707_10006535 3300005295 Bacteria 4163
20 Ga0070670_100000055 3300005331 Bacteria 120693
21 Ga0070670_100178448 3300005331 Bacteria 1843
22 Ga0070670_100381382 3300005331 Bacteria 1242
23 Ga0070670_100661371 3300005331 Bacteria 938
24 Ga0068869_101697098 3300005334 Bacteria 564
25 Ga0070689_100339611 3300005340 Bacteria 1258
26 Ga0070689_100440894 3300005340 Bacteria 1107
27 Ga0070689_100978970 3300005340 Bacteria 752
28 Ga0070687_100867663 3300005343 Bacteria 645
29 Ga0070692_10038945 3300005345 Bacteria 2425
30 Ga0070669_100063722 3300005353 Bacteria 2714
31 Ga0070669_101086464 3300005353 Bacteria 689
32 Ga0070671_100511876 3300005355 Bacteria 1033
33 Ga0070671_101544161 3300005355 Bacteria 588
34 Ga0070673_100300601 3300005364 Bacteria 1413
35 Ga0070673_100348599 3300005364 Bacteria 1314
36 Ga0070673_101563572 3300005364 Bacteria 623
37 Ga0070659_100132526 3300005366 Bacteria 2025
38 Ga0070659_101408303 3300005366 Bacteria 620
39 Ga0070701_10303034 3300005438 Bacteria 983
40 Ga0070705_100290541 3300005440 Bacteria 1167
41 Ga0070705_100494477 3300005440 Bacteria 927
42 Ga0070705_100506886 3300005440 Bacteria 917
43 Ga0070705_101009344 3300005440 Bacteria 676
44 Ga0070700_100076030 3300005441 Bacteria 2155
45 Ga0070700_100200759 3300005441 Bacteria 1400
46 Ga0070700_100955209 3300005441 Bacteria 701
47 Ga0070700_100976698 3300005441 Bacteria 695
48 Ga0070700_101406882 3300005441 Bacteria 590
49 Ga0070694_100055281 3300005444 Bacteria 2692
50 Ga0070694_101447681 3300005444 Unclassified 580
51 Ga0070708_100175385 3300005445 Bacteria 2003
52 Ga0070663_100611663 3300005455 Bacteria 918
53 Ga0068867_101007373 3300005459 Bacteria 756
54 Ga0070685_10143335 3300005466 Bacteria 1507
55 Ga0070706_100000126 3300005467 Bacteria 94634
56 Ga0070706_101842968 3300005467 Bacteria 549
57 Ga0070707_101511607 3300005468 Unclassified 638
58 Ga0070699_100181947 3300005518 Bacteria 1865
59 Ga0070699_100315115 3300005518 Bacteria 1405
60 Ga0068853_100200773 3300005539 Bacteria 1815
61 Ga0068853_100769936 3300005539 Bacteria 920
62 Ga0070695_100154934 3300005545 Bacteria 1602
63 Ga0070695_100690891 3300005545 Bacteria 809
64 Ga0070695_100776551 3300005545 Bacteria 766
65 Ga0070695_101675247 3300005545 Bacteria 532
66 Ga0070696_101872234 3300005546 Bacteria 519
67 Ga0070693_100109369 3300005547 Bacteria 1697
68 Ga0070704_100457076 3300005549 Bacteria 1101
69 Ga0070704_101067418 3300005549 Bacteria 733
70 Ga0070704_101273250 3300005549 Bacteria 672
71 Ga0068855_100620767 3300005563 Bacteria 1164
72 Ga0070664_100203729 3300005564 Bacteria 1766
73 Ga0070664_100609601 3300005564 Bacteria 1013
74 Ga0070664_101230561 3300005564 Bacteria 707
75 Ga0068857_100116633 3300005577 Bacteria 2402
76 Ga0068857_100380631 3300005577 Bacteria 1310
77 Ga0068857_101223772 3300005577 Bacteria 727
78 Ga0068854_100481949 3300005578 Bacteria 1041
79 Ga0068854_100810483 3300005578 Bacteria 817
80 Ga0068854_101839675 3300005578 Bacteria 556
81 Ga0068854_101910733 3300005578 Bacteria 546
82 Ga0070702_100066403 3300005615 Bacteria 2115
83 Ga0070702_100104006 3300005615 Bacteria 1747
84 Ga0070702_100229305 3300005615 Bacteria 1247
85 Ga0070702_100240898 3300005615 Bacteria 1221
86 Ga0070702_100776162 3300005615 Bacteria 739
87 Ga0070702_100879811 3300005615 Bacteria 699
88 Ga0068852_100126075 3300005616 Bacteria 2351
89 Ga0068852_100512848 3300005616 Bacteria 1195
90 Ga0068859_100075577 3300005617 Bacteria 3409
91 Ga0068859_100131115 3300005617 Bacteria 2578
92 Ga0068859_100239227 3300005617 Bacteria 1904
93 Ga0068859_100268942 3300005617 Bacteria 1796
94 Ga0068859_100309074 3300005617 Bacteria 1674
95 Ga0068859_100782011 3300005617 Bacteria 1043
96 Ga0068859_101231151 3300005617 Bacteria 824
97 Ga0068859_102166314 3300005617 Bacteria 614
98 Ga0068864_100246593 3300005618 Bacteria 1657
99 Ga0068864_100265317 3300005618 Bacteria 1598
100 Ga0068864_100646140 3300005618 Bacteria 1030
101 Ga0068864_101674816 3300005618 Bacteria 641
102 Ga0068864_102083612 3300005618 Bacteria 574
103 Ga0068866_10251958 3300005718 Bacteria 1081
104 Ga0068861_100419803 3300005719 Bacteria 1192
105 Ga0068861_100751759 3300005719 Bacteria 911
106 Ga0068870_10229931 3300005840 Bacteria 1139
107 Ga0068863_101148611 3300005841 Bacteria 782
108 Ga0068858_100318656 3300005842 Bacteria 1485
109 Ga0068858_100420969 3300005842 Bacteria 1284
110 Ga0068858_100446161 3300005842 Bacteria 1246
111 Ga0068860_100012137 3300005843 Bacteria 8488
112 Ga0068860_100090019 3300005843 Bacteria 2922
113 Ga0068860_100104569 3300005843 Bacteria 2703
114 Ga0068860_100540420 3300005843 Bacteria 1167
115 Ga0068860_100939919 3300005843 Bacteria 881
116 Ga0068862_100287670 3300005844 Bacteria 1508
117 Ga0068862_100613844 3300005844 Bacteria 1046
118 Ga0068862_101490325 3300005844 Bacteria 682
119 Ga0081455_10519532 3300005937 Bacteria 795
120 Ga0081540_1202989 3300005983 Bacteria 719
121 Ga0081539_10000067 3300005985 Bacteria 246361
122 Ga0081539_10032714 3300005985 Bacteria 3181
123 Ga0081539_10206108 3300005985 Bacteria 904
124 Ga0097621_100028479 3300006237 Bacteria 4402
125 Ga0097621_100028704 3300006237 Bacteria 4387
126 Ga0097621_100207802 3300006237 Bacteria 1702
127 Ga0068871_100260478 3300006358 Bacteria 1512
128 Ga0068871_100732717 3300006358 Bacteria 908
129 Ga0075428_100806082 3300006844 Bacteria 998
130 Ga0075430_100166600 3300006846 Bacteria 1833
131 Ga0075431_100270159 3300006847 Bacteria 1723
132 Ga0075431_101682193 3300006847 Bacteria 592
133 Ga0075433_10149330 3300006852 Bacteria 2079
134 Ga0075433_10236923 3300006852 Bacteria 1620
135 Ga0075433_10589052 3300006852 Unclassified 977
136 Ga0075433_10675089 3300006852 Bacteria 905
137 Ga0075434_100073629 3300006871 Bacteria 3408
138 Ga0075434_100176340 3300006871 Bacteria 2157
139 Ga0075434_100181083 3300006871 Bacteria 2127
140 Ga0075429_100163495 3300006880 Bacteria 1949
141 Ga0075429_100180418 3300006880 Bacteria 1850
142 Ga0075436_101178941 3300006914 Unclassified 578
143 Ga0097620_100028737 3300006931 Bacteria 5574
144 Ga0097620_100075575 3300006931 Bacteria 3409
145 Ga0097620_100131111 3300006931 Bacteria 2578
146 Ga0097620_100239203 3300006931 Bacteria 1904
147 Ga0097620_100268947 3300006931 Bacteria 1796
148 Ga0097620_100309063 3300006931 Bacteria 1674
149 Ga0097620_100703108 3300006931 Bacteria 1101
150 Ga0097620_100781972 3300006931 Bacteria 1043
151 Ga0097620_101021155 3300006931 Bacteria 908
152 Ga0097620_101231193 3300006931 Bacteria 824
153 Ga0097620_102166230 3300006931 Bacteria 614
154 Ga0105251_10198708 3300009011 Bacteria 904
155 Ga0105240_10646435 3300009093 Bacteria 1160
156 Ga0105240_11384452 3300009093 Bacteria 740
157 Ga0105240_12172098 3300009093 Bacteria 576
158 Ga0105240_12244455 3300009093 Bacteria 566
159 Ga0111539_10008323 3300009094 Bacteria 13201
160 Ga0111539_11291745 3300009094 Bacteria 847
161 Ga0105245_11338369 3300009098 Bacteria 765
162 Ga0105245_11368881 3300009098 Bacteria 757
163 Ga0105245_11813761 3300009098 Bacteria 663
164 Ga0105247_10004949 3300009101 Bacteria 8467
165 Ga0105247_10066099 3300009101 Bacteria 2251
166 Ga0105247_10174686 3300009101 Bacteria 1430
167 Ga0105247_10776857 3300009101 Bacteria 728
168 Ga0114129_10841491 3300009147 Unclassified 1167
169 Ga0105243_10643443 3300009148 Bacteria 1027
170 Ga0105243_10647315 3300009148 Bacteria 1024
171 Ga0105243_10673837 3300009148 Bacteria 1005
172 Ga0105243_11495133 3300009148 Bacteria 699
173 Ga0105243_12722062 3300009148 Bacteria 535
174 Ga0105241_10107094 3300009174 Bacteria 2232
175 Ga0105241_10390029 3300009174 Bacteria 1219
176 Ga0105241_10536732 3300009174 Bacteria 1048
177 Ga0105241_11011702 3300009174 Bacteria 778
178 Ga0105241_11730441 3300009174 Bacteria 608
179 Ga0105242_10408444 3300009176 Bacteria 1269
180 Ga0105242_10665280 3300009176 Bacteria 1014
181 Ga0105242_12693253 3300009176 Bacteria 547
182 Ga0105248_10042858 3300009177 Bacteria 5075
183 Ga0105248_10226510 3300009177 Bacteria 2104
184 Ga0105248_10241126 3300009177 Bacteria 2035
185 Ga0105248_10258410 3300009177 Bacteria 1961
186 Ga0105248_10535099 3300009177 Bacteria 1321
187 Ga0105248_10815765 3300009177 Bacteria 1053
188 Ga0105248_10966115 3300009177 Bacteria 962
189 Ga0105248_12303500 3300009177 Bacteria 613
190 Ga0105237_10817594 3300009545 Bacteria 939
191 Ga0105238_10027673 3300009551 Bacteria 5778
192 Ga0105238_10130168 3300009551 Bacteria 2495
193 Ga0105238_10952002 3300009551 Bacteria 878
194 Ga0105238_12431853 3300009551 Bacteria 559
195 Ga0105249_10015933 3300009553 Bacteria 6662
196 Ga0105249_10033371 3300009553 Bacteria 4660
197 Ga0105239_10041192 3300010375 Bacteria 5062
198 Ga0105239_11565025 3300010375 Bacteria 762
199 Ga0105239_12838043 3300010375 Bacteria 565
200 Ga0105246_10078604 3300011119 Bacteria 2343
201 Ga0105246_10488844 3300011119 Bacteria 1043
202 Ga0157373_10172971 3300013100 Bacteria 1520
203 Ga0157373_10344848 3300013100 Bacteria 1062
204 Ga0157371_10493690 3300013102 Bacteria 903
205 Ga0157371_11363297 3300013102 Bacteria 550
206 Ga0157374_10945794 3300013296 Bacteria 880
207 Ga0157378_11000225 3300013297 Bacteria 870
208 Ga0163162_11343707 3300013306 Bacteria 812
209 Ga0157375_10091705 3300013308 Bacteria 3100
210 Ga0157375_10165344 3300013308 Bacteria 2357
211 Ga0157375_11050253 3300013308 Bacteria 952
212 Ga0157375_11866179 3300013308 Bacteria 713
213 Ga0163163_10181156 3300014325 Bacteria 2154
214 Ga0163163_10216677 3300014325 Bacteria 1963
215 Ga0163163_10234843 3300014325 Bacteria 1883
216 Ga0163163_10268310 3300014325 Bacteria 1758
217 Ga0163163_10809543 3300014325 Bacteria 1000
218 Ga0163163_11124115 3300014325 Bacteria 848
219 Ga0157380_12255289 3300014326 Bacteria 609
220 Ga0157377_10042377 3300014745 Bacteria 2528
221 Ga0157377_10151781 3300014745 Bacteria 1433
222 Ga0157377_10289240 3300014745 Bacteria 1077
223 Ga0157377_10726257 3300014745 Bacteria 724
224 Ga0157379_11218982 3300014968 Bacteria 724
225 Ga0182007_10378010 3300015262 Unclassified 537
226 Ga0163161_10883657 3300017792 Bacteria 756
227 Ga0207642_10176038 3300025899 Bacteria 1161
228 Ga0207710_10000712 3300025900 Bacteria 18499
229 Ga0207710_10099394 3300025900 Bacteria 1370
230 Ga0207710_10150783 3300025900 Bacteria 1128
231 Ga0207688_10149984 3300025901 Bacteria 1377
232 Ga0207647_10005411 3300025904 Bacteria 9371
233 Ga0207647_10389024 3300025904 Bacteria 787
234 Ga0207645_11037263 3300025907 Bacteria 554
235 Ga0207643_10103915 3300025908 Bacteria 1668
236 Ga0207643_10131543 3300025908 Bacteria 1489
237 Ga0207643_10346626 3300025908 Bacteria 932
238 Ga0207684_10000023 3300025910 Bacteria 334838
239 Ga0207684_10342406 3300025910 Bacteria 1288
240 Ga0207654_10021693 3300025911 Bacteria 3418
241 Ga0207654_10323135 3300025911 Bacteria 1055
242 Ga0207654_10438570 3300025911 Bacteria 914
243 Ga0207654_10899660 3300025911 Bacteria 642
244 Ga0207654_11197428 3300025911 Bacteria 554
245 Ga0207695_10507310 3300025913 Bacteria 1088
246 Ga0207671_10389838 3300025914 Bacteria 1107
247 Ga0207660_10870854 3300025917 Bacteria 735
248 Ga0207662_10057210 3300025918 Bacteria 2330
249 Ga0207662_10825237 3300025918 Bacteria 654
250 Ga0207649_10546861 3300025920 Bacteria 885
251 Ga0207649_11204198 3300025920 Bacteria 598
252 Ga0207681_10015512 3300025923 Bacteria 4752
253 Ga0207694_10008080 3300025924 Bacteria 7951
254 Ga0207650_10000001 3300025925 Bacteria 1545726
255 Ga0207650_10196094 3300025925 Bacteria 1615
256 Ga0207650_10636773 3300025925 Bacteria 898
257 Ga0207650_11287459 3300025925 Bacteria 622
258 Ga0207659_10446180 3300025926 Bacteria 1089
259 Ga0207687_10303330 3300025927 Bacteria 1287
260 Ga0207687_11199113 3300025927 Bacteria 652
261 Ga0207687_11639826 3300025927 Bacteria 552
262 Ga0207644_10518220 3300025931 Bacteria 985
263 Ga0207690_10069650 3300025932 Bacteria 2421
264 Ga0207690_11111360 3300025932 Bacteria 659
265 Ga0207706_10232264 3300025933 Bacteria 1614
266 Ga0207686_11765052 3300025934 Bacteria 512
267 Ga0207709_10276275 3300025935 Bacteria 1239
268 Ga0207709_10679425 3300025935 Bacteria 822
269 Ga0207670_10405503 3300025936 Bacteria 1091
270 Ga0207670_10554657 3300025936 Bacteria 939
271 Ga0207670_10886159 3300025936 Bacteria 747
272 Ga0207704_10549652 3300025938 Bacteria 938
273 Ga0207691_10135711 3300025940 Bacteria 2170
274 Ga0207711_10001579 3300025941 Bacteria 21034
275 Ga0207711_10181095 3300025941 Bacteria 1916
276 Ga0207711_10311409 3300025941 Bacteria 1454
277 Ga0207711_11342361 3300025941 Bacteria 657
278 Ga0207689_10287956 3300025942 Bacteria 1360
279 Ga0207689_10865769 3300025942 Bacteria 763
280 Ga0207689_10869656 3300025942 Bacteria 761
281 Ga0207689_10869964 3300025942 Bacteria 761
282 Ga0207679_10346130 3300025945 Bacteria 1294
283 Ga0207679_10426553 3300025945 Bacteria 1171
284 Ga0207679_10493796 3300025945 Bacteria 1091
285 Ga0207679_11284728 3300025945 Bacteria 672
286 Ga0207667_10670500 3300025949 Bacteria 1041
287 Ga0207651_10120016 3300025960 Bacteria 1992
288 Ga0207651_10336049 3300025960 Bacteria 1268
289 Ga0207651_11854518 3300025960 Bacteria 542
290 Ga0207712_10007686 3300025961 Bacteria 6817
291 Ga0207712_10054845 3300025961 Bacteria 2801
292 Ga0207712_10760333 3300025961 Bacteria 849
293 Ga0207640_10760647 3300025981 Bacteria 836
294 Ga0207640_10914229 3300025981 Bacteria 767
295 Ga0207640_11360912 3300025981 Bacteria 635
296 Ga0207640_11388958 3300025981 Bacteria 629
297 Ga0207677_10515265 3300026023 Bacteria 1036
298 Ga0207703_10169838 3300026035 Bacteria 1917
299 Ga0207703_10659578 3300026035 Bacteria 993
300 Ga0207703_10722090 3300026035 Bacteria 948
301 Ga0207703_11114627 3300026035 Bacteria 758
302 Ga0207703_11236865 3300026035 Bacteria 718
303 Ga0207703_11358289 3300026035 Bacteria 683
304 Ga0207639_10029728 3300026041 Bacteria 4003
305 Ga0207708_10000140 3300026075 Bacteria 57251
306 Ga0207708_10020101 3300026075 Bacteria 5036
307 Ga0207708_10021004 3300026075 Bacteria 4927
308 Ga0207708_10551861 3300026075 Bacteria 972
309 Ga0207708_11192370 3300026075 Unclassified 665
310 Ga0207641_10225144 3300026088 Bacteria 1741
311 Ga0207641_10843518 3300026088 Bacteria 908
312 Ga0207641_11653008 3300026088 Bacteria 642
313 Ga0207648_10035854 3300026089 Bacteria 4371
314 Ga0207648_10374696 3300026089 Bacteria 1286
315 Ga0207676_10144953 3300026095 Bacteria 2038
316 Ga0207676_10342111 3300026095 Bacteria 1380
317 Ga0207676_10546377 3300026095 Unclassified 1106
318 Ga0207676_10660514 3300026095 Bacteria 1010
319 Ga0207676_10678074 3300026095 Bacteria 997
320 Ga0207676_11140019 3300026095 Bacteria 772
321 Ga0207676_11500250 3300026095 Bacteria 671
322 Ga0207674_10106021 3300026116 Bacteria 2788
323 Ga0207674_10140300 3300026116 Bacteria 2376
324 Ga0207674_10510531 3300026116 Bacteria 1161
325 Ga0207674_10606091 3300026116 Bacteria 1058
326 Ga0207674_10887788 3300026116 Bacteria 859
327 Ga0207674_11023417 3300026116 Bacteria 795
328 Ga0207675_100194290 3300026118 Bacteria 1947
329 Ga0207675_100245738 3300026118 Bacteria 1730
330 Ga0207675_100404382 3300026118 Bacteria 1346
331 Ga0207675_100407733 3300026118 Bacteria 1340
332 Ga0207698_10393571 3300026142 Bacteria 1322
333 Ga0207698_11602537 3300026142 Bacteria 666
334 Ga0207428_10088139 3300027907 Bacteria 2414
335 Ga0268266_10562158 3300028379 Bacteria 1094
336 Ga0268265_10144083 3300028380 Bacteria 1999
337 Ga0268265_10461381 3300028380 Bacteria 1189
338 Ga0268265_10678973 3300028380 Bacteria 993
339 Ga0268265_11063163 3300028380 Bacteria 802
340 Ga0268264_10146007 3300028381 Bacteria 2115
341 Ga0268264_10309719 3300028381 Bacteria 1489
342 Ga0316178_1090125 3300030735 Bacteria 1208
343 Ga0307408_100016150 3300031548 Bacteria 4978
344 Ga0307405_10018139 3300031731 Bacteria 3877
345 Ga0307405_10102469 3300031731 Bacteria 1923
346 Ga0307410_10032582 3300031852 Bacteria 3356
347 Ga0307410_10337725 3300031852 Bacteria 1200
348 Ga0307406_10267038 3300031901 Bacteria 1298
349 Ga0307412_10021217 3300031911 Bacteria 3964
350 Ga0307412_10362359 3300031911 Bacteria 1168
351 Ga0307416_100028578 3300032002 Bacteria 4149
352 Ga0307416_102615455 3300032002 Bacteria 602
353 Ga0307414_10027244 3300032004 Bacteria 3690
354 Ga0307414_10097267 3300032004 Bacteria 2205
355 Ga0307411_10595799 3300032005 Unclassified 950
356 Ga0307415_100079148 3300032126 Bacteria 2340
357 Ga0307415_100348400 3300032126 Bacteria 1246
358 Ga0373948_0021524 3300034817 Bacteria 1236
359 Ga0373949_0117287 3300035090 Bacteria 744
360 Ga0373951_0000768 3300035091 Bacteria 8795
361 Ga0373941_0023593 3300035115 Bacteria 1758
362 Ga0373941_0037154 3300035115 Bacteria 1485
363 Ga0373942_0005066 3300035207 Bacteria 3057
364 Ga0373942_0167321 3300035207 Bacteria 714
365 Ga0395900_0301925 3300037418 Bacteria 1587
366 Ga0395900_1504971 3300037418 Bacteria 585
367 Ga0395898_0099943 3300037466 Bacteria 2786
368 Ga0395898_0841402 3300037466 Bacteria 857
369 Ga0395905_1465283 3300037471 Bacteria 587
370 Ga0395905_1838203 3300037471 Unclassified 512
371 Ga0395901_0314524 3300038443 Bacteria 1621
372 Ga0395901_1033193 3300038443 Unclassified 796
373 Ga0395901_1154672 3300038443 Bacteria 742
374 Ga0242422_00745 3300038699 Bacteria 2164
375 Ga0242420_004809 3300038996 Bacteria 2060
376 Ga0439453_0031431 3300041408 Bacteria 1008
377 Ga0439448_0058823 3300042005 Bacteria 1268
378 Ga0450902_067383 3300042137 Bacteria 622
379 Ga0451576_2360260 3300045051 Bacteria 544
380 Ga0496102_0908910 3300048905 Bacteria 802
381 Ga0496102_1250341 3300048905 Bacteria 662
382 Ga0496104_0297465 3300048907 Bacteria 1526
383 Ga0496106_0500145 3300048909 Bacteria 976
384 Ga0496107_0789373 3300048910 Bacteria 696
385 Ga0496108_0272276 3300048911 Bacteria 1474
386 Ga0496108_0608483 3300048911 Bacteria 952
387 Ga0496109_0294247 3300048912 Bacteria 1531
388 Ga0496110_0365003 3300048913 Bacteria 1316
389 Ga0496110_0691198 3300048913 Bacteria 921
390 Ga0496110_0899974 3300048913 Bacteria 791
391 Ga0496110_1826534 3300048913 Bacteria 518
392 Ga0496112_0336429 3300048915 Bacteria 1453
393 Ga0496112_0408893 3300048915 Bacteria 1296
394 Ga0496112_1124709 3300048915 Bacteria 703
395 Ga0501291_062521 3300049514 Bacteria 704
396 Ga0501298_061792 3300049521 Bacteria 795
397 Ga0501202_115835 3300049652 Bacteria 668
398 Ga0501207_002315 3300049654 Bacteria 2451
399 Ga0501209_047597 3300049656 Bacteria 1159
400 Ga0501216_082222 3300049660 Bacteria 683
401 Ga0501223_008437 3300049663 Bacteria 2101
402 Ga0501223_014313 3300049663 Bacteria 1574
403 Ga0501224_084371 3300049664 Unclassified 509
404 Ga0501227_002694 3300049665 Bacteria 3898
405 Ga0501230_010261 3300049667 Bacteria 1458
406 Ga0501233_011246 3300049668 Bacteria 1776
407 Ga0501235_023884 3300049669 Bacteria 1364
408 Ga0501236_023603 3300049670 Bacteria 927
409 Ga0501239_029465 3300049672 Bacteria 714
410 Ga0501257_254783 3300049686 Bacteria 521
411 Ga0501260_007987 3300049689 Bacteria 1038
412 Ga0501225_0001466 3300049705 Bacteria 7390
413 Ga0501234_013397 3300049707 Bacteria 1286
414 Ga0501275_005747 3300049772 Bacteria 1200
415 Ga0501220_05577 3300049852 Bacteria 609
416 Ga0501226_001522 3300049853 Bacteria 2956
417 nmdc:mga05p37_1598645_c1 3300050507 Bacteria 642
418 nmdc:mga05p37_324663_c1 3300050507 Bacteria 1820
419 nmdc:mga09592_107549_c1 3300050508 Bacteria 2392
420 nmdc:mga09592_524477_c1 3300050508 Bacteria 1019
421 nmdc:mga0qj67_249655_c1 3300050509 Bacteria 1440
422 nmdc:mga06r32_241756_c1 3300050510 Bacteria 1793
423 nmdc:mga06r32_707600_c1 3300050510 Bacteria 973
424 nmdc:mga08y16_374711_c1 3300050511 Bacteria 1460
425 nmdc:mga08y16_406778_c1 3300050511 Bacteria 1392
426 nmdc:mga0n895_194844_c1 3300050512 Bacteria 2057
427 nmdc:mga0n895_513183_c1 3300050512 Bacteria 1207
428 nmdc:mga0n895_575318_c1 3300050512 Bacteria 1131
429 nmdc:mga0a205_112201_c1 3300050515 Bacteria 2625
430 nmdc:mga0a205_252881_c1 3300050515 Bacteria 1641
431 nmdc:mga0a205_253020_c1 3300050515 Bacteria 1641
432 nmdc:mga0a205_440340_c1 3300050515 Unclassified 1164
433 nmdc:mga0a205_632484_c1 3300050515 Bacteria 922
434 Ga0530510_0120195 3300061734 Bacteria 1928

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100511876 Ga0070671_1005118762 107
2 3300005440 Ga0070705_100494477 Ga0070705_1004944771 107
3 3300009101 Ga0105247_10174686 Ga0105247_101746862 107
4 3300009174 Ga0105241_11730441 Ga0105241_117304411 107
5 3300009177 Ga0105248_10535099 Ga0105248_105350992 107
6 3300013100 Ga0157373_10172971 Ga0157373_101729712 107
7 3300013308 Ga0157375_10091705 Ga0157375_100917052 107
8 3300014745 Ga0157377_10289240 Ga0157377_102892402 107
9 3300014745 Ga0157377_10726257 Ga0157377_107262571 107
10 3300013102 Ga0157371_11363297 Ga0157371_113632971 109
11 3300009177 Ga0105248_10241126 Ga0105248_102411263 110
12 3300048915 Ga0496112_0408893 Ga0496112_0408893_40_372 110
13 3300048915 Ga0496112_1124709 Ga0496112_1124709_42_374 110
14 3300005331 Ga0070670_100381382 Ga0070670_1003813822 113
15 3300050512 nmdc:mga0n895_513183_c1 nmdc:mga0n895_513183_c1_377_718 113
16 3300050515 nmdc:mga0a205_253020_c1 nmdc:mga0a205_253020_c1_740_1081 113
17 3300061734 Ga0530510_0120195 Ga0530510_0120195_466_807 113
18 3300002459 JGI24751J29686_10000057 JGI24751J29686_1000005712 124
19 3300002459 JGI24751J29686_10000130 JGI24751J29686_1000013015 124
20 3300005288 Ga0065714_10002185 Ga0065714_1000218573 124
21 3300005290 Ga0065712_10010223 Ga0065712_100102232 124
22 3300005290 Ga0065712_10118042 Ga0065712_101180422 124
23 3300005290 Ga0065712_10210041 Ga0065712_102100412 124
24 3300005293 Ga0065715_10015971 Ga0065715_100159712 124
25 3300005293 Ga0065715_10016448 Ga0065715_100164482 124
26 3300005293 Ga0065715_10119045 Ga0065715_101190452 124
27 3300005293 Ga0065715_10139570 Ga0065715_101395702 124
28 3300005293 Ga0065715_10155495 Ga0065715_101554952 124
29 3300005331 Ga0070670_100000055 Ga0070670_1000000552 124
30 3300005331 Ga0070670_100661371 Ga0070670_1006613712 124
31 3300005340 Ga0070689_100978970 Ga0070689_1009789702 124
32 3300005353 Ga0070669_100063722 Ga0070669_1000637222 124
33 3300005353 Ga0070669_101086464 Ga0070669_1010864642 124
34 3300005364 Ga0070673_100348599 Ga0070673_1003485992 124
35 3300005366 Ga0070659_101408303 Ga0070659_1014083032 124
36 3300005441 Ga0070700_100200759 Ga0070700_1002007592 124
37 3300005441 Ga0070700_100976698 Ga0070700_1009766982 124
38 3300005455 Ga0070663_100611663 Ga0070663_1006116632 124
39 3300005459 Ga0068867_101007373 Ga0068867_1010073731 124
40 3300005518 Ga0070699_100315115 Ga0070699_1003151152 124
41 3300005539 Ga0068853_100200773 Ga0068853_1002007732 124
42 3300005545 Ga0070695_100776551 Ga0070695_1007765512 124
43 3300005545 Ga0070695_101675247 Ga0070695_1016752471 124
44 3300005547 Ga0070693_100109369 Ga0070693_1001093691 124
45 3300005549 Ga0070704_100457076 Ga0070704_1004570762 124
46 3300005549 Ga0070704_101067418 Ga0070704_1010674181 124
47 3300005549 Ga0070704_101273250 Ga0070704_1012732501 124
48 3300005564 Ga0070664_101230561 Ga0070664_1012305611 124
49 3300005577 Ga0068857_101223772 Ga0068857_1012237722 124
50 3300005578 Ga0068854_100481949 Ga0068854_1004819492 124
51 3300005578 Ga0068854_101839675 Ga0068854_1018396752 124
52 3300005578 Ga0068854_101910733 Ga0068854_1019107331 124
53 3300005615 Ga0070702_100229305 Ga0070702_1002293052 124
54 3300005615 Ga0070702_100776162 Ga0070702_1007761622 124
55 3300005615 Ga0070702_100879811 Ga0070702_1008798112 124
56 3300005616 Ga0068852_100126075 Ga0068852_1001260752 124
57 3300005617 Ga0068859_100075577 Ga0068859_1000755773 124
58 3300005617 Ga0068859_100131115 Ga0068859_1001311152 124
59 3300005617 Ga0068859_100268942 Ga0068859_1002689422 124
60 3300005617 Ga0068859_100309074 Ga0068859_1003090742 124
61 3300005617 Ga0068859_101231151 Ga0068859_1012311512 124
62 3300005618 Ga0068864_100246593 Ga0068864_1002465932 124
63 3300005618 Ga0068864_102083612 Ga0068864_1020836121 124
64 3300005718 Ga0068866_10251958 Ga0068866_102519582 124
65 3300005719 Ga0068861_100419803 Ga0068861_1004198032 124
66 3300005840 Ga0068870_10229931 Ga0068870_102299312 124
67 3300005841 Ga0068863_101148611 Ga0068863_1011486111 124
68 3300005842 Ga0068858_100420969 Ga0068858_1004209692 124
69 3300005843 Ga0068860_100104569 Ga0068860_1001045691 124
70 3300005843 Ga0068860_100939919 Ga0068860_1009399192 124
71 3300005844 Ga0068862_100287670 Ga0068862_1002876702 124
72 3300005844 Ga0068862_101490325 Ga0068862_1014903251 124
73 3300005985 Ga0081539_10000067 Ga0081539_100000673 124
74 3300005985 Ga0081539_10206108 Ga0081539_102061082 124
75 3300006237 Ga0097621_100207802 Ga0097621_1002078022 124
76 3300006358 Ga0068871_100732717 Ga0068871_1007327172 124
77 3300006844 Ga0075428_100806082 Ga0075428_1008060822 124
78 3300006846 Ga0075430_100166600 Ga0075430_1001666002 124
79 3300006847 Ga0075431_100270159 Ga0075431_1002701591 124
80 3300006847 Ga0075431_101682193 Ga0075431_1016821931 124
81 3300006880 Ga0075429_100163495 Ga0075429_1001634953 124
82 3300006880 Ga0075429_100180418 Ga0075429_1001804182 124
83 3300006931 Ga0097620_100075575 Ga0097620_1000755752 124
84 3300006931 Ga0097620_100131111 Ga0097620_1001311112 124
85 3300006931 Ga0097620_100268947 Ga0097620_1002689472 124
86 3300006931 Ga0097620_100309063 Ga0097620_1003090632 124
87 3300006931 Ga0097620_101021155 Ga0097620_1010211552 124
88 3300006931 Ga0097620_101231193 Ga0097620_1012311932 124
89 3300009093 Ga0105240_12172098 Ga0105240_121720982 124
90 3300009098 Ga0105245_11813761 Ga0105245_118137612 124
91 3300009101 Ga0105247_10004949 Ga0105247_100049497 124
92 3300009148 Ga0105243_10647315 Ga0105243_106473152 124
93 3300009148 Ga0105243_12722062 Ga0105243_127220622 124
94 3300009174 Ga0105241_10107094 Ga0105241_101070942 124
95 3300009176 Ga0105242_10408444 Ga0105242_104084441 124
96 3300009176 Ga0105242_12693253 Ga0105242_126932531 124
97 3300009177 Ga0105248_10966115 Ga0105248_109661151 124
98 3300009177 Ga0105248_12303500 Ga0105248_123035002 124
99 3300009551 Ga0105238_10027673 Ga0105238_100276733 124
100 3300009551 Ga0105238_12431853 Ga0105238_124318531 124
101 3300009553 Ga0105249_10015933 Ga0105249_100159332 124
102 3300010375 Ga0105239_11565025 Ga0105239_115650251 124
103 3300013100 Ga0157373_10344848 Ga0157373_103448482 124
104 3300013297 Ga0157378_11000225 Ga0157378_110002251 124
105 3300013308 Ga0157375_10165344 Ga0157375_101653442 124
106 3300014325 Ga0163163_10181156 Ga0163163_101811562 124
107 3300014325 Ga0163163_10216677 Ga0163163_102166772 124
108 3300014325 Ga0163163_10234843 Ga0163163_102348431 124
109 3300014325 Ga0163163_10809543 Ga0163163_108095432 124
110 3300014325 Ga0163163_11124115 Ga0163163_111241152 124
111 3300014745 Ga0157377_10151781 Ga0157377_101517812 124
112 3300017792 Ga0163161_10883657 Ga0163161_108836571 124
113 3300025899 Ga0207642_10176038 Ga0207642_101760382 124
114 3300025900 Ga0207710_10000712 Ga0207710_100007125 124
115 3300025901 Ga0207688_10149984 Ga0207688_101499842 124
116 3300025904 Ga0207647_10389024 Ga0207647_103890242 124
117 3300025908 Ga0207643_10103915 Ga0207643_101039152 124
118 3300025908 Ga0207643_10131543 Ga0207643_101315432 124
119 3300025911 Ga0207654_10021693 Ga0207654_100216933 124
120 3300025911 Ga0207654_10899660 Ga0207654_108996602 124
121 3300025913 Ga0207695_10507310 Ga0207695_105073102 124
122 3300025920 Ga0207649_10546861 Ga0207649_105468612 124
123 3300025923 Ga0207681_10015512 Ga0207681_100155122 124
124 3300025924 Ga0207694_10008080 Ga0207694_100080803 124
125 3300025925 Ga0207650_10000001 Ga0207650_10000001618 124
126 3300025925 Ga0207650_10196094 Ga0207650_101960942 124
127 3300025925 Ga0207650_11287459 Ga0207650_112874591 124
128 3300025927 Ga0207687_11639826 Ga0207687_116398261 124
129 3300025931 Ga0207644_10518220 Ga0207644_105182202 124
130 3300025932 Ga0207690_11111360 Ga0207690_111113602 124
131 3300025933 Ga0207706_10232264 Ga0207706_102322642 124
132 3300025934 Ga0207686_11765052 Ga0207686_117650521 124
133 3300025935 Ga0207709_10276275 Ga0207709_102762752 124
134 3300025935 Ga0207709_10679425 Ga0207709_106794251 124
135 3300025936 Ga0207670_10405503 Ga0207670_104055032 124
136 3300025940 Ga0207691_10135711 Ga0207691_101357112 124
137 3300025941 Ga0207711_10181095 Ga0207711_101810952 124
138 3300025942 Ga0207689_10865769 Ga0207689_108657692 124
139 3300025942 Ga0207689_10869656 Ga0207689_108696562 124
140 3300025945 Ga0207679_11284728 Ga0207679_112847282 124
141 3300025960 Ga0207651_10120016 Ga0207651_101200162 124
142 3300025960 Ga0207651_10336049 Ga0207651_103360492 124
143 3300025961 Ga0207712_10007686 Ga0207712_100076864 124
144 3300025961 Ga0207712_10760333 Ga0207712_107603332 124
145 3300025981 Ga0207640_10914229 Ga0207640_109142292 124
146 3300025981 Ga0207640_11360912 Ga0207640_113609121 124
147 3300025981 Ga0207640_11388958 Ga0207640_113889581 124
148 3300026035 Ga0207703_10722090 Ga0207703_107220902 124
149 3300026075 Ga0207708_10021004 Ga0207708_100210043 124
150 3300026075 Ga0207708_10551861 Ga0207708_105518612 124
151 3300026088 Ga0207641_10843518 Ga0207641_108435182 124
152 3300026088 Ga0207641_11653008 Ga0207641_116530081 124
153 3300026089 Ga0207648_10035854 Ga0207648_100358542 124
154 3300026089 Ga0207648_10374696 Ga0207648_103746962 124
155 3300026095 Ga0207676_10660514 Ga0207676_106605142 124
156 3300026095 Ga0207676_11500250 Ga0207676_115002501 124
157 3300026116 Ga0207674_10510531 Ga0207674_105105312 124
158 3300026116 Ga0207674_10887788 Ga0207674_108877881 124
159 3300026116 Ga0207674_11023417 Ga0207674_110234172 124
160 3300026118 Ga0207675_100404382 Ga0207675_1004043822 124
161 3300026142 Ga0207698_10393571 Ga0207698_103935711 124
162 3300026142 Ga0207698_11602537 Ga0207698_116025372 124
163 3300028379 Ga0268266_10562158 Ga0268266_105621582 124
164 3300028380 Ga0268265_10144083 Ga0268265_101440832 124
165 3300028380 Ga0268265_10461381 Ga0268265_104613812 124
166 3300028380 Ga0268265_11063163 Ga0268265_110631632 124
167 3300028381 Ga0268264_10146007 Ga0268264_101460072 124
168 3300030735 Ga0316178_1090125 Ga0316178_10901251 124
169 3300031731 Ga0307405_10102469 Ga0307405_101024692 124
170 3300031852 Ga0307410_10337725 Ga0307410_103377252 124
171 3300031901 Ga0307406_10267038 Ga0307406_102670382 124
172 3300031911 Ga0307412_10362359 Ga0307412_103623592 124
173 3300032002 Ga0307416_102615455 Ga0307416_1026154551 124
174 3300032004 Ga0307414_10097267 Ga0307414_100972672 124
175 3300032005 Ga0307411_10595799 Ga0307411_105957991 124
176 3300032126 Ga0307415_100348400 Ga0307415_1003484002 124
177 3300034817 Ga0373948_0021524 Ga0373948_0021524_811_1185 124
178 3300035090 Ga0373949_0117287 Ga0373949_0117287_17_391 124
179 3300035115 Ga0373941_0023593 Ga0373941_0023593_62_436 124
180 3300037418 Ga0395900_1504971 Ga0395900_1504971_179_553 124
181 3300037471 Ga0395905_1838203 Ga0395905_1838203_17_391 124
182 3300038443 Ga0395901_1033193 Ga0395901_1033193_318_692 124
183 3300041408 Ga0439453_0031431 Ga0439453_0031431_281_658 124
184 3300042005 Ga0439448_0058823 Ga0439448_0058823_693_1067 124
185 3300042137 Ga0450902_067383 Ga0450902_067383_217_591 124
186 3300048905 Ga0496102_1250341 Ga0496102_1250341_54_428 124
187 3300048910 Ga0496107_0789373 Ga0496107_0789373_150_524 124
188 3300048913 Ga0496110_0899974 Ga0496110_0899974_217_591 124
189 3300049654 Ga0501207_002315 Ga0501207_002315_560_934 124
190 3300049656 Ga0501209_047597 Ga0501209_047597_422_796 124
191 3300049660 Ga0501216_082222 Ga0501216_082222_295_669 124
192 3300049663 Ga0501223_008437 Ga0501223_008437_1495_1869 124
193 3300049665 Ga0501227_002694 Ga0501227_002694_124_498 124
194 3300049667 Ga0501230_010261 Ga0501230_010261_85_459 124
195 3300049668 Ga0501233_011246 Ga0501233_011246_100_474 124
196 3300049670 Ga0501236_023603 Ga0501236_023603_539_913 124
197 3300049672 Ga0501239_029465 Ga0501239_029465_144_518 124
198 3300049686 Ga0501257_254783 Ga0501257_254783_124_498 124
199 3300049689 Ga0501260_007987 Ga0501260_007987_156_530 124
200 3300049705 Ga0501225_0001466 Ga0501225_0001466_5064_5438 124
201 3300049707 Ga0501234_013397 Ga0501234_013397_747_1121 124
202 3300049772 Ga0501275_005747 Ga0501275_005747_229_603 124
203 3300049853 Ga0501226_001522 Ga0501226_001522_2506_2880 124
204 3300050508 nmdc:mga09592_107549_c1 nmdc:mga09592_107549_c1_1328_1705 124
205 3300050508 nmdc:mga09592_524477_c1 nmdc:mga09592_524477_c1_454_828 124
206 3300050509 nmdc:mga0qj67_249655_c1 nmdc:mga0qj67_249655_c1_342_716 124
207 3300050510 nmdc:mga06r32_241756_c1 nmdc:mga06r32_241756_c1_1068_1442 124
208 3300050510 nmdc:mga06r32_707600_c1 nmdc:mga06r32_707600_c1_486_860 124
209 3300050511 nmdc:mga08y16_374711_c1 nmdc:mga08y16_374711_c1_985_1359 124
210 3300050511 nmdc:mga08y16_406778_c1 nmdc:mga08y16_406778_c1_519_893 124
211 3300050512 nmdc:mga0n895_575318_c1 nmdc:mga0n895_575318_c1_37_411 124
212 3300050515 nmdc:mga0a205_632484_c1 nmdc:mga0a205_632484_c1_16_390 124
213 2162886007 SwRhRL2b_contig_11080 SwRhRL2b_0441.00008290 126
214 3300000532 CNAas_1001197 CNAas_10011972 126
215 3300005289 Ga0065704_10076258 Ga0065704_100762584 126
216 3300005290 Ga0065712_10016005 Ga0065712_100160053 126
217 3300005290 Ga0065712_10126780 Ga0065712_101267802 126
218 3300005293 Ga0065715_10024804 Ga0065715_100248042 126
219 3300005293 Ga0065715_10077002 Ga0065715_100770021 126
220 3300005295 Ga0065707_10006535 Ga0065707_100065352 126
221 3300005331 Ga0070670_100178448 Ga0070670_1001784482 126
222 3300005334 Ga0068869_101697098 Ga0068869_1016970981 126
223 3300005340 Ga0070689_100339611 Ga0070689_1003396112 126
224 3300005340 Ga0070689_100440894 Ga0070689_1004408942 126
225 3300005343 Ga0070687_100867663 Ga0070687_1008676632 126
226 3300005345 Ga0070692_10038945 Ga0070692_100389452 126
227 3300005355 Ga0070671_101544161 Ga0070671_1015441611 126
228 3300005364 Ga0070673_100300601 Ga0070673_1003006012 126
229 3300005364 Ga0070673_101563572 Ga0070673_1015635722 126
230 3300005366 Ga0070659_100132526 Ga0070659_1001325262 126
231 3300005438 Ga0070701_10303034 Ga0070701_103030341 126
232 3300005440 Ga0070705_100290541 Ga0070705_1002905412 126
233 3300005440 Ga0070705_100506886 Ga0070705_1005068862 126
234 3300005440 Ga0070705_101009344 Ga0070705_1010093441 126
235 3300005441 Ga0070700_100076030 Ga0070700_1000760302 126
236 3300005441 Ga0070700_100955209 Ga0070700_1009552092 126
237 3300005441 Ga0070700_101406882 Ga0070700_1014068821 126
238 3300005444 Ga0070694_100055281 Ga0070694_1000552812 126
239 3300005444 Ga0070694_101447681 Ga0070694_1014476812 126
240 3300005445 Ga0070708_100175385 Ga0070708_1001753852 126
241 3300005466 Ga0070685_10143335 Ga0070685_101433352 126
242 3300005467 Ga0070706_100000126 Ga0070706_10000012675 126
243 3300005467 Ga0070706_101842968 Ga0070706_1018429681 126
244 3300005468 Ga0070707_101511607 Ga0070707_1015116071 126
245 3300005518 Ga0070699_100181947 Ga0070699_1001819472 126
246 3300005539 Ga0068853_100769936 Ga0068853_1007699362 126
247 3300005545 Ga0070695_100154934 Ga0070695_1001549342 126
248 3300005545 Ga0070695_100690891 Ga0070695_1006908912 126
249 3300005546 Ga0070696_101872234 Ga0070696_1018722341 126
250 3300005563 Ga0068855_100620767 Ga0068855_1006207672 126
251 3300005564 Ga0070664_100203729 Ga0070664_1002037292 126
252 3300005564 Ga0070664_100609601 Ga0070664_1006096012 126
253 3300005577 Ga0068857_100116633 Ga0068857_1001166333 126
254 3300005577 Ga0068857_100380631 Ga0068857_1003806312 126
255 3300005578 Ga0068854_100810483 Ga0068854_1008104831 126
256 3300005615 Ga0070702_100066403 Ga0070702_1000664032 126
257 3300005615 Ga0070702_100104006 Ga0070702_1001040062 126
258 3300005615 Ga0070702_100240898 Ga0070702_1002408982 126
259 3300005616 Ga0068852_100512848 Ga0068852_1005128481 126
260 3300005617 Ga0068859_100239227 Ga0068859_1002392272 126
261 3300005617 Ga0068859_100782011 Ga0068859_1007820112 126
262 3300005617 Ga0068859_102166314 Ga0068859_1021663142 126
263 3300005618 Ga0068864_100265317 Ga0068864_1002653172 126
264 3300005618 Ga0068864_100646140 Ga0068864_1006461402 126
265 3300005618 Ga0068864_101674816 Ga0068864_1016748162 126
266 3300005719 Ga0068861_100751759 Ga0068861_1007517591 126
267 3300005842 Ga0068858_100318656 Ga0068858_1003186562 126
268 3300005842 Ga0068858_100446161 Ga0068858_1004461612 126
269 3300005843 Ga0068860_100012137 Ga0068860_1000121372 126
270 3300005843 Ga0068860_100090019 Ga0068860_1000900192 126
271 3300005843 Ga0068860_100540420 Ga0068860_1005404202 126
272 3300005844 Ga0068862_100613844 Ga0068862_1006138442 126
273 3300005937 Ga0081455_10519532 Ga0081455_105195322 126
274 3300005983 Ga0081540_1202989 Ga0081540_12029892 126
275 3300005985 Ga0081539_10032714 Ga0081539_100327143 126
276 3300006237 Ga0097621_100028479 Ga0097621_1000284792 126
277 3300006237 Ga0097621_100028704 Ga0097621_1000287043 126
278 3300006358 Ga0068871_100260478 Ga0068871_1002604782 126
279 3300006852 Ga0075433_10149330 Ga0075433_101493302 126
280 3300006852 Ga0075433_10236923 Ga0075433_102369232 126
281 3300006852 Ga0075433_10589052 Ga0075433_105890521 126
282 3300006852 Ga0075433_10675089 Ga0075433_106750891 126
283 3300006871 Ga0075434_100073629 Ga0075434_1000736292 126
284 3300006871 Ga0075434_100176340 Ga0075434_1001763403 126
285 3300006871 Ga0075434_100181083 Ga0075434_1001810832 126
286 3300006914 Ga0075436_101178941 Ga0075436_1011789411 126
287 3300006931 Ga0097620_100028737 Ga0097620_1000287373 126
288 3300006931 Ga0097620_100239203 Ga0097620_1002392032 126
289 3300006931 Ga0097620_100703108 Ga0097620_1007031082 126
290 3300006931 Ga0097620_100781972 Ga0097620_1007819722 126
291 3300006931 Ga0097620_102166230 Ga0097620_1021662302 126
292 3300009011 Ga0105251_10198708 Ga0105251_101987082 126
293 3300009093 Ga0105240_10646435 Ga0105240_106464352 126
294 3300009093 Ga0105240_11384452 Ga0105240_113844521 126
295 3300009093 Ga0105240_12244455 Ga0105240_122444551 126
296 3300009094 Ga0111539_10008323 Ga0111539_100083232 126
297 3300009094 Ga0111539_11291745 Ga0111539_112917452 126
298 3300009098 Ga0105245_11338369 Ga0105245_113383692 126
299 3300009098 Ga0105245_11368881 Ga0105245_113688811 126
300 3300009101 Ga0105247_10066099 Ga0105247_100660992 126
301 3300009101 Ga0105247_10776857 Ga0105247_107768571 126
302 3300009147 Ga0114129_10841491 Ga0114129_108414911 126
303 3300009148 Ga0105243_10643443 Ga0105243_106434432 126
304 3300009148 Ga0105243_10673837 Ga0105243_106738372 126
305 3300009148 Ga0105243_11495133 Ga0105243_114951332 126
306 3300009174 Ga0105241_10390029 Ga0105241_103900292 126
307 3300009174 Ga0105241_10536732 Ga0105241_105367322 126
308 3300009174 Ga0105241_11011702 Ga0105241_110117022 126
309 3300009176 Ga0105242_10665280 Ga0105242_106652802 126
310 3300009177 Ga0105248_10042858 Ga0105248_100428584 126
311 3300009177 Ga0105248_10226510 Ga0105248_102265102 126
312 3300009177 Ga0105248_10258410 Ga0105248_102584102 126
313 3300009177 Ga0105248_10815765 Ga0105248_108157651 126
314 3300009545 Ga0105237_10817594 Ga0105237_108175942 126
315 3300009551 Ga0105238_10130168 Ga0105238_101301683 126
316 3300009551 Ga0105238_10952002 Ga0105238_109520022 126
317 3300009553 Ga0105249_10033371 Ga0105249_100333713 126
318 3300010375 Ga0105239_10041192 Ga0105239_100411922 126
319 3300010375 Ga0105239_12838043 Ga0105239_128380431 126
320 3300011119 Ga0105246_10078604 Ga0105246_100786042 126
321 3300011119 Ga0105246_10488844 Ga0105246_104888442 126
322 3300013102 Ga0157371_10493690 Ga0157371_104936902 126
323 3300013296 Ga0157374_10945794 Ga0157374_109457942 126
324 3300013306 Ga0163162_11343707 Ga0163162_113437072 126
325 3300013308 Ga0157375_11050253 Ga0157375_110502532 126
326 3300013308 Ga0157375_11866179 Ga0157375_118661791 126
327 3300014325 Ga0163163_10268310 Ga0163163_102683102 126
328 3300014326 Ga0157380_12255289 Ga0157380_122552892 126
329 3300014745 Ga0157377_10042377 Ga0157377_100423772 126
330 3300014968 Ga0157379_11218982 Ga0157379_112189821 126
331 3300015262 Ga0182007_10378010 Ga0182007_103780102 126
332 3300025900 Ga0207710_10099394 Ga0207710_100993942 126
333 3300025900 Ga0207710_10150783 Ga0207710_101507832 126
334 3300025904 Ga0207647_10005411 Ga0207647_100054115 126
335 3300025907 Ga0207645_11037263 Ga0207645_110372631 126
336 3300025908 Ga0207643_10346626 Ga0207643_103466262 126
337 3300025910 Ga0207684_10000023 Ga0207684_10000023249 126
338 3300025910 Ga0207684_10342406 Ga0207684_103424062 126
339 3300025911 Ga0207654_10323135 Ga0207654_103231352 126
340 3300025911 Ga0207654_10438570 Ga0207654_104385702 126
341 3300025911 Ga0207654_11197428 Ga0207654_111974281 126
342 3300025914 Ga0207671_10389838 Ga0207671_103898382 126
343 3300025917 Ga0207660_10870854 Ga0207660_108708542 126
344 3300025918 Ga0207662_10057210 Ga0207662_100572102 126
345 3300025918 Ga0207662_10825237 Ga0207662_108252371 126
346 3300025920 Ga0207649_11204198 Ga0207649_112041981 126
347 3300025925 Ga0207650_10636773 Ga0207650_106367731 126
348 3300025926 Ga0207659_10446180 Ga0207659_104461801 126
349 3300025927 Ga0207687_10303330 Ga0207687_103033301 126
350 3300025927 Ga0207687_11199113 Ga0207687_111991132 126
351 3300025932 Ga0207690_10069650 Ga0207690_100696502 126
352 3300025936 Ga0207670_10554657 Ga0207670_105546572 126
353 3300025936 Ga0207670_10886159 Ga0207670_108861591 126
354 3300025938 Ga0207704_10549652 Ga0207704_105496522 126
355 3300025941 Ga0207711_10001579 Ga0207711_1000157914 126
356 3300025941 Ga0207711_10311409 Ga0207711_103114092 126
357 3300025941 Ga0207711_11342361 Ga0207711_113423611 126
358 3300025942 Ga0207689_10287956 Ga0207689_102879562 126
359 3300025942 Ga0207689_10869964 Ga0207689_108699642 126
360 3300025945 Ga0207679_10346130 Ga0207679_103461302 126
361 3300025945 Ga0207679_10426553 Ga0207679_104265532 126
362 3300025945 Ga0207679_10493796 Ga0207679_104937962 126
363 3300025949 Ga0207667_10670500 Ga0207667_106705002 126
364 3300025960 Ga0207651_11854518 Ga0207651_118545182 126
365 3300025961 Ga0207712_10054845 Ga0207712_100548452 126
366 3300025981 Ga0207640_10760647 Ga0207640_107606472 126
367 3300026023 Ga0207677_10515265 Ga0207677_105152652 126
368 3300026035 Ga0207703_10169838 Ga0207703_101698382 126
369 3300026035 Ga0207703_10659578 Ga0207703_106595782 126
370 3300026035 Ga0207703_11114627 Ga0207703_111146271 126
371 3300026035 Ga0207703_11236865 Ga0207703_112368652 126
372 3300026035 Ga0207703_11358289 Ga0207703_113582892 126
373 3300026041 Ga0207639_10029728 Ga0207639_100297282 126
374 3300026075 Ga0207708_10000140 Ga0207708_100001402 126
375 3300026075 Ga0207708_10020101 Ga0207708_100201015 126
376 3300026075 Ga0207708_11192370 Ga0207708_111923702 126
377 3300026088 Ga0207641_10225144 Ga0207641_102251442 126
378 3300026095 Ga0207676_10144953 Ga0207676_101449532 126
379 3300026095 Ga0207676_10342111 Ga0207676_103421112 126
380 3300026095 Ga0207676_10546377 Ga0207676_105463772 126
381 3300026095 Ga0207676_10678074 Ga0207676_106780742 126
382 3300026095 Ga0207676_11140019 Ga0207676_111400192 126
383 3300026116 Ga0207674_10106021 Ga0207674_101060212 126
384 3300026116 Ga0207674_10140300 Ga0207674_101403003 126
385 3300026116 Ga0207674_10606091 Ga0207674_106060912 126
386 3300026118 Ga0207675_100194290 Ga0207675_1001942902 126
387 3300026118 Ga0207675_100245738 Ga0207675_1002457382 126
388 3300026118 Ga0207675_100407733 Ga0207675_1004077332 126
389 3300027907 Ga0207428_10088139 Ga0207428_100881392 126
390 3300028380 Ga0268265_10678973 Ga0268265_106789732 126
391 3300028381 Ga0268264_10309719 Ga0268264_103097192 126
392 3300031548 Ga0307408_100016150 Ga0307408_1000161504 126
393 3300031731 Ga0307405_10018139 Ga0307405_100181393 126
394 3300031852 Ga0307410_10032582 Ga0307410_100325822 126
395 3300031911 Ga0307412_10021217 Ga0307412_100212172 126
396 3300032002 Ga0307416_100028578 Ga0307416_1000285783 126
397 3300032004 Ga0307414_10027244 Ga0307414_100272443 126
398 3300032126 Ga0307415_100079148 Ga0307415_1000791481 126
399 3300035091 Ga0373951_0000768 Ga0373951_0000768_8234_8614 126
400 3300035115 Ga0373941_0037154 Ga0373941_0037154_424_804 126
401 3300035207 Ga0373942_0005066 Ga0373942_0005066_2316_2696 126
402 3300035207 Ga0373942_0167321 Ga0373942_0167321_159_539 126
403 3300037418 Ga0395900_0301925 Ga0395900_0301925_505_885 126
404 3300037466 Ga0395898_0099943 Ga0395898_0099943_1868_2248 126
405 3300037466 Ga0395898_0841402 Ga0395898_0841402_108_488 126
406 3300037471 Ga0395905_1465283 Ga0395905_1465283_156_536 126
407 3300038443 Ga0395901_0314524 Ga0395901_0314524_402_782 126
408 3300038443 Ga0395901_1154672 Ga0395901_1154672_86_466 126
409 3300038699 Ga0242422_00745 Ga0242422_00745_1161_1541 126
410 3300038996 Ga0242420_004809 Ga0242420_004809_375_755 126
411 3300045051 Ga0451576_2360260 Ga0451576_2360260_153_533 126
412 3300048905 Ga0496102_0908910 Ga0496102_0908910_280_660 126
413 3300048907 Ga0496104_0297465 Ga0496104_0297465_424_807 126
414 3300048909 Ga0496106_0500145 Ga0496106_0500145_379_759 126
415 3300048911 Ga0496108_0272276 Ga0496108_0272276_707_1087 126
416 3300048911 Ga0496108_0608483 Ga0496108_0608483_178_561 126
417 3300048912 Ga0496109_0294247 Ga0496109_0294247_231_611 126
418 3300048913 Ga0496110_0365003 Ga0496110_0365003_881_1261 126
419 3300048913 Ga0496110_0691198 Ga0496110_0691198_475_858 126
420 3300048913 Ga0496110_1826534 Ga0496110_1826534_98_478 126
421 3300048915 Ga0496112_0336429 Ga0496112_0336429_331_714 126
422 3300049514 Ga0501291_062521 Ga0501291_062521_181_561 126
423 3300049521 Ga0501298_061792 Ga0501298_061792_312_692 126
424 3300049652 Ga0501202_115835 Ga0501202_115835_259_639 126
425 3300049663 Ga0501223_014313 Ga0501223_014313_445_825 126
426 3300049664 Ga0501224_084371 Ga0501224_084371_38_418 126
427 3300049669 Ga0501235_023884 Ga0501235_023884_193_573 126
428 3300049852 Ga0501220_05577 Ga0501220_05577_204_584 126
429 3300050507 nmdc:mga05p37_1598645_c1 nmdc:mga05p37_1598645_c1_185_565 126
430 3300050507 nmdc:mga05p37_324663_c1 nmdc:mga05p37_324663_c1_510_893 126
431 3300050512 nmdc:mga0n895_194844_c1 nmdc:mga0n895_194844_c1_414_797 126
432 3300050515 nmdc:mga0a205_112201_c1 nmdc:mga0a205_112201_c1_60_440 126
433 3300050515 nmdc:mga0a205_252881_c1 nmdc:mga0a205_252881_c1_61_441 126
434 3300050515 nmdc:mga0a205_440340_c1 nmdc:mga0a205_440340_c1_141_524 126

Feature Viewer

pLDDT pTM Quality
54.58 0.35 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map