F442919

General Info

Members Datasets Scaffolds Average Seq Length
433 185 408 238

Family's Representative Sequence

Representative Sequence 3300046491|Ga0495584_0035550|Ga0495584_0035550_87_884
Length 265
Sequence MFHQQKKSLTEEPHMNMLEGKVALITGGGQGVXXXXAYALADEGATVAVAGRTRATLEQTCAEIRRRGGTALVVECDVMSQADIDRCVAQVVEAFGGLNILVNNAHVVPLGSILEVSDEAFMQGIDSGPMATLRLMRACYPYLKGDGAVINLASSAAVRWDASGYGHYAATKEAIRALSRGAACEWGVDGIRVNVIAPHALSPGLRGWVENNPQEAQAFFSSIPLRRVGDCETDIGRTVAFLVSDNARYLTGATIPLDGGQAYWG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231015 Pseudomonas sp. GM49 Isolate Nodule
3 2547132424 Nocardia nova SH22a Isolate Unclassified
4 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
5 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
6 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
7 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
8 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
9 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
10 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
11 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
12 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
13 2818991452 Burkholderia cepacia 561 Isolate Unclassified
14 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
15 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
16 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
17 2922554459 Rhodococcus sp. 66b Isolate Unclassified
18 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
19 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
20 2928170801 Burkholderia sp. 572 Isolate Unclassified
21 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
22 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
23 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
24 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
25 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
26 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
27 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
28 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
29 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
30 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
31 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
32 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
33 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
39 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
40 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
41 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
42 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
43 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
44 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
73 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
80 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
82 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
107 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
110 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
111 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
112 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
113 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
114 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
115 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
116 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
117 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
118 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
119 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
122 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
125 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
126 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
127 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
128 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
129 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
130 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
131 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
132 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
133 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
134 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
135 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
136 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
137 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
138 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
139 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
140 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
141 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
142 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
143 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
144 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
145 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
146 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
147 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
148 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
149 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
150 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
151 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
152 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
153 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
154 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
155 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
156 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
157 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
158 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
159 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
160 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
161 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
162 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
164 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
165 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
166 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
167 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
168 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
169 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
170 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
171 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
172 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
173 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
174 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
175 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
176 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
177 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
178 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
179 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
180 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
181 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
182 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
183 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
184 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
185 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.23
Metatranscriptomes 0
Isolates 5.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.39
Nodule 0.23
Rhizoplane 9.47
Rhizosphere 65.59
Stem 0
Stem Tuber 0
Unclassified 20.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1732412 2162886007 Bacteria 5492
2 SwRhRL2b_contig_2288151 2162886007 Bacteria 1380
3 SwRhRL2b_contig_2334788 2162886007 Bacteria 75171
4 SwRhRL2b_contig_3746231 2162886007 Bacteria 5378
5 SwRhRL2b_contig_660862 2162886007 Bacteria 2141
6 JGI24752J21851_1000128 3300001976 Bacteria 10252
7 JGI24750J21931_1001044 3300002070 Bacteria 3617
8 JGI24748J21848_1000040 3300002074 Bacteria 66807
9 JGI24749J21850_1000041 3300002076 Bacteria 24509
10 JGI24749J21850_1001199 3300002076 Bacteria 3681
11 JGI24034J26672_10000045 3300002239 Bacteria 66804
12 JGI24751J29686_10000002 3300002459 Bacteria 160619
13 rootH1_10237577 3300003323 Bacteria 6496
14 Ga0055532_1000240 3300003758 Bacteria 40160
15 Ga0055532_1001336 3300003758 Bacteria 7078
16 Ga0055527_1000963 3300003760 Bacteria 7078
17 Ga0055535_1002290 3300003761 Bacteria 7078
18 Ga0055542_1003243 3300003762 Bacteria 4547
19 Ga0055529_1001972 3300003763 Bacteria 4592
20 Ga0055530_10008059 3300003791 Bacteria 4295
21 Ga0065704_10000551 3300005289 Bacteria 62542
22 Ga0065704_10002742 3300005289 Bacteria 10794
23 Ga0065704_10005191 3300005289 Bacteria 3273
24 Ga0065704_10070166 3300005289 Bacteria 176609
25 Ga0065704_10071003 3300005289 Bacteria 13828
26 Ga0065707_10011192 3300005295 Bacteria 2007
27 Ga0065707_10082123 3300005295 Bacteria 21352
28 Ga0065707_10088016 3300005295 Bacteria 4811
29 Ga0070690_100000006 3300005330 Bacteria 132992
30 Ga0070670_100000012 3300005331 Bacteria 256314
31 Ga0070670_100142215 3300005331 Bacteria 2075
32 Ga0070666_10000004 3300005335 Bacteria 372098
33 Ga0070666_10033143 3300005335 Bacteria 3416
34 Ga0070666_10036255 3300005335 Bacteria 3272
35 Ga0070666_10246568 3300005335 Bacteria 1264
36 Ga0070668_100052849 3300005347 Bacteria 3132
37 Ga0070668_100052851 3300005347 Bacteria 3132
38 Ga0070668_100110224 3300005347 Bacteria 2190
39 Ga0070668_100156044 3300005347 Bacteria 1849
40 Ga0070669_100000064 3300005353 Bacteria 107033
41 Ga0070669_100000077 3300005353 Bacteria 95577
42 Ga0070669_100000083 3300005353 Bacteria 91096
43 Ga0070669_100000183 3300005353 Bacteria 54573
44 Ga0070669_100000199 3300005353 Bacteria 52239
45 Ga0070669_100027320 3300005353 Bacteria 4106
46 Ga0070671_100000107 3300005355 Bacteria 52884
47 Ga0070671_100000471 3300005355 Bacteria 28078
48 Ga0070671_100000682 3300005355 Bacteria 24369
49 Ga0070671_100038314 3300005355 Bacteria 3979
50 Ga0070671_100175076 3300005355 Bacteria 1815
51 Ga0070688_100008471 3300005365 Bacteria 5582
52 Ga0070667_100000347 3300005367 Bacteria 51490
53 Ga0070667_100005356 3300005367 Bacteria 10717
54 Ga0070667_100021325 3300005367 Bacteria 5381
55 Ga0070667_100060197 3300005367 Bacteria 3213
56 Ga0070667_100062511 3300005367 Bacteria 3154
57 Ga0070713_100172801 3300005436 Bacteria 1937
58 Ga0070708_100532510 3300005445 Bacteria 1108
59 Ga0070685_10000268 3300005466 Bacteria 33580
60 Ga0070685_10089813 3300005466 Bacteria 1858
61 Ga0070686_100000036 3300005544 Bacteria 108117
62 Ga0070665_100000004 3300005548 Bacteria 785500
63 Ga0070665_100000163 3300005548 Bacteria 121320
64 Ga0070665_100000592 3300005548 Bacteria 50403
65 Ga0070665_100124108 3300005548 Bacteria 2584
66 Ga0070665_100344523 3300005548 Bacteria 1495
67 Ga0070665_100902272 3300005548 Bacteria 896
68 Ga0068855_100081323 3300005563 Bacteria 3755
69 Ga0068859_100001455 3300005617 Bacteria 24046
70 Ga0068859_100001679 3300005617 Bacteria 22526
71 Ga0068859_100011814 3300005617 Bacteria 8770
72 Ga0068859_100013152 3300005617 Bacteria 8316
73 Ga0068859_100291517 3300005617 Bacteria 1725
74 Ga0068864_100000010 3300005618 Bacteria 358723
75 Ga0068864_100000076 3300005618 Bacteria 107865
76 Ga0068864_100018051 3300005618 Bacteria 5889
77 Ga0068864_100067136 3300005618 Bacteria 3114
78 Ga0068864_100151847 3300005618 Bacteria 2098
79 Ga0068861_100004185 3300005719 Bacteria 9675
80 Ga0068861_100015232 3300005719 Bacteria 5413
81 Ga0068863_100005909 3300005841 Bacteria 12000
82 Ga0068863_100006132 3300005841 Bacteria 11790
83 Ga0068863_100075479 3300005841 Bacteria 3190
84 Ga0068863_100151077 3300005841 Bacteria 2222
85 Ga0068858_100000462 3300005842 Bacteria 42398
86 Ga0068858_100007118 3300005842 Bacteria 10862
87 Ga0068858_100025887 3300005842 Bacteria 5456
88 Ga0068858_100094529 3300005842 Bacteria 2784
89 Ga0068858_100206482 3300005842 Bacteria 1858
90 Ga0068858_100224400 3300005842 Bacteria 1780
91 Ga0068860_100000009 3300005843 Bacteria 372089
92 Ga0068860_100003035 3300005843 Bacteria 17334
93 Ga0068860_100009786 3300005843 Bacteria 9517
94 Ga0068860_100016576 3300005843 Bacteria 7186
95 Ga0068860_100018466 3300005843 Bacteria 6783
96 Ga0068860_100029173 3300005843 Bacteria 5307
97 Ga0068860_100093936 3300005843 Bacteria 2859
98 Ga0068862_100000016 3300005844 Bacteria 250031
99 Ga0068862_100000023 3300005844 Bacteria 203389
100 Ga0068862_100000029 3300005844 Bacteria 182708
101 Ga0068862_100026938 3300005844 Bacteria 4835
102 Ga0068862_100166899 3300005844 Bacteria 1968
103 Ga0068862_100197007 3300005844 Bacteria 1815
104 Ga0075364_10041272 3300006051 Bacteria 2996
105 Ga0075432_10000728 3300006058 Bacteria 10167
106 Ga0075370_10095254 3300006353 Bacteria 1719
107 Ga0097620_100001455 3300006931 Bacteria 24046
108 Ga0097620_100001679 3300006931 Bacteria 22526
109 Ga0097620_100011814 3300006931 Bacteria 8770
110 Ga0097620_100013152 3300006931 Bacteria 8316
111 Ga0097620_100291522 3300006931 Bacteria 1725
112 Ga0105251_10003673 3300009011 Bacteria 11011
113 Ga0105244_10001385 3300009036 Bacteria 19690
114 Ga0105250_10011961 3300009092 Bacteria 3594
115 Ga0105247_10006544 3300009101 Bacteria 7208
116 Ga0105247_10026047 3300009101 Bacteria 3530
117 Ga0105247_10050373 3300009101 Bacteria 2562
118 Ga0105247_10120962 3300009101 Bacteria 1696
119 Ga0105248_10000053 3300009177 Bacteria 143972
120 Ga0105248_10001490 3300009177 Bacteria 26065
121 Ga0105248_10002289 3300009177 Bacteria 21208
122 Ga0105248_10005391 3300009177 Bacteria 14059
123 Ga0105248_10024273 3300009177 Bacteria 6741
124 Ga0105248_10077154 3300009177 Bacteria 3745
125 Ga0105248_10099984 3300009177 Bacteria 3268
126 Ga0105248_10137264 3300009177 Bacteria 2759
127 Ga0105248_10957755 3300009177 Bacteria 967
128 Ga0105249_10000004 3300009553 Bacteria 368014
129 Ga0105249_10000006 3300009553 Bacteria 354449
130 Ga0105249_10088220 3300009553 Bacteria 2897
131 Ga0105249_10130209 3300009553 Bacteria 2401
132 Ga0105249_10188569 3300009553 Bacteria 2011
133 Ga0105249_10466449 3300009553 Bacteria 1304
134 Ga0105249_10593298 3300009553 Bacteria 1162
135 Ga0105148_100052 3300009978 Bacteria 17846
136 Ga0163162_10001037 3300013306 Bacteria 25862
137 Ga0163162_10018467 3300013306 Bacteria 6833
138 Ga0163162_10136951 3300013306 Bacteria 2560
139 Ga0163162_10431339 3300013306 Bacteria 1450
140 Ga0163162_10447468 3300013306 Bacteria 1424
141 Ga0163163_10170782 3300014325 Bacteria 2221
142 Ga0163163_10240869 3300014325 Bacteria 1858
143 Ga0157380_10000025 3300014326 Bacteria 107388
144 Ga0157380_10000211 3300014326 Bacteria 34374
145 Ga0157380_10000845 3300014326 Bacteria 19168
146 Ga0157380_10050009 3300014326 Bacteria 3300
147 Ga0157380_10511130 3300014326 Bacteria 1169
148 Ga0157379_10113380 3300014968 Bacteria 2436
149 Ga0163161_10000029 3300017792 Bacteria 193416
150 Ga0213872_10000049 3300021361 Bacteria 109094
151 Ga0209566_100384 3300025225 Bacteria 35773
152 Ga0209674_110139 3300025226 Bacteria 1017
153 Ga0209672_100062 3300025228 Bacteria 204912
154 Ga0209147_100078 3300025229 Bacteria 204912
155 Ga0209147_100145 3300025229 Bacteria 106552
156 Ga0209258_100108 3300025242 Bacteria 204912
157 Ga0209148_1000730 3300025254 Bacteria 25735
158 Ga0209759_1005393 3300025256 Bacteria 4491
159 Ga0209455_1000460 3300025272 Bacteria 30845
160 Ga0209050_1000232 3300025298 Bacteria 121822
161 Ga0207697_10010506 3300025315 Bacteria 3954
162 Ga0207713_1000266 3300025735 Bacteria 64691
163 Ga0207713_1001192 3300025735 Bacteria 21837
164 Ga0207710_10003376 3300025900 Bacteria 7137
165 Ga0207680_10000010 3300025903 Bacteria 414170
166 Ga0207680_10036416 3300025903 Bacteria 2834
167 Ga0207680_10099871 3300025903 Bacteria 1863
168 Ga0207680_10222804 3300025903 Bacteria 1294
169 Ga0207680_10292880 3300025903 Bacteria 1133
170 Ga0207646_10688433 3300025922 Bacteria 915
171 Ga0207681_10000013 3300025923 Bacteria 357411
172 Ga0207681_10000047 3300025923 Bacteria 127446
173 Ga0207681_10000060 3300025923 Bacteria 102672
174 Ga0207681_10000081 3300025923 Bacteria 85588
175 Ga0207681_10000575 3300025923 Bacteria 25010
176 Ga0207681_10015602 3300025923 Bacteria 4741
177 Ga0207681_10063202 3300025923 Bacteria 2552
178 Ga0207681_10153099 3300025923 Bacteria 1730
179 Ga0207650_10000008 3300025925 Bacteria 498534
180 Ga0207650_10184422 3300025925 Bacteria 1665
181 Ga0207650_10248845 3300025925 Bacteria 1438
182 Ga0207650_10319767 3300025925 Bacteria 1271
183 Ga0207700_10114565 3300025928 Bacteria 2175
184 Ga0207644_10000004 3300025931 Bacteria 566613
185 Ga0207644_10000331 3300025931 Bacteria 30626
186 Ga0207644_10000821 3300025931 Bacteria 19754
187 Ga0207644_10014929 3300025931 Bacteria 5207
188 Ga0207644_10072856 3300025931 Bacteria 2517
189 Ga0207709_10422424 3300025935 Bacteria 1024
190 Ga0207670_10089135 3300025936 Bacteria 2177
191 Ga0207711_10000754 3300025941 Bacteria 31740
192 Ga0207711_10001078 3300025941 Bacteria 26059
193 Ga0207711_10001565 3300025941 Bacteria 21139
194 Ga0207711_10013529 3300025941 Bacteria 6775
195 Ga0207711_10171570 3300025941 Bacteria 1968
196 Ga0207711_10275622 3300025941 Bacteria 1548
197 Ga0207667_10049479 3300025949 Bacteria 4438
198 Ga0207712_10000008 3300025961 Bacteria 527957
199 Ga0207712_10000014 3300025961 Bacteria 375393
200 Ga0207712_10034849 3300025961 Bacteria 3414
201 Ga0207712_10248910 3300025961 Bacteria 1435
202 Ga0207668_10002064 3300025972 Bacteria 11714
203 Ga0207668_10003450 3300025972 Bacteria 9278
204 Ga0207668_10071879 3300025972 Bacteria 2473
205 Ga0207668_10073600 3300025972 Bacteria 2449
206 Ga0207668_10137325 3300025972 Bacteria 1875
207 Ga0207668_10154665 3300025972 Bacteria 1780
208 Ga0207668_10292304 3300025972 Bacteria 1341
209 Ga0207658_10000490 3300025986 Bacteria 36308
210 Ga0207658_10001340 3300025986 Bacteria 19288
211 Ga0207658_10001365 3300025986 Bacteria 19070
212 Ga0207658_10033395 3300025986 Bacteria 3670
213 Ga0207658_10098693 3300025986 Bacteria 2283
214 Ga0207703_10000613 3300026035 Bacteria 36130
215 Ga0207703_10004339 3300026035 Bacteria 11654
216 Ga0207703_10007587 3300026035 Bacteria 8600
217 Ga0207703_10198661 3300026035 Bacteria 1781
218 Ga0207703_10459036 3300026035 Bacteria 1191
219 Ga0207676_10000012 3300026095 Bacteria 353971
220 Ga0207676_10001259 3300026095 Bacteria 18844
221 Ga0207676_10005460 3300026095 Bacteria 9000
222 Ga0207676_10294496 3300026095 Bacteria 1479
223 Ga0207675_100000057 3300026118 Bacteria 81804
224 Ga0207675_100000262 3300026118 Bacteria 50134
225 Ga0268266_10000009 3300028379 Bacteria 1097737
226 Ga0268266_10000205 3300028379 Bacteria 103915
227 Ga0268266_10016836 3300028379 Bacteria 6247
228 Ga0268266_10127208 3300028379 Bacteria 2275
229 Ga0268266_10288216 3300028379 Bacteria 1528
230 Ga0268266_10637638 3300028379 Bacteria 1025
231 Ga0268265_10000006 3300028380 Bacteria 466482
232 Ga0268265_10000035 3300028380 Bacteria 207267
233 Ga0268265_10000283 3300028380 Bacteria 57566
234 Ga0268265_10012537 3300028380 Bacteria 5745
235 Ga0268265_10049178 3300028380 Bacteria 3169
236 Ga0268265_10174044 3300028380 Bacteria 1843
237 Ga0268264_10000023 3300028381 Bacteria 471408
238 Ga0268264_10001198 3300028381 Bacteria 25042
239 Ga0268264_10006322 3300028381 Bacteria 9984
240 Ga0268264_10022258 3300028381 Bacteria 5175
241 Ga0268264_10073324 3300028381 Bacteria 2905
242 Ga0268264_10417400 3300028381 Bacteria 1293
243 Ga0268264_10556607 3300028381 Bacteria 1125
244 Ga0307516_10007864 3300031730 Bacteria 12153
245 Ga0307414_10359176 3300032004 Bacteria 1253
246 Ga0436365_0396693 3300039437 Bacteria 1255
247 Ga0436361_0082864 3300039447 Bacteria 107951
248 Ga0439436_0016910 3300041404 Bacteria 2185
249 Ga0439438_001282 3300041405 Bacteria 11119
250 Ga0439447_003484 3300041407 Bacteria 5591
251 Ga0439466_0000164 3300041411 Bacteria 26501
252 Ga0439432_015302 3300042006 Bacteria 2590
253 Ga0439451_000332 3300042009 Bacteria 9157
254 Ga0439452_061694 3300042010 Bacteria 838
255 Ga0439456_013001 3300042013 Bacteria 1730
256 Ga0439434_0070171 3300042435 Bacteria 1102
257 Ga0466968_0000001 3300044735 Bacteria 100282
258 Ga0495603_0010401 3300046455 Bacteria 5634
259 Ga0495584_0035550 3300046491 Bacteria 2518
260 Ga0495607_0012796 3300046501 Bacteria 5520
261 Ga0495610_0021662 3300046512 Bacteria 3528
262 Ga0495654_0000805 3300046530 Bacteria 24067
263 Ga0495622_0083622 3300046557 Bacteria 1468
264 Ga0495668_0039764 3300046616 Bacteria 2626
265 Ga0495671_0018796 3300046692 Bacteria 3662
266 Ga0495671_0019682 3300046692 Bacteria 3563
267 Ga0495649_0000997 3300046694 Bacteria 22308
268 Ga0495672_0001254 3300047320 Bacteria 25467
269 Ga0495673_0000900 3300047469 Bacteria 27305
270 Ga0495686_0119686 3300047472 Bacteria 1571
271 Ga0495626_0000948 3300048091 Bacteria 25206
272 Ga0496101_0063049 3300048904 Bacteria 2697
273 Ga0496102_0000149 3300048905 Bacteria 95638
274 Ga0496102_0000178 3300048905 Bacteria 86174
275 Ga0496102_0033617 3300048905 Bacteria 4609
276 Ga0496102_0085722 3300048905 Bacteria 2908
277 Ga0496102_0278260 3300048905 Bacteria 1577
278 Ga0496103_0000049 3300048906 Bacteria 154466
279 Ga0496103_0000961 3300048906 Bacteria 20452
280 Ga0496103_0001521 3300048906 Bacteria 15482
281 Ga0496103_0074881 3300048906 Bacteria 2123
282 Ga0496103_0219631 3300048906 Bacteria 1222
283 Ga0496104_0000073 3300048907 Bacteria 104347
284 Ga0496104_0044245 3300048907 Bacteria 4184
285 Ga0496104_0211095 3300048907 Bacteria 1853
286 Ga0496104_0474626 3300048907 Bacteria 1162
287 Ga0496104_0597738 3300048907 Bacteria 1013
288 Ga0496105_0000040 3300048908 Bacteria 117075
289 Ga0496105_0001483 3300048908 Bacteria 16570
290 Ga0496105_0009434 3300048908 Bacteria 7632
291 Ga0496106_0001103 3300048909 Bacteria 19971
292 Ga0496106_0065802 3300048909 Bacteria 2760
293 Ga0496107_0000975 3300048910 Bacteria 16984
294 Ga0496108_0000312 3300048911 Bacteria 41253
295 Ga0496108_0100675 3300048911 Bacteria 2465
296 Ga0496108_0339530 3300048911 Bacteria 1310
297 Ga0496110_0008945 3300048913 Bacteria 8075
298 Ga0496110_0121141 3300048913 Bacteria 2357
299 Ga0496110_0229056 3300048913 Bacteria 1690
300 Ga0496110_0443883 3300048913 Bacteria 1182
301 Ga0496111_0016462 3300048914 Bacteria 5094
302 Ga0496111_0050476 3300048914 Bacteria 3001
303 Ga0496111_0159812 3300048914 Bacteria 1673
304 Ga0496112_0062888 3300048915 Bacteria 3662
305 Ga0496112_0076616 3300048915 Bacteria 3307
306 Ga0496113_0000648 3300048916 Bacteria 17543
307 Ga0496113_0006684 3300048916 Bacteria 7339
308 Ga0496113_0017707 3300048916 Bacteria 4953
309 Ga0496114_0047504 3300048917 Bacteria 3571
310 Ga0496114_0055208 3300048917 Bacteria 3313
311 Ga0496115_0001008 3300048918 Bacteria 20430
312 Ga0496116_0000078 3300048919 Bacteria 227712
313 Ga0496116_0020897 3300048919 Bacteria 4954
314 Ga0496116_0038635 3300048919 Bacteria 3311
315 Ga0496116_0043426 3300048919 Bacteria 3062
316 Ga0496116_0146678 3300048919 Bacteria 1318
317 Ga0496117_0000123 3300048920 Bacteria 169805
318 Ga0496117_0002983 3300048920 Bacteria 20392
319 Ga0496117_0019249 3300048920 Bacteria 5614
320 Ga0496117_0072239 3300048920 Bacteria 2308
321 Ga0496117_0135353 3300048920 Bacteria 1485
322 Ga0496117_0237099 3300048920 Bacteria 1004
323 Ga0496118_0000186 3300048921 Bacteria 108940
324 Ga0496118_0011342 3300048921 Bacteria 8710
325 Ga0496118_0017830 3300048921 Bacteria 6440
326 Ga0496118_0042992 3300048921 Bacteria 3557
327 Ga0496118_0044608 3300048921 Bacteria 3470
328 Ga0496118_0049710 3300048921 Bacteria 3226
329 Ga0496118_0087455 3300048921 Unclassified 2161
330 Ga0496118_0292921 3300048921 Bacteria 898
331 Ga0496119_0000090 3300048922 Bacteria 134340
332 Ga0496119_0018491 3300048922 Bacteria 5183
333 Ga0496119_0063889 3300048922 Bacteria 2188
334 Ga0496120_0000690 3300048923 Bacteria 49503
335 Ga0496120_0012610 3300048923 Bacteria 5739
336 Ga0496120_0043471 3300048923 Bacteria 2617
337 Ga0496121_0000038 3300048924 Bacteria 351739
338 Ga0496121_0000058 3300048924 Bacteria 281335
339 Ga0496121_0000569 3300048924 Bacteria 69581
340 Ga0496121_0003997 3300048924 Bacteria 20341
341 Ga0496121_0007115 3300048924 Bacteria 13580
342 Ga0496121_0014621 3300048924 Bacteria 8303
343 Ga0496121_0069115 3300048924 Bacteria 2853
344 Ga0496121_0099313 3300048924 Bacteria 2250
345 Ga0496122_0000094 3300048925 Bacteria 202047
346 Ga0496122_0003419 3300048925 Bacteria 20890
347 Ga0496122_0003952 3300048925 Bacteria 18941
348 Ga0496122_0024359 3300048925 Bacteria 5297
349 Ga0496122_0046309 3300048925 Bacteria 3370
350 Ga0496123_0000116 3300048926 Bacteria 161699
351 Ga0496123_0003967 3300048926 Bacteria 16032
352 Ga0496123_0005109 3300048926 Bacteria 13396
353 Ga0496123_0019669 3300048926 Bacteria 5317
354 Ga0496123_0037067 3300048926 Bacteria 3448
355 Ga0496123_0111199 3300048926 Bacteria 1566
356 Ga0496123_0171198 3300048926 Bacteria 1145
357 Ga0496124_0003146 3300048927 Bacteria 20419
358 Ga0496124_0007030 3300048927 Bacteria 12056
359 Ga0496124_0007192 3300048927 Bacteria 11897
360 Ga0496124_0013214 3300048927 Bacteria 8075
361 Ga0496124_0024316 3300048927 Bacteria 5512
362 Ga0496124_0031758 3300048927 Bacteria 4671
363 Ga0496124_0252748 3300048927 Bacteria 1302
364 Ga0496124_0575373 3300048927 Bacteria 738
365 Ga0496125_0001768 3300048928 Bacteria 29937
366 Ga0496125_0002834 3300048928 Bacteria 21843
367 Ga0496125_0003609 3300048928 Bacteria 18579
368 Ga0496125_0003614 3300048928 Bacteria 18569
369 Ga0496125_0018310 3300048928 Bacteria 6654
370 Ga0496125_0078852 3300048928 Bacteria 2529
371 Ga0496125_0149659 3300048928 Bacteria 1606
372 Ga0496126_0000045 3300048929 Bacteria 331225
373 Ga0496126_0000058 3300048929 Bacteria 272530
374 Ga0496126_0003337 3300048929 Bacteria 20402
375 Ga0496126_0004560 3300048929 Bacteria 16458
376 Ga0496126_0005928 3300048929 Bacteria 13774
377 Ga0496126_0012980 3300048929 Bacteria 8503
378 Ga0496126_0014415 3300048929 Bacteria 7992
379 Ga0496126_0025922 3300048929 Bacteria 5630
380 Ga0496126_0075745 3300048929 Bacteria 2986
381 Ga0501290_000287 3300049513 Bacteria 8286
382 Ga0501292_000006 3300049515 Bacteria 90286
383 Ga0501294_000434 3300049517 Bacteria 4923
384 Ga0501300_000144 3300049523 Bacteria 10596
385 Ga0501032_0009608 3300049569 Bacteria 7010
386 Ga0501037_0089014 3300049573 Bacteria 2234
387 Ga0501039_0132105 3300049575 Bacteria 1959
388 Ga0501043_0117375 3300049579 Bacteria 2088
389 Ga0501048_0421288 3300049582 Bacteria 955
390 Ga0501069_0079209 3300049585 Bacteria 1849
391 Ga0501222_006532 3300049662 Bacteria 1565
392 Ga0501223_000006 3300049663 Bacteria 133378
393 Ga0501223_012170 3300049663 Bacteria 1723
394 Ga0501224_014675 3300049664 Bacteria 1159
395 Ga0501235_002821 3300049669 Bacteria 3742
396 Ga0501259_000413 3300049688 Bacteria 6797
397 Ga0501261_000001 3300049690 Bacteria 126537
398 Ga0501225_0000032 3300049705 Bacteria 47166
399 Ga0501225_0008537 3300049705 Bacteria 2936
400 Ga0501225_0010676 3300049705 Bacteria 2598
401 Ga0501225_0046433 3300049705 Bacteria 1204
402 Ga0501245_003245 3300049708 Bacteria 2201
403 Ga0501279_000006 3300049775 Bacteria 152264
404 Ga0501280_000127 3300049776 Bacteria 19855
405 Ga0501281_00003 3300049777 Bacteria 40318
406 Ga0501282_000017 3300049778 Bacteria 24205
407 Ga0501283_000294 3300049779 Bacteria 6607
408 nmdc:mga03n38_81306_c1 3300050490 Bacteria 1523

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044735 Ga0466968_0000001 Ga0466968_0000001_78230_78991 214
2 3300005548 Ga0070665_100344523 Ga0070665_1003445231 223
3 3300005842 Ga0068858_100224400 Ga0068858_1002244002 223
4 3300009177 Ga0105248_10957755 Ga0105248_109577551 223
5 3300013306 Ga0163162_10018467 Ga0163162_100184674 223
6 3300026035 Ga0207703_10198661 Ga0207703_101986612 223
7 3300028379 Ga0268266_10288216 Ga0268266_102882161 223
8 3300048905 Ga0496102_0278260 Ga0496102_0278260_701_1438 224
9 3300049708 Ga0501245_003245 Ga0501245_003245_1409_2176 225
10 3300042006 Ga0439432_015302 Ga0439432_015302_1633_2406 227
11 3300042435 Ga0439434_0070171 Ga0439434_0070171_253_1026 227
12 3300048921 Ga0496118_0292921 Ga0496118_0292921_48_734 227
13 iso_pu_bacteria 2547132424 2548694328 227
14 3300048915 Ga0496112_0076616 Ga0496112_0076616_2571_3257 228
15 3300048927 Ga0496124_0575373 Ga0496124_0575373_10_696 228
16 3300005841 Ga0068863_100005909 Ga0068863_10000590910 229
17 3300005843 Ga0068860_100003035 Ga0068860_1000030353 229
18 3300005844 Ga0068862_100000023 Ga0068862_100000023156 229
19 3300009101 Ga0105247_10006544 Ga0105247_100065442 229
20 3300009553 Ga0105249_10000004 Ga0105249_10000004215 229
21 3300014326 Ga0157380_10000211 Ga0157380_100002115 229
22 3300014326 Ga0157380_10511130 Ga0157380_105111302 229
23 3300025900 Ga0207710_10003376 Ga0207710_100033768 229
24 3300025961 Ga0207712_10000008 Ga0207712_10000008346 229
25 3300028380 Ga0268265_10000035 Ga0268265_10000035150 229
26 3300028381 Ga0268264_10001198 Ga0268264_100011982 229
27 3300048927 Ga0496124_0031758 Ga0496124_0031758_3905_4594 229
28 2162886007 SwRhRL2b_contig_2288151 SwRhRL2b_0697.00005400 230
29 2162886007 SwRhRL2b_contig_3746231 SwRhRL2b_0647.00001150 230
30 3300005289 Ga0065704_10000551 Ga0065704_1000055115 230
31 3300005295 Ga0065707_10011192 Ga0065707_100111922 230
32 3300005353 Ga0070669_100000077 Ga0070669_10000007762 230
33 3300005355 Ga0070671_100000471 Ga0070671_10000047115 230
34 3300005367 Ga0070667_100000347 Ga0070667_10000034729 230
35 3300005445 Ga0070708_100532510 Ga0070708_1005325101 230
36 3300005548 Ga0070665_100000592 Ga0070665_10000059225 230
37 3300005618 Ga0068864_100000076 Ga0068864_10000007643 230
38 3300005841 Ga0068863_100151077 Ga0068863_1001510773 230
39 3300005842 Ga0068858_100000462 Ga0068858_1000004628 230
40 3300005843 Ga0068860_100018466 Ga0068860_1000184666 230
41 3300005843 Ga0068860_100093936 Ga0068860_1000939364 230
42 3300005844 Ga0068862_100166899 Ga0068862_1001668992 230
43 3300009092 Ga0105250_10011961 Ga0105250_100119613 230
44 3300009177 Ga0105248_10005391 Ga0105248_100053918 230
45 3300009553 Ga0105249_10088220 Ga0105249_100882202 230
46 3300009553 Ga0105249_10130209 Ga0105249_101302093 230
47 3300013306 Ga0163162_10001037 Ga0163162_1000103717 230
48 3300014325 Ga0163163_10170782 Ga0163163_101707822 230
49 3300025735 Ga0207713_1001192 Ga0207713_100119210 230
50 3300025903 Ga0207680_10099871 Ga0207680_100998712 230
51 3300025923 Ga0207681_10000081 Ga0207681_100000814 230
52 3300025931 Ga0207644_10000821 Ga0207644_1000082110 230
53 3300025986 Ga0207658_10000490 Ga0207658_100004907 230
54 3300026035 Ga0207703_10007587 Ga0207703_100075878 230
55 3300026095 Ga0207676_10001259 Ga0207676_1000125911 230
56 3300028379 Ga0268266_10016836 Ga0268266_100168365 230
57 3300028380 Ga0268265_10012537 Ga0268265_100125372 230
58 3300028381 Ga0268264_10006322 Ga0268264_100063226 230
59 3300028381 Ga0268264_10073324 Ga0268264_100733244 230
60 3300048905 Ga0496102_0000149 Ga0496102_0000149_42163_42924 230
61 3300048906 Ga0496103_0000049 Ga0496103_0000049_102921_103682 230
62 3300048907 Ga0496104_0000073 Ga0496104_0000073_13035_13796 230
63 3300048908 Ga0496105_0000040 Ga0496105_0000040_103156_103917 230
64 3300048913 Ga0496110_0229056 Ga0496110_0229056_819_1580 230
65 3300048915 Ga0496112_0062888 Ga0496112_0062888_2276_3037 230
66 3300048916 Ga0496113_0006684 Ga0496113_0006684_5401_6162 230
67 3300048919 Ga0496116_0043426 Ga0496116_0043426_226_987 230
68 3300048920 Ga0496117_0000123 Ga0496117_0000123_99376_100137 230
69 3300048921 Ga0496118_0011342 Ga0496118_0011342_6590_7351 230
70 3300048922 Ga0496119_0000090 Ga0496119_0000090_30439_31200 230
71 3300048923 Ga0496120_0000690 Ga0496120_0000690_30790_31551 230
72 3300048924 Ga0496121_0007115 Ga0496121_0007115_7297_8058 230
73 3300048925 Ga0496122_0024359 Ga0496122_0024359_1648_2409 230
74 3300048925 Ga0496122_0046309 Ga0496122_0046309_1746_2495 230
75 3300048926 Ga0496123_0003967 Ga0496123_0003967_2889_3650 230
76 3300048926 Ga0496123_0019669 Ga0496123_0019669_4024_4773 230
77 3300048927 Ga0496124_0007030 Ga0496124_0007030_4208_4957 230
78 3300048927 Ga0496124_0013214 Ga0496124_0013214_1549_2310 230
79 3300048928 Ga0496125_0003614 Ga0496125_0003614_16713_17474 230
80 3300048929 Ga0496126_0000045 Ga0496126_0000045_227353_228114 230
81 3300048929 Ga0496126_0025922 Ga0496126_0025922_365_1129 230
82 3300002076 JGI24749J21850_1000041 JGI24749J21850_100004119 231
83 3300002459 JGI24751J29686_10000002 JGI24751J29686_1000000238 231
84 3300005295 Ga0065707_10088016 Ga0065707_100880165 231
85 3300005331 Ga0070670_100000012 Ga0070670_100000012161 231
86 3300005347 Ga0070668_100110224 Ga0070668_1001102243 231
87 3300005353 Ga0070669_100000064 Ga0070669_10000006449 231
88 3300005367 Ga0070667_100005356 Ga0070667_1000053566 231
89 3300005617 Ga0068859_100001455 Ga0068859_10000145518 231
90 3300005618 Ga0068864_100000010 Ga0068864_100000010258 231
91 3300005719 Ga0068861_100015232 Ga0068861_1000152325 231
92 3300005844 Ga0068862_100000016 Ga0068862_100000016155 231
93 3300006931 Ga0097620_100001455 Ga0097620_10000145518 231
94 3300009177 Ga0105248_10000053 Ga0105248_10000053103 231
95 3300009553 Ga0105249_10466449 Ga0105249_104664492 231
96 3300013306 Ga0163162_10431339 Ga0163162_104313392 231
97 3300014326 Ga0157380_10000025 Ga0157380_1000002570 231
98 3300025903 Ga0207680_10292880 Ga0207680_102928802 231
99 3300025923 Ga0207681_10000013 Ga0207681_10000013244 231
100 3300025925 Ga0207650_10000008 Ga0207650_10000008325 231
101 3300025941 Ga0207711_10000754 Ga0207711_1000075410 231
102 3300025972 Ga0207668_10002064 Ga0207668_1000206410 231
103 3300025972 Ga0207668_10073600 Ga0207668_100736002 231
104 3300025986 Ga0207658_10033395 Ga0207658_100333954 231
105 3300026095 Ga0207676_10000012 Ga0207676_1000001272 231
106 3300026118 Ga0207675_100000057 Ga0207675_10000005732 231
107 3300028380 Ga0268265_10000006 Ga0268265_10000006355 231
108 3300003323 rootH1_10237577 rootH1_102375773 232
109 3300005335 Ga0070666_10033143 Ga0070666_100331433 232
110 3300005335 Ga0070666_10246568 Ga0070666_102465682 232
111 3300005347 Ga0070668_100052849 Ga0070668_1000528493 232
112 3300005353 Ga0070669_100000083 Ga0070669_10000008378 232
113 3300005355 Ga0070671_100000107 Ga0070671_10000010745 232
114 3300005355 Ga0070671_100038314 Ga0070671_1000383144 232
115 3300005367 Ga0070667_100021325 Ga0070667_1000213254 232
116 3300005436 Ga0070713_100172801 Ga0070713_1001728012 232
117 3300005617 Ga0068859_100001679 Ga0068859_10000167913 232
118 3300005617 Ga0068859_100013152 Ga0068859_1000131522 232
119 3300005617 Ga0068859_100291517 Ga0068859_1002915173 232
120 3300005618 Ga0068864_100151847 Ga0068864_1001518472 232
121 3300005841 Ga0068863_100075479 Ga0068863_1000754793 232
122 3300005842 Ga0068858_100007118 Ga0068858_1000071183 232
123 3300005842 Ga0068858_100206482 Ga0068858_1002064822 232
124 3300005843 Ga0068860_100009786 Ga0068860_1000097865 232
125 3300005844 Ga0068862_100197007 Ga0068862_1001970072 232
126 3300006931 Ga0097620_100001679 Ga0097620_1000016799 232
127 3300006931 Ga0097620_100013152 Ga0097620_1000131522 232
128 3300006931 Ga0097620_100291522 Ga0097620_1002915223 232
129 3300009101 Ga0105247_10120962 Ga0105247_101209622 232
130 3300009177 Ga0105248_10002289 Ga0105248_1000228915 232
131 3300009177 Ga0105248_10099984 Ga0105248_100999842 232
132 3300013306 Ga0163162_10136951 Ga0163162_101369513 232
133 3300025315 Ga0207697_10010506 Ga0207697_100105061 232
134 3300025903 Ga0207680_10222804 Ga0207680_102228042 232
135 3300025923 Ga0207681_10000060 Ga0207681_1000006090 232
136 3300025928 Ga0207700_10114565 Ga0207700_101145652 232
137 3300025931 Ga0207644_10000004 Ga0207644_10000004570 232
138 3300025931 Ga0207644_10072856 Ga0207644_100728562 232
139 3300025941 Ga0207711_10001565 Ga0207711_1000156515 232
140 3300025941 Ga0207711_10171570 Ga0207711_101715701 232
141 3300025972 Ga0207668_10071879 Ga0207668_100718793 232
142 3300025972 Ga0207668_10154665 Ga0207668_101546652 232
143 3300025986 Ga0207658_10098693 Ga0207658_100986933 232
144 3300026035 Ga0207703_10004339 Ga0207703_100043399 232
145 3300026035 Ga0207703_10459036 Ga0207703_104590362 232
146 3300028380 Ga0268265_10174044 Ga0268265_101740442 232
147 3300028381 Ga0268264_10417400 Ga0268264_104174002 232
148 3300048906 Ga0496103_0074881 Ga0496103_0074881_96_857 232
149 3300048907 Ga0496104_0211095 Ga0496104_0211095_36_797 232
150 3300048907 Ga0496104_0597738 Ga0496104_0597738_188_949 232
151 3300048909 Ga0496106_0001103 Ga0496106_0001103_12629_13390 232
152 3300048910 Ga0496107_0000975 Ga0496107_0000975_528_1289 232
153 3300048913 Ga0496110_0443883 Ga0496110_0443883_345_1106 232
154 3300048914 Ga0496111_0050476 Ga0496111_0050476_222_983 232
155 3300048916 Ga0496113_0000648 Ga0496113_0000648_11415_12176 232
156 3300048917 Ga0496114_0055208 Ga0496114_0055208_310_1071 232
157 3300048929 Ga0496126_0004560 Ga0496126_0004560_5727_6488 232
158 3300049585 Ga0501069_0079209 Ga0501069_0079209_877_1626 232
159 3300003791 Ga0055530_10008059 Ga0055530_100080595 233
160 3300005331 Ga0070670_100142215 Ga0070670_1001422152 233
161 3300025925 Ga0207650_10319767 Ga0207650_103197672 233
162 3300001976 JGI24752J21851_1000128 JGI24752J21851_10001283 234
163 3300002070 JGI24750J21931_1001044 JGI24750J21931_10010443 234
164 3300002074 JGI24748J21848_1000040 JGI24748J21848_100004010 234
165 3300002076 JGI24749J21850_1001199 JGI24749J21850_10011993 234
166 3300002239 JGI24034J26672_10000045 JGI24034J26672_1000004559 234
167 3300005330 Ga0070690_100000006 Ga0070690_100000006104 234
168 3300005335 Ga0070666_10000004 Ga0070666_1000000477 234
169 3300005353 Ga0070669_100000183 Ga0070669_10000018316 234
170 3300005365 Ga0070688_100008471 Ga0070688_1000084714 234
171 3300005367 Ga0070667_100060197 Ga0070667_1000601973 234
172 3300005466 Ga0070685_10000268 Ga0070685_100002685 234
173 3300005544 Ga0070686_100000036 Ga0070686_10000003677 234
174 3300005548 Ga0070665_100000004 Ga0070665_100000004453 234
175 3300005548 Ga0070665_100902272 Ga0070665_1009022721 234
176 3300005617 Ga0068859_100011814 Ga0068859_1000118143 234
177 3300005618 Ga0068864_100018051 Ga0068864_1000180512 234
178 3300005719 Ga0068861_100004185 Ga0068861_1000041854 234
179 3300005842 Ga0068858_100025887 Ga0068858_1000258872 234
180 3300005843 Ga0068860_100000009 Ga0068860_10000000977 234
181 3300005844 Ga0068862_100000029 Ga0068862_10000002988 234
182 3300006931 Ga0097620_100011814 Ga0097620_1000118143 234
183 3300009101 Ga0105247_10050373 Ga0105247_100503733 234
184 3300009177 Ga0105248_10077154 Ga0105248_100771544 234
185 3300009553 Ga0105249_10000006 Ga0105249_10000006287 234
186 3300009553 Ga0105249_10188569 Ga0105249_101885692 234
187 3300013306 Ga0163162_10447468 Ga0163162_104474682 234
188 3300014325 Ga0163163_10240869 Ga0163163_102408692 234
189 3300017792 Ga0163161_10000029 Ga0163161_10000029110 234
190 3300021361 Ga0213872_10000049 Ga0213872_1000004927 234
191 3300025903 Ga0207680_10000010 Ga0207680_10000010330 234
192 3300025922 Ga0207646_10688433 Ga0207646_106884332 234
193 3300025923 Ga0207681_10000047 Ga0207681_1000004736 234
194 3300025931 Ga0207644_10014929 Ga0207644_100149292 234
195 3300025936 Ga0207670_10089135 Ga0207670_100891351 234
196 3300025961 Ga0207712_10000014 Ga0207712_1000001477 234
197 3300025961 Ga0207712_10034849 Ga0207712_100348493 234
198 3300025972 Ga0207668_10292304 Ga0207668_102923042 234
199 3300025986 Ga0207658_10001340 Ga0207658_1000134019 234
200 3300026035 Ga0207703_10000613 Ga0207703_1000061325 234
201 3300026095 Ga0207676_10005460 Ga0207676_100054607 234
202 3300026118 Ga0207675_100000262 Ga0207675_1000002629 234
203 3300028379 Ga0268266_10000009 Ga0268266_10000009347 234
204 3300028379 Ga0268266_10637638 Ga0268266_106376381 234
205 3300028380 Ga0268265_10000283 Ga0268265_1000028342 234
206 3300028381 Ga0268264_10000023 Ga0268264_10000023288 234
207 3300039447 Ga0436361_0082864 Ga0436361_0082864_75917_76672 234
208 3300048904 Ga0496101_0063049 Ga0496101_0063049_476_1234 234
209 3300048905 Ga0496102_0085722 Ga0496102_0085722_2004_2762 234
210 3300048906 Ga0496103_0001521 Ga0496103_0001521_1082_1840 234
211 3300048907 Ga0496104_0474626 Ga0496104_0474626_290_1048 234
212 3300048908 Ga0496105_0009434 Ga0496105_0009434_4052_4810 234
213 3300048919 Ga0496116_0038635 Ga0496116_0038635_641_1399 234
214 3300048920 Ga0496117_0019249 Ga0496117_0019249_380_1138 234
215 3300048921 Ga0496118_0017830 Ga0496118_0017830_1082_1840 234
216 3300048924 Ga0496121_0099313 Ga0496121_0099313_1084_1842 234
217 3300048929 Ga0496126_0075745 Ga0496126_0075745_101_862 234
218 2162886007 SwRhRL2b_contig_2334788 SwRhRL2b_0502.00010790 235
219 3300005289 Ga0065704_10070166 Ga0065704_10070166141 235
220 3300049513 Ga0501290_000287 Ga0501290_000287_2727_3488 235
221 3300049515 Ga0501292_000006 Ga0501292_000006_49352_50113 235
222 3300049517 Ga0501294_000434 Ga0501294_000434_2589_3350 235
223 3300049523 Ga0501300_000144 Ga0501300_000144_9580_10341 235
224 3300049662 Ga0501222_006532 Ga0501222_006532_90_851 235
225 3300049663 Ga0501223_012170 Ga0501223_012170_223_984 235
226 3300049664 Ga0501224_014675 Ga0501224_014675_28_789 235
227 3300049669 Ga0501235_002821 Ga0501235_002821_2444_3205 235
228 3300049688 Ga0501259_000413 Ga0501259_000413_4782_5543 235
229 3300049690 Ga0501261_000001 Ga0501261_000001_29260_30021 235
230 3300049705 Ga0501225_0008537 Ga0501225_0008537_1431_2192 235
231 3300049775 Ga0501279_000006 Ga0501279_000006_54919_55680 235
232 3300049776 Ga0501280_000127 Ga0501280_000127_715_1476 235
233 3300049777 Ga0501281_00003 Ga0501281_00003_2175_2936 235
234 3300049778 Ga0501282_000017 Ga0501282_000017_9097_9858 235
235 3300049779 Ga0501283_000294 Ga0501283_000294_3197_3958 235
236 3300005843 Ga0068860_100016576 Ga0068860_1000165761 236
237 3300025298 Ga0209050_1000232 Ga0209050_100023258 236
238 3300028381 Ga0268264_10556607 Ga0268264_105566072 236
239 iso_pu_bacteria 2511231015 2511323341 237
240 iso_pu_bacteria 2554235231 2555245004 237
241 iso_pu_bacteria 2599185239 2599734869 237
242 iso_pu_bacteria 2744054900 2746089543 237
243 iso_pu_bacteria 2744054901 2746098402 237
244 iso_pu_bacteria 2808606379 2808940691 237
245 iso_pu_bacteria 2818991452 2819635816 237
246 iso_pu_bacteria 2870068957 2870075449 237
247 iso_pu_bacteria 2928170801 2928175191 237
248 iso_pu_bacteria 2981990288 2981992595 237
249 iso_pu_bacteria 641736154 642418784 237
250 iso_pu_bacteria 8011350971 8011351974 237
251 iso_pu_bacteria 8018845410 8018847803 237
252 iso_pu_bacteria 8021120328 8021121901 237
253 2162886007 SwRhRL2b_contig_660862 SwRhRL2b_0228.00001470 238
254 3300003758 Ga0055532_1000240 Ga0055532_10002403 238
255 3300005289 Ga0065704_10071003 Ga0065704_1007100310 238
256 3300025225 Ga0209566_100384 Ga0209566_10038432 238
257 3300025226 Ga0209674_110139 Ga0209674_1101392 238
258 3300025229 Ga0209147_100145 Ga0209147_10014547 238
259 3300039437 Ga0436365_0396693 Ga0436365_0396693_312_1067 238
260 3300048925 Ga0496122_0003952 Ga0496122_0003952_4733_5488 238
261 3300048926 Ga0496123_0005109 Ga0496123_0005109_1204_1959 238
262 3300048927 Ga0496124_0252748 Ga0496124_0252748_214_975 238
263 3300048929 Ga0496126_0012980 Ga0496126_0012980_6518_7279 238
264 iso_pu_bacteria 2811994881 2812368407 238
265 iso_pu_bacteria 2923519811 2923522463 238
266 3300003758 Ga0055532_1001336 Ga0055532_10013363 239
267 3300003760 Ga0055527_1000963 Ga0055527_10009633 239
268 3300003761 Ga0055535_1002290 Ga0055535_10022903 239
269 3300003762 Ga0055542_1003243 Ga0055542_10032433 239
270 3300003763 Ga0055529_1001972 Ga0055529_10019726 239
271 3300005563 Ga0068855_100081323 Ga0068855_1000813235 239
272 3300025228 Ga0209672_100062 Ga0209672_100062147 239
273 3300025229 Ga0209147_100078 Ga0209147_100078147 239
274 3300025242 Ga0209258_100108 Ga0209258_100108147 239
275 3300025254 Ga0209148_1000730 Ga0209148_10007306 239
276 3300025256 Ga0209759_1005393 Ga0209759_10053934 239
277 3300025272 Ga0209455_1000460 Ga0209455_100046023 239
278 3300025949 Ga0207667_10049479 Ga0207667_100494792 239
279 3300041411 Ga0439466_0000164 Ga0439466_0000164_9698_10447 239
280 3300046501 Ga0495607_0012796 Ga0495607_0012796_2058_2813 239
281 3300046692 Ga0495671_0018796 Ga0495671_0018796_1375_2130 239
282 3300048905 Ga0496102_0000178 Ga0496102_0000178_18767_19516 239
283 3300048906 Ga0496103_0000961 Ga0496103_0000961_955_1704 239
284 3300048907 Ga0496104_0044245 Ga0496104_0044245_91_840 239
285 3300048908 Ga0496105_0001483 Ga0496105_0001483_891_1640 239
286 3300048913 Ga0496110_0008945 Ga0496110_0008945_845_1594 239
287 3300048914 Ga0496111_0016462 Ga0496111_0016462_713_1462 239
288 3300048917 Ga0496114_0047504 Ga0496114_0047504_960_1709 239
289 3300048918 Ga0496115_0001008 Ga0496115_0001008_18777_19526 239
290 3300048920 Ga0496117_0002983 Ga0496117_0002983_891_1640 239
291 3300048921 Ga0496118_0000186 Ga0496118_0000186_18778_19527 239
292 3300048922 Ga0496119_0018491 Ga0496119_0018491_283_1032 239
293 3300048923 Ga0496120_0012610 Ga0496120_0012610_2641_3390 239
294 3300048924 Ga0496121_0003997 Ga0496121_0003997_18691_19440 239
295 3300048925 Ga0496122_0003419 Ga0496122_0003419_735_1484 239
296 3300048927 Ga0496124_0003146 Ga0496124_0003146_902_1651 239
297 3300048928 Ga0496125_0002834 Ga0496125_0002834_20236_20985 239
298 3300048929 Ga0496126_0003337 Ga0496126_0003337_901_1650 239
299 iso_pu_bacteria 2565956761 2566996272 239
300 iso_pu_bacteria 2738541308 2738890640 239
301 iso_pu_bacteria 2738543005 2739203848 239
302 iso_pu_bacteria 2738543005 2739206013 239
303 iso_pu_bacteria 2895880812 2895885749 239
304 iso_pu_bacteria 2904535858 2904540910 239
305 iso_pu_bacteria 2922554459 2922555002 239
306 iso_pu_bacteria 2928142448 2928145577 239
307 3300005295 Ga0065707_10082123 Ga0065707_1008212315 240
308 3300014326 Ga0157380_10000845 Ga0157380_1000084515 240
309 3300046512 Ga0495610_0021662 Ga0495610_0021662_1500_2255 240
310 3300047472 Ga0495686_0119686 Ga0495686_0119686_163_918 240
311 3300048919 Ga0496116_0000078 Ga0496116_0000078_47092_47850 240
312 3300048921 Ga0496118_0087455 Ga0496118_0087455_210_968 240
313 3300048925 Ga0496122_0000094 Ga0496122_0000094_187976_188734 240
314 3300048926 Ga0496123_0000116 Ga0496123_0000116_102246_103004 240
315 3300048927 Ga0496124_0024316 Ga0496124_0024316_3068_3826 240
316 3300048928 Ga0496125_0001768 Ga0496125_0001768_3346_4104 240
317 3300048928 Ga0496125_0018310 Ga0496125_0018310_550_1302 240
318 3300048929 Ga0496126_0000058 Ga0496126_0000058_104830_105588 240
319 3300049569 Ga0501032_0009608 Ga0501032_0009608_4660_5415 240
320 3300049573 Ga0501037_0089014 Ga0501037_0089014_1062_1817 240
321 3300049575 Ga0501039_0132105 Ga0501039_0132105_826_1581 240
322 3300006058 Ga0075432_10000728 Ga0075432_1000072811 241
323 3300009036 Ga0105244_10001385 Ga0105244_100013856 241
324 3300031730 Ga0307516_10007864 Ga0307516_100078645 241
325 3300041404 Ga0439436_0016910 Ga0439436_0016910_16_771 241
326 3300041405 Ga0439438_001282 Ga0439438_001282_10049_10822 241
327 3300041407 Ga0439447_003484 Ga0439447_003484_702_1475 241
328 3300042009 Ga0439451_000332 Ga0439451_000332_5614_6369 241
329 3300042010 Ga0439452_061694 Ga0439452_061694_59_814 241
330 3300042013 Ga0439456_013001 Ga0439456_013001_184_939 241
331 3300046455 Ga0495603_0010401 Ga0495603_0010401_652_1407 241
332 3300046491 Ga0495584_0035550 Ga0495584_0035550_87_884 241
333 3300046530 Ga0495654_0000805 Ga0495654_0000805_11844_12641 241
334 3300046557 Ga0495622_0083622 Ga0495622_0083622_40_837 241
335 3300046692 Ga0495671_0019682 Ga0495671_0019682_925_1722 241
336 3300046694 Ga0495649_0000997 Ga0495649_0000997_12556_13353 241
337 3300047320 Ga0495672_0001254 Ga0495672_0001254_12970_13767 241
338 3300047469 Ga0495673_0000900 Ga0495673_0000900_11534_12331 241
339 3300048091 Ga0495626_0000948 Ga0495626_0000948_12565_13362 241
340 3300048911 Ga0496108_0100675 Ga0496108_0100675_1642_2403 241
341 3300048920 Ga0496117_0072239 Ga0496117_0072239_445_1206 241
342 3300048921 Ga0496118_0044608 Ga0496118_0044608_1785_2546 241
343 3300048922 Ga0496119_0063889 Ga0496119_0063889_1339_2100 241
344 3300049579 Ga0501043_0117375 Ga0501043_0117375_1084_1860 241
345 3300049582 Ga0501048_0421288 Ga0501048_0421288_112_888 241
346 3300005289 Ga0065704_10005191 Ga0065704_100051913 242
347 3300005355 Ga0070671_100175076 Ga0070671_1001750762 242
348 3300005466 Ga0070685_10089813 Ga0070685_100898133 242
349 3300009177 Ga0105248_10001490 Ga0105248_100014905 242
350 3300009978 Ga0105148_100052 Ga0105148_10005210 242
351 3300014968 Ga0157379_10113380 Ga0157379_101133802 242
352 3300025923 Ga0207681_10153099 Ga0207681_101530992 242
353 3300025925 Ga0207650_10184422 Ga0207650_101844222 242
354 3300025941 Ga0207711_10001078 Ga0207711_1000107823 242
355 3300025941 Ga0207711_10013529 Ga0207711_100135292 242
356 3300032004 Ga0307414_10359176 Ga0307414_103591762 242
357 3300048909 Ga0496106_0065802 Ga0496106_0065802_526_1284 242
358 3300048911 Ga0496108_0339530 Ga0496108_0339530_274_1035 242
359 3300048913 Ga0496110_0121141 Ga0496110_0121141_781_1542 242
360 3300048916 Ga0496113_0017707 Ga0496113_0017707_1275_2036 242
361 3300048919 Ga0496116_0146678 Ga0496116_0146678_206_964 242
362 3300048921 Ga0496118_0042992 Ga0496118_0042992_1797_2555 242
363 3300048921 Ga0496118_0049710 Ga0496118_0049710_1871_2629 242
364 3300048924 Ga0496121_0000038 Ga0496121_0000038_325721_326479 242
365 3300048924 Ga0496121_0000058 Ga0496121_0000058_262628_263386 242
366 3300048928 Ga0496125_0078852 Ga0496125_0078852_770_1531 242
367 3300048928 Ga0496125_0149659 Ga0496125_0149659_198_959 242
368 3300048929 Ga0496126_0005928 Ga0496126_0005928_6568_7326 242
369 3300049705 Ga0501225_0010676 Ga0501225_0010676_1205_1966 242
370 3300049705 Ga0501225_0046433 Ga0501225_0046433_126_887 242
371 2162886007 SwRhRL2b_contig_1732412 SwRhRL2b_0813.00000110 243
372 3300005289 Ga0065704_10002742 Ga0065704_100027427 243
373 3300005335 Ga0070666_10036255 Ga0070666_100362554 243
374 3300005347 Ga0070668_100052851 Ga0070668_1000528511 243
375 3300005347 Ga0070668_100156044 Ga0070668_1001560442 243
376 3300005353 Ga0070669_100000199 Ga0070669_1000001996 243
377 3300005353 Ga0070669_100027320 Ga0070669_1000273204 243
378 3300005355 Ga0070671_100000682 Ga0070671_1000006829 243
379 3300005367 Ga0070667_100062511 Ga0070667_1000625114 243
380 3300005548 Ga0070665_100000163 Ga0070665_10000016383 243
381 3300005548 Ga0070665_100124108 Ga0070665_1001241082 243
382 3300005618 Ga0068864_100067136 Ga0068864_1000671363 243
383 3300005841 Ga0068863_100006132 Ga0068863_10000613211 243
384 3300005842 Ga0068858_100094529 Ga0068858_1000945292 243
385 3300005843 Ga0068860_100029173 Ga0068860_1000291733 243
386 3300005844 Ga0068862_100026938 Ga0068862_1000269385 243
387 3300006051 Ga0075364_10041272 Ga0075364_100412722 243
388 3300006353 Ga0075370_10095254 Ga0075370_100952541 243
389 3300009011 Ga0105251_10003673 Ga0105251_100036733 243
390 3300009101 Ga0105247_10026047 Ga0105247_100260472 243
391 3300009177 Ga0105248_10024273 Ga0105248_100242736 243
392 3300009177 Ga0105248_10137264 Ga0105248_101372643 243
393 3300009553 Ga0105249_10593298 Ga0105249_105932981 243
394 3300014326 Ga0157380_10050009 Ga0157380_100500093 243
395 3300025735 Ga0207713_1000266 Ga0207713_10002669 243
396 3300025903 Ga0207680_10036416 Ga0207680_100364162 243
397 3300025923 Ga0207681_10000575 Ga0207681_1000057511 243
398 3300025923 Ga0207681_10015602 Ga0207681_100156024 243
399 3300025923 Ga0207681_10063202 Ga0207681_100632022 243
400 3300025925 Ga0207650_10248845 Ga0207650_102488451 243
401 3300025931 Ga0207644_10000331 Ga0207644_1000033123 243
402 3300025935 Ga0207709_10422424 Ga0207709_104224242 243
403 3300025941 Ga0207711_10275622 Ga0207711_102756222 243
404 3300025961 Ga0207712_10248910 Ga0207712_102489102 243
405 3300025972 Ga0207668_10003450 Ga0207668_100034504 243
406 3300025972 Ga0207668_10137325 Ga0207668_101373251 243
407 3300025986 Ga0207658_10001365 Ga0207658_1000136514 243
408 3300026095 Ga0207676_10294496 Ga0207676_102944962 243
409 3300028379 Ga0268266_10000205 Ga0268266_1000020571 243
410 3300028379 Ga0268266_10127208 Ga0268266_101272083 243
411 3300028380 Ga0268265_10049178 Ga0268265_100491782 243
412 3300028381 Ga0268264_10022258 Ga0268264_100222586 243
413 3300046616 Ga0495668_0039764 Ga0495668_0039764_1266_2027 243
414 3300048905 Ga0496102_0033617 Ga0496102_0033617_983_1744 243
415 3300048906 Ga0496103_0219631 Ga0496103_0219631_146_907 243
416 3300048911 Ga0496108_0000312 Ga0496108_0000312_33750_34511 243
417 3300048914 Ga0496111_0159812 Ga0496111_0159812_722_1483 243
418 3300048919 Ga0496116_0020897 Ga0496116_0020897_284_1045 243
419 3300048920 Ga0496117_0135353 Ga0496117_0135353_592_1353 243
420 3300048920 Ga0496117_0237099 Ga0496117_0237099_42_803 243
421 3300048923 Ga0496120_0043471 Ga0496120_0043471_216_977 243
422 3300048924 Ga0496121_0000569 Ga0496121_0000569_29863_30624 243
423 3300048924 Ga0496121_0014621 Ga0496121_0014621_1231_1992 243
424 3300048924 Ga0496121_0069115 Ga0496121_0069115_1910_2671 243
425 3300048926 Ga0496123_0037067 Ga0496123_0037067_996_1757 243
426 3300048926 Ga0496123_0111199 Ga0496123_0111199_647_1408 243
427 3300048926 Ga0496123_0171198 Ga0496123_0171198_89_850 243
428 3300048927 Ga0496124_0007192 Ga0496124_0007192_6686_7447 243
429 3300048928 Ga0496125_0003609 Ga0496125_0003609_3625_4386 243
430 3300048929 Ga0496126_0014415 Ga0496126_0014415_1595_2356 243
431 3300049663 Ga0501223_000006 Ga0501223_000006_60775_61536 243
432 3300049705 Ga0501225_0000032 Ga0501225_0000032_24133_24894 243
433 3300050490 nmdc:mga03n38_81306_c1 nmdc:mga03n38_81306_c1_203_964 243

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

21

213

0.96

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

27

262

0.96

PF08659

KR

KR domain

21

197

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5jy1-assembly1.cif.gz_D crystal structure of putative short-chain dehydrogenase/reductase from burkholderia xenovorans lb400 bound to nad 0.9439 1 239
1vl8-assembly1.cif.gz_B crystal structure of gluconate 5-dehydrogenase (tm0441) from thermotoga maritima at 2.07 a resolution 0.9303 4 239
1ahi-assembly1.cif.gz_A 7 alpha-hydroxysteroid dehydrogenase complexed with nadh and 7-oxo glycochenodeoxycholic acid 0.9302 4 240
6zzs-assembly2.cif.gz_F-2 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and 3-oxovalerate 0.9279 4 239
6zzs-assembly2.cif.gz_E-2 crystal structure of (r)-3-hydroxybutyrate dehydrogenase from acinetobacter baumannii complexed with nad+ and 3-oxovalerate 0.9259 1 239
ID Description Score Start End Superfamily
5jy1D00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9439 1 239 3.40.50.720
af_P0AET8_1_255_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9362 4 240 3.40.50.720
1vl8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9303 4 239 3.40.50.720
3svtA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9281 4 239 3.40.50.720
af_I1LJY0_35_302_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.927 4 239 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A7X7PCP2-F1-model_v4 SDR family oxidoreductase 0.9783 24 242 GO:0016491
AF-A0A1G4Q2G0-F1-model_v4 deleted 0.969 1 243
AF-A0A2T5AV47-F1-model_v4 deleted 0.9676 3 243
AF-A0A173LPB1-F1-model_v4 Putative oxidoreductase 0.9676 3 243
AF-A0A2E2YG13-F1-model_v4 3-oxoacyl-ACP reductase 0.9674 2 243

Feature Viewer

pLDDT pTM Quality
91.41 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map