F442910

General Info

Members Datasets Scaffolds Average Seq Length
433 155 432 345

Family's Representative Sequence

Representative Sequence 3300045051|Ga0451576_0188102|Ga0451576_0188102_385_1602
Length 405
Sequence LKADLSLEIAERRYAAVKAGVSGFPYVEFRISNCFQHCQKQNIRQHVSTGTSTKISSMQKARVIEKDPPLKKSDLIVITGAGGFIGGNLAGYFAKKGFTNIRAVDKKPLYEWYLHVPGVQNLCLDVSDEENCQRVCAGAVEVYNLAADMGGMGFIERFRVECLRSILINTHMVEAAYRAGARRYFFSSSACAYNTDLQQDPKVRALKESDAYPAMAERGYGWEKLVSEMFCQEYWAERGMKTAIARFHNVYGPHGTWDGGREKAPAAMCRKVITAIDTGKKDITIWGDGHQTRSFMYIDDCVKGIDMITHCDDLIATPINLGSSELVSINDLLSKVEKIAGVKLKRHYDLDAPRGVAGRNSDNTFIQKVLKWEPNTSLDKGLAATYEWIKEQYDKRKEGKRVGIG

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2920107658 Aquisphaera insulae JC669 Isolate Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
12 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
13 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
14 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
17 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
18 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
19 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
20 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
21 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
22 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
23 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
24 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
25 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
26 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
27 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
29 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
30 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
31 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
32 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
33 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
34 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
35 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
36 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
37 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
38 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
39 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
40 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
41 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
54 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
55 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
57 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
59 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
60 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
61 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
62 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
63 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
64 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
65 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
66 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
67 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
68 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
69 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
70 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
71 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
72 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
73 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
74 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
75 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
76 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
77 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
78 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
79 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
80 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
81 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
82 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
83 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
84 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
85 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
86 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
87 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
88 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
91 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
92 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
93 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
94 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
95 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
96 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
99 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
100 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
101 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
102 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
103 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
104 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
105 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
106 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
107 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
108 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
109 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
110 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
111 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
114 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
115 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
119 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
122 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
123 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
124 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
125 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
126 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
127 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
128 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
129 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
130 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
131 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
132 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
133 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
134 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
135 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
141 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
142 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
144 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
145 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
146 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
147 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
149 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
150 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
151 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
152 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
153 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
154 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
155 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.61
Metatranscriptomes 1.15
Isolates 0.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.23
Rhizosphere 97.92
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3539642 2162886007 Unclassified 4358
2 Ga0065704_10080389 3300005289 Unclassified 3935
3 Ga0065707_10005667 3300005295 Bacteria 5361
4 Ga0065707_10012578 3300005295 Bacteria 2765
5 Ga0065707_10084102 3300005295 Bacteria 7693
6 Ga0070690_100091924 3300005330 Bacteria 2000
7 Ga0068868_100297391 3300005338 Bacteria 1370
8 Ga0070691_10025040 3300005341 Bacteria 2777
9 Ga0070667_100213123 3300005367 Bacteria 1717
10 Ga0070711_100008491 3300005439 Bacteria 6293
11 Ga0070711_100031157 3300005439 Unclassified 3538
12 Ga0070711_100222743 3300005439 Bacteria 1467
13 Ga0070694_100123587 3300005444 Unclassified 1860
14 Ga0070694_100197916 3300005444 Bacteria 1496
15 Ga0070681_10042617 3300005458 Bacteria 4548
16 Ga0070706_100006177 3300005467 Bacteria 11333
17 Ga0070707_100010237 3300005468 Bacteria 8734
18 Ga0070698_100134159 3300005471 Bacteria 2430
19 Ga0070698_100377504 3300005471 Bacteria 1350
20 Ga0068855_100041835 3300005563 Bacteria 5430
21 Ga0068855_100351462 3300005563 Bacteria 1624
22 Ga0068857_100015146 3300005577 Bacteria 6730
23 Ga0068856_100000760 3300005614 Bacteria 34998
24 Ga0068856_100046768 3300005614 Bacteria 4262
25 Ga0068856_100165552 3300005614 Unclassified 2222
26 Ga0068859_100255163 3300005617 Bacteria 1844
27 Ga0068860_100224129 3300005843 Bacteria 1826
28 Ga0068860_100532106 3300005843 Bacteria 1176
29 Ga0081455_10002687 3300005937 Bacteria 21011
30 Ga0081539_10018419 3300005985 Bacteria 4847
31 Ga0070717_10059135 3300006028 Bacteria 3171
32 Ga0070717_10112545 3300006028 Bacteria 2323
33 Ga0075428_100130479 3300006844 Bacteria 2734
34 Ga0075431_100256894 3300006847 Bacteria 1774
35 Ga0075431_100457452 3300006847 Unclassified 1271
36 Ga0075433_10006667 3300006852 Bacteria 9141
37 Ga0075433_10363607 3300006852 Bacteria 1278
38 Ga0075434_100025798 3300006871 Bacteria 5754
39 Ga0097620_100255148 3300006931 Bacteria 1844
40 Ga0099794_10000967 3300007265 Bacteria 9675
41 Ga0099795_10039401 3300007788 Unclassified 1672
42 Ga0099795_10097200 3300007788 Bacteria 1150
43 Ga0105240_10001651 3300009093 Bacteria 37853
44 Ga0105240_10009028 3300009093 Bacteria 14157
45 Ga0111539_10012394 3300009094 Bacteria 10688
46 Ga0111539_10020680 3300009094 Bacteria 8106
47 Ga0111539_10731893 3300009094 Bacteria 1151
48 Ga0114129_10001366 3300009147 Bacteria 32807
49 Ga0114129_10001578 3300009147 Bacteria 30952
50 Ga0114129_10016502 3300009147 Bacteria 10516
51 Ga0114129_10019549 3300009147 Bacteria 9644
52 Ga0114129_10037295 3300009147 Bacteria 6864
53 Ga0114129_10055896 3300009147 Bacteria 5531
54 Ga0114129_10418835 3300009147 Bacteria 1762
55 Ga0105238_10004756 3300009551 Bacteria 13433
56 Ga0105238_10011149 3300009551 Bacteria 9039
57 Ga0105238_10036513 3300009551 Bacteria 4996
58 Ga0105238_10319077 3300009551 Bacteria 1539
59 Ga0099796_10031476 3300010159 Unclassified 1730
60 Ga0163162_10097526 3300013306 Bacteria 3028
61 Ga0163162_10126173 3300013306 Bacteria 2665
62 Ga0157372_10176715 3300013307 Bacteria 2471
63 Ga0163163_10134708 3300014325 Bacteria 2511
64 Ga0157380_10391786 3300014326 Unclassified 1315
65 Ga0213876_10002834 3300021384 Bacteria 10085
66 Ga0213875_10016676 3300021388 Bacteria 3559
67 Ga0207699_10023688 3300025906 Unclassified 3344
68 Ga0207684_10020434 3300025910 Bacteria 5657
69 Ga0207707_10047338 3300025912 Bacteria 3745
70 Ga0207695_10066572 3300025913 Bacteria 3699
71 Ga0207695_10210238 3300025913 Unclassified 1857
72 Ga0207693_10005011 3300025915 Bacteria 11113
73 Ga0207663_10022551 3300025916 Bacteria 3601
74 Ga0207663_10022859 3300025916 Unclassified 3580
75 Ga0207646_10009506 3300025922 Bacteria 9601
76 Ga0207694_10013591 3300025924 Bacteria 6136
77 Ga0207694_10055776 3300025924 Bacteria 3067
78 Ga0207694_10094170 3300025924 Bacteria 2367
79 Ga0207694_10213643 3300025924 Bacteria 1572
80 Ga0207700_10042487 3300025928 Bacteria 3333
81 Ga0207700_10049040 3300025928 Unclassified 3139
82 Ga0207700_10172574 3300025928 Bacteria 1805
83 Ga0207665_10032373 3300025939 Bacteria 3462
84 Ga0207667_10145964 3300025949 Bacteria 2435
85 Ga0207703_10046332 3300026035 Bacteria 3501
86 Ga0207703_10109496 3300026035 Bacteria 2354
87 Ga0207702_10000506 3300026078 Bacteria 43980
88 Ga0207702_10010455 3300026078 Bacteria 7763
89 Ga0207702_10088676 3300026078 Unclassified 2703
90 Ga0207674_10030834 3300026116 Bacteria 5635
91 Ga0209179_1000700 3300027512 Bacteria 3619
92 Ga0207428_10063599 3300027907 Unclassified 2914
93 Ga0268264_10410281 3300028381 Bacteria 1304
94 Ga0265337_1000257 3300028556 Bacteria 28698
95 Ga0265337_1002800 3300028556 Bacteria 7802
96 Ga0265337_1007053 3300028556 Bacteria 4247
97 Ga0265337_1011791 3300028556 Bacteria 2999
98 Ga0265337_1026918 3300028556 Unclassified 1737
99 Ga0265337_1027725 3300028556 Bacteria 1705
100 Ga0265326_10000880 3300028558 Bacteria 10920
101 Ga0265326_10029018 3300028558 Bacteria 1576
102 Ga0265326_10041711 3300028558 Bacteria 1302
103 Ga0265319_1000019 3300028563 Bacteria 154537
104 Ga0265319_1002075 3300028563 Bacteria 11241
105 Ga0265319_1038353 3300028563 Bacteria 1629
106 Ga0265318_10009517 3300028577 Bacteria 4270
107 Ga0265318_10013592 3300028577 Bacteria 3434
108 Ga0265323_10000081 3300028653 Bacteria 54264
109 Ga0265323_10000489 3300028653 Bacteria 22332
110 Ga0265323_10001533 3300028653 Bacteria 11215
111 Ga0265323_10002140 3300028653 Bacteria 9207
112 Ga0265323_10004584 3300028653 Bacteria 5945
113 Ga0265323_10006353 3300028653 Bacteria 4968
114 Ga0265323_10015233 3300028653 Bacteria 3027
115 Ga0265323_10020922 3300028653 Bacteria 2512
116 Ga0265323_10031553 3300028653 Bacteria 1969
117 Ga0265322_10000346 3300028654 Bacteria 19409
118 Ga0265322_10000892 3300028654 Bacteria 10580
119 Ga0265336_10003863 3300028666 Bacteria 5764
120 Ga0265336_10018127 3300028666 Bacteria 2284
121 Ga0265338_10000458 3300028800 Bacteria 72770
122 Ga0265338_10000593 3300028800 Bacteria 63891
123 Ga0265338_10000942 3300028800 Bacteria 49028
124 Ga0265338_10001055 3300028800 Bacteria 45944
125 Ga0265338_10001593 3300028800 Bacteria 36415
126 Ga0265338_10001807 3300028800 Bacteria 33620
127 Ga0265338_10001870 3300028800 Bacteria 33044
128 Ga0265338_10001988 3300028800 Bacteria 31801
129 Ga0265338_10002193 3300028800 Bacteria 29914
130 Ga0265338_10005663 3300028800 Bacteria 16199
131 Ga0265338_10008480 3300028800 Bacteria 12469
132 Ga0265338_10014155 3300028800 Bacteria 8916
133 Ga0265338_10023411 3300028800 Bacteria 6352
134 Ga0265338_10043311 3300028800 Bacteria 4177
135 Ga0265338_10131739 3300028800 Bacteria 1972
136 Ga0265338_10139031 3300028800 Bacteria 1905
137 Ga0265338_10146292 3300028800 Bacteria 1843
138 Ga0265338_10168734 3300028800 Bacteria 1681
139 Ga0265338_10233538 3300028800 Bacteria 1366
140 Ga0265324_10000568 3300029957 Bacteria 25298
141 Ga0265324_10007982 3300029957 Bacteria 4241
142 Ga0265324_10008527 3300029957 Bacteria 4068
143 Ga0265324_10008796 3300029957 Bacteria 3981
144 Ga0265324_10010211 3300029957 Bacteria 3631
145 Ga0265324_10013063 3300029957 Unclassified 3108
146 Ga0265324_10034983 3300029957 Bacteria 1749
147 Ga0265324_10057270 3300029957 Bacteria 1334
148 Ga0265330_10000367 3300031235 Bacteria 31833
149 Ga0265330_10002086 3300031235 Bacteria 11040
150 Ga0265330_10026549 3300031235 Bacteria 2619
151 Ga0265330_10096638 3300031235 Bacteria 1266
152 Ga0265332_10001868 3300031238 Bacteria 11196
153 Ga0265328_10051734 3300031239 Bacteria 1508
154 Ga0265328_10058292 3300031239 Bacteria 1418
155 Ga0265328_10062775 3300031239 Bacteria 1364
156 Ga0265320_10000471 3300031240 Bacteria 31514
157 Ga0265320_10003990 3300031240 Bacteria 9731
158 Ga0265320_10004485 3300031240 Bacteria 9141
159 Ga0265320_10005261 3300031240 Bacteria 8339
160 Ga0265320_10011023 3300031240 Bacteria 5342
161 Ga0265320_10011822 3300031240 Bacteria 5116
162 Ga0265320_10013822 3300031240 Bacteria 4626
163 Ga0265320_10052605 3300031240 Bacteria 1971
164 Ga0265320_10060753 3300031240 Bacteria 1803
165 Ga0265320_10063793 3300031240 Bacteria 1752
166 Ga0265320_10110170 3300031240 Bacteria 1261
167 Ga0265325_10010256 3300031241 Bacteria 5435
168 Ga0265325_10019920 3300031241 Unclassified 3702
169 Ga0265325_10025351 3300031241 Bacteria 3220
170 Ga0265325_10084932 3300031241 Unclassified 1568
171 Ga0265329_10000411 3300031242 Bacteria 22483
172 Ga0265329_10002817 3300031242 Bacteria 7765
173 Ga0265329_10018626 3300031242 Bacteria 2371
174 Ga0265329_10024727 3300031242 Bacteria 1992
175 Ga0265340_10000342 3300031247 Bacteria 24777
176 Ga0265340_10000538 3300031247 Bacteria 20927
177 Ga0265340_10014202 3300031247 Bacteria 4167
178 Ga0265340_10024707 3300031247 Bacteria 3050
179 Ga0265340_10025439 3300031247 Bacteria 2997
180 Ga0265340_10031050 3300031247 Unclassified 2674
181 Ga0265340_10065959 3300031247 Bacteria 1723
182 Ga0265339_10001804 3300031249 Bacteria 15711
183 Ga0265339_10009046 3300031249 Bacteria 6292
184 Ga0265339_10032841 3300031249 Unclassified 2926
185 Ga0265339_10135492 3300031249 Unclassified 1256
186 Ga0265331_10001577 3300031250 Bacteria 16669
187 Ga0265331_10023435 3300031250 Bacteria 3135
188 Ga0265331_10024378 3300031250 Bacteria 3061
189 Ga0265327_10000063 3300031251 Bacteria 232763
190 Ga0265327_10008548 3300031251 Bacteria 7602
191 Ga0265327_10024871 3300031251 Bacteria 3504
192 Ga0265327_10037891 3300031251 Bacteria 2635
193 Ga0265327_10076380 3300031251 Bacteria 1665
194 Ga0265316_10000109 3300031344 Bacteria 88245
195 Ga0265316_10000177 3300031344 Bacteria 72268
196 Ga0265316_10000788 3300031344 Bacteria 34909
197 Ga0265316_10000858 3300031344 Bacteria 33524
198 Ga0265316_10003398 3300031344 Bacteria 16107
199 Ga0265316_10007725 3300031344 Bacteria 10075
200 Ga0265316_10008002 3300031344 Bacteria 9871
201 Ga0265316_10008525 3300031344 Bacteria 9503
202 Ga0265316_10014026 3300031344 Bacteria 7079
203 Ga0265316_10016327 3300031344 Bacteria 6444
204 Ga0265316_10020820 3300031344 Bacteria 5570
205 Ga0265316_10025905 3300031344 Bacteria 4886
206 Ga0265316_10027606 3300031344 Bacteria 4696
207 Ga0265316_10045318 3300031344 Bacteria 3491
208 Ga0265316_10051086 3300031344 Bacteria 3249
209 Ga0265316_10069718 3300031344 Bacteria 2713
210 Ga0265316_10085074 3300031344 Unclassified 2420
211 Ga0265316_10128230 3300031344 Bacteria 1912
212 Ga0265316_10130408 3300031344 Bacteria 1894
213 Ga0265316_10136164 3300031344 Bacteria 1847
214 Ga0265316_10195304 3300031344 Bacteria 1502
215 Ga0265316_10236917 3300031344 Bacteria 1343
216 Ga0265316_10245591 3300031344 Bacteria 1315
217 Ga0265313_10004128 3300031595 Bacteria 11290
218 Ga0265313_10043186 3300031595 Bacteria 2208
219 Ga0265313_10102853 3300031595 Bacteria 1266
220 Ga0307508_10000229 3300031616 Bacteria 68303
221 Ga0316579_10014823 3300031691 Bacteria 3378
222 Ga0316579_10021940 3300031691 Unclassified 2851
223 Ga0316579_10052773 3300031691 Bacteria 1904
224 Ga0265314_10000210 3300031711 Bacteria 86377
225 Ga0265314_10000420 3300031711 Bacteria 57180
226 Ga0265314_10001393 3300031711 Bacteria 27094
227 Ga0265314_10003376 3300031711 Bacteria 15477
228 Ga0265314_10012535 3300031711 Bacteria 6908
229 Ga0265314_10030772 3300031711 Bacteria 3970
230 Ga0265314_10032695 3300031711 Unclassified 3823
231 Ga0265314_10042308 3300031711 Bacteria 3252
232 Ga0265314_10056511 3300031711 Unclassified 2701
233 Ga0265342_10002374 3300031712 Bacteria 16311
234 Ga0265342_10004606 3300031712 Bacteria 10757
235 Ga0265342_10013558 3300031712 Bacteria 5459
236 Ga0265342_10016847 3300031712 Bacteria 4764
237 Ga0265342_10037283 3300031712 Bacteria 2965
238 Ga0316576_10002173 3300031727 Bacteria 11065
239 Ga0316576_10018919 3300031727 Bacteria 4712
240 Ga0316576_10237749 3300031727 Unclassified 1369
241 Ga0316578_10008087 3300031728 Bacteria 5323
242 Ga0316578_10016295 3300031728 Bacteria 4019
243 Ga0316578_10017894 3300031728 Bacteria 3869
244 Ga0316578_10040901 3300031728 Bacteria 2683
245 Ga0316578_10114778 3300031728 Bacteria 1618
246 Ga0316577_10003049 3300031733 Bacteria 8405
247 Ga0316577_10006081 3300031733 Bacteria 6363
248 Ga0316577_10014512 3300031733 Unclassified 4325
249 Ga0316577_10024013 3300031733 Unclassified 3387
250 Ga0316585_10000100 3300032137 Bacteria 15598
251 Ga0316585_10002703 3300032137 Unclassified 4814
252 Ga0316585_10043718 3300032137 Bacteria 1431
253 Ga0316585_10050091 3300032137 Bacteria 1340
254 Ga0316593_10004771 3300032168 Bacteria 3515
255 Ga0316593_10029599 3300032168 Unclassified 1772
256 Ga0316592_1001836 3300033524 Bacteria 3546
257 Ga0316592_1008984 3300033524 Unclassified 1991
258 Ga0316596_1039706 3300033541 Unclassified 1235
259 Ga0373938_0003918 3300034957 Bacteria 2462
260 Ga0373928_0000080 3300035084 Bacteria 16471
261 Ga0373929_0000250 3300035085 Bacteria 9928
262 Ga0373944_0001761 3300035089 Bacteria 5469
263 Ga0373949_0000873 3300035090 Bacteria 9519
264 Ga0373951_0001272 3300035091 Bacteria 6683
265 Ga0373932_0000001 3300035112 Bacteria 1459067
266 Ga0373953_0089300 3300035117 Unclassified 1288
267 Ga0373956_0050060 3300035119 Unclassified 1875
268 Ga0373943_0051091 3300035170 Bacteria 2034
269 Ga0373946_0058385 3300035171 Bacteria 1634
270 Ga0373962_0000032 3300035242 Bacteria 35295
271 Ga0316574_0000861 3300035398 Bacteria 13357
272 Ga0316574_0019637 3300035398 Bacteria 3990
273 Ga0316574_0021676 3300035398 Unclassified 3818
274 Ga0316574_0023451 3300035398 Unclassified 3683
275 Ga0316574_0050023 3300035398 Bacteria 2600
276 Ga0316574_0080071 3300035398 Unclassified 2073
277 Ga0316574_0262465 3300035398 Bacteria 1102
278 Ga0373931_0000008 3300035691 Bacteria 362269
279 Ga0373935_0009016 3300035692 Bacteria 5968
280 Ga0373935_0013423 3300035692 Unclassified 4941
281 Ga0373927_0067480 3300035695 Bacteria 2314
282 Ga0316582_0000303 3300036647 Bacteria 17098
283 Ga0316582_0031200 3300036647 Unclassified 3255
284 Ga0316582_0073330 3300036647 Unclassified 2221
285 Ga0316582_0093359 3300036647 Bacteria 1984
286 Ga0316582_0164356 3300036647 Bacteria 1504
287 Ga0316584_0000743 3300036712 Bacteria 18138
288 Ga0316584_0001906 3300036712 Bacteria 12973
289 Ga0316584_0013419 3300036712 Bacteria 5798
290 Ga0316584_0062582 3300036712 Bacteria 2787
291 Ga0316584_0264104 3300036712 Unclassified 1254
292 Ga0373925_0023775 3300037068 Bacteria 4470
293 Ga0373925_0039588 3300037068 Bacteria 3487
294 Ga0316581_0035866 3300037588 Unclassified 1504
295 Ga0436364_0710990 3300037853 Bacteria 5487
296 Ga0400483_076291 3300039062 Bacteria 2557
297 Ga0400483_275118 3300039062 Bacteria 1218
298 Ga0436365_1682458 3300039437 Bacteria 36201
299 Ga0451853_1137929 3300041512 Unclassified 1291
300 Ga0451577_0000048 3300042876 Bacteria 309377
301 Ga0451577_0001478 3300042876 Bacteria 31145
302 Ga0451577_0003005 3300042876 Bacteria 19218
303 Ga0451577_0005102 3300042876 Bacteria 13535
304 Ga0451577_0015615 3300042876 Bacteria 7056
305 Ga0451577_0020608 3300042876 Bacteria 6047
306 Ga0451577_0025483 3300042876 Bacteria 5365
307 Ga0451577_0027137 3300042876 Bacteria 5183
308 Ga0451577_0031457 3300042876 Bacteria 4788
309 Ga0451577_0112716 3300042876 Unclassified 2434
310 Ga0451577_0170492 3300042876 Bacteria 1961
311 Ga0453683_0000055 3300044673 Bacteria 192588
312 Ga0453683_0000106 3300044673 Bacteria 124433
313 Ga0453683_0000214 3300044673 Bacteria 77233
314 Ga0453683_0001627 3300044673 Bacteria 18859
315 Ga0453683_0015709 3300044673 Bacteria 4897
316 Ga0453683_0016524 3300044673 Bacteria 4760
317 Ga0453683_0045161 3300044673 Bacteria 2763
318 Ga0453684_0000044 3300044712 Bacteria 585643
319 Ga0453684_0000161 3300044712 Bacteria 298175
320 Ga0453684_0000570 3300044712 Bacteria 137760
321 Ga0453684_0000766 3300044712 Bacteria 111429
322 Ga0453684_0000995 3300044712 Bacteria 92458
323 Ga0453684_0001129 3300044712 Bacteria 83588
324 Ga0453684_0001311 3300044712 Bacteria 73522
325 Ga0453684_0002142 3300044712 Bacteria 49500
326 Ga0453684_0002794 3300044712 Bacteria 41282
327 Ga0453684_0003209 3300044712 Bacteria 37487
328 Ga0453684_0004964 3300044712 Bacteria 27076
329 Ga0453684_0008244 3300044712 Bacteria 18782
330 Ga0453684_0009650 3300044712 Bacteria 16819
331 Ga0453684_0016658 3300044712 Bacteria 11468
332 Ga0453684_0032935 3300044712 Bacteria 7236
333 Ga0453684_0036777 3300044712 Bacteria 6739
334 Ga0453684_0045479 3300044712 Bacteria 5855
335 Ga0453684_0047416 3300044712 Bacteria 5699
336 Ga0453684_0051869 3300044712 Bacteria 5370
337 Ga0453684_0062285 3300044712 Bacteria 4779
338 Ga0453684_0086994 3300044712 Bacteria 3875
339 Ga0453684_0087913 3300044712 Bacteria 3849
340 Ga0453684_0106385 3300044712 Unclassified 3419
341 Ga0453684_0143299 3300044712 Bacteria 2849
342 Ga0453684_0153734 3300044712 Unclassified 2731
343 Ga0453684_0188099 3300044712 Bacteria 2417
344 Ga0453684_0284322 3300044712 Unclassified 1885
345 Ga0453684_0434838 3300044712 Bacteria 1463
346 Ga0453684_0460613 3300044712 Bacteria 1414
347 Ga0453684_0570372 3300044712 Bacteria 1244
348 Ga0451576_0000009 3300045051 Bacteria 712666
349 Ga0451576_0000059 3300045051 Bacteria 296795
350 Ga0451576_0000095 3300045051 Bacteria 223485
351 Ga0451576_0000293 3300045051 Bacteria 122443
352 Ga0451576_0004689 3300045051 Bacteria 17583
353 Ga0451576_0009365 3300045051 Bacteria 11359
354 Ga0451576_0015290 3300045051 Bacteria 8508
355 Ga0451576_0038728 3300045051 Bacteria 5046
356 Ga0451576_0050062 3300045051 Unclassified 4383
357 Ga0451576_0115081 3300045051 Bacteria 2800
358 Ga0451576_0144992 3300045051 Bacteria 2476
359 Ga0451576_0153452 3300045051 Bacteria 2402
360 Ga0451576_0185370 3300045051 Bacteria 2173
361 Ga0451576_0188102 3300045051 Unclassified 2156
362 Ga0451576_0226311 3300045051 Unclassified 1953
363 Ga0451576_0402959 3300045051 Bacteria 1434
364 Ga0451576_0453407 3300045051 Bacteria 1346
365 Ga0495592_0123009 3300046454 Bacteria 1823
366 Ga0495629_0014793 3300046459 Bacteria 5613
367 Ga0495641_0059309 3300046461 Bacteria 1730
368 Ga0495582_0011189 3300046473 Bacteria 4942
369 Ga0495582_0118158 3300046473 Bacteria 1492
370 Ga0495662_0014177 3300046476 Bacteria 3879
371 Ga0495618_0025835 3300046514 Unclassified 3647
372 Ga0495630_0000137 3300046517 Bacteria 57459
373 Ga0495630_0095668 3300046517 Bacteria 2246
374 Ga0495630_0117889 3300046517 Bacteria 2013
375 Ga0495630_0195599 3300046517 Bacteria 1543
376 Ga0495640_0031460 3300046533 Bacteria 3787
377 Ga0495640_0090869 3300046533 Bacteria 2015
378 Ga0495586_0008116 3300046535 Bacteria 5598
379 Ga0495667_0012306 3300046559 Bacteria 5800
380 Ga0495667_0070686 3300046559 Bacteria 2277
381 Ga0495667_0226036 3300046559 Bacteria 1194
382 Ga0495634_0012069 3300046642 Bacteria 6263
383 Ga0495634_0012736 3300046642 Bacteria 6088
384 Ga0495658_0006537 3300046683 Bacteria 5726
385 Ga0495658_0019921 3300046683 Bacteria 3509
386 Ga0495613_0000999 3300046689 Bacteria 21503
387 Ga0495613_0046519 3300046689 Bacteria 3209
388 Ga0495624_0102232 3300046690 Bacteria 1764
389 Ga0495581_0202720 3300047315 Bacteria 1160
390 Ga0495674_0012513 3300047319 Bacteria 7992
391 Ga0495674_0253939 3300047319 Bacteria 1446
392 Ga0495680_0047387 3300047322 Unclassified 3381
393 Ga0495675_0194507 3300047444 Bacteria 1237
394 Ga0496106_0250821 3300048909 Bacteria 1415
395 Ga0501031_0000871 3300049568 Bacteria 18183
396 Ga0501032_0007778 3300049569 Bacteria 7817
397 Ga0501032_0023386 3300049569 Bacteria 4271
398 Ga0501033_0002809 3300049570 Bacteria 14569
399 Ga0501033_0052568 3300049570 Bacteria 3019
400 Ga0501034_0001195 3300049571 Bacteria 35704
401 Ga0501034_0140773 3300049571 Bacteria 2392
402 Ga0501034_0344386 3300049571 Bacteria 1420
403 Ga0501037_0015482 3300049573 Bacteria 5613
404 Ga0501046_0285808 3300049580 Bacteria 1207
405 Ga0501070_0134617 3300049586 Bacteria 2041
406 Ga0501075_0048735 3300049591 Unclassified 3184
407 Ga0501080_0123501 3300049742 Bacteria 2398
408 Ga0501083_0136701 3300049744 Unclassified 1606
409 Ga0501035_0002284 3300049822 Bacteria 18951
410 Ga0501035_0010127 3300049822 Bacteria 8750
411 Ga0501035_0097629 3300049822 Bacteria 2580
412 Ga0501044_0000032 3300049823 Bacteria 169439
413 Ga0501044_0000926 3300049823 Bacteria 35271
414 Ga0501044_0005270 3300049823 Bacteria 14381
415 Ga0501044_0125071 3300049823 Bacteria 2569
416 Ga0501044_0288163 3300049823 Bacteria 1574
417 nmdc:mga05p37_24221_c1 3300050507 Bacteria 7376
418 nmdc:mga05p37_27702_c1 3300050507 Bacteria 6903
419 nmdc:mga05p37_299231_c1 3300050507 Bacteria 1912
420 nmdc:mga05p37_658_c1 3300050507 Bacteria 38217
421 nmdc:mga05p37_937_c1 3300050507 Bacteria 32838
422 nmdc:mga09592_2099_c1 3300050508 Bacteria 16089
423 nmdc:mga09592_291786_c1 3300050508 Unclassified 1414
424 nmdc:mga09592_319993_c1 3300050508 Bacteria 1344
425 nmdc:mga09592_93123_c1 3300050508 Bacteria 2576
426 nmdc:mga06r32_167960_c2 3300050510 Unclassified 1279
427 nmdc:mga08y16_15128_c1 3300050511 Bacteria 8110
428 nmdc:mga08y16_201756_c1 3300050511 Unclassified 2061
429 nmdc:mga0n895_614060_c1 3300050512 Bacteria 1089
430 nmdc:mga0a205_368840_c1 3300050515 Bacteria 1302
431 nmdc:mga0a205_8695_c1 3300050515 Bacteria 9246
432 Ga0495619_0243985 3300053085 Bacteria 1245

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300032168 Ga0316593_10029599 Ga0316593_100295992 322
2 3300014325 Ga0163163_10134708 Ga0163163_101347081 323
3 3300042876 Ga0451577_0001478 Ga0451577_0001478_16206_17180 323
4 3300042876 Ga0451577_0015615 Ga0451577_0015615_4844_5818 323
5 3300042876 Ga0451577_0020608 Ga0451577_0020608_1682_2656 323
6 3300042876 Ga0451577_0025483 Ga0451577_0025483_2478_3452 323
7 3300042876 Ga0451577_0027137 Ga0451577_0027137_1815_2789 323
8 3300044673 Ga0453683_0000055 Ga0453683_0000055_39663_40637 323
9 3300044673 Ga0453683_0000214 Ga0453683_0000214_37140_38114 323
10 3300044712 Ga0453684_0000570 Ga0453684_0000570_31921_32895 323
11 3300044712 Ga0453684_0000766 Ga0453684_0000766_81253_82227 323
12 3300044712 Ga0453684_0000995 Ga0453684_0000995_25408_26382 323
13 3300044712 Ga0453684_0143299 Ga0453684_0143299_92_1066 323
14 3300045051 Ga0451576_0000095 Ga0451576_0000095_190593_191567 323
15 3300045051 Ga0451576_0004689 Ga0451576_0004689_7006_7980 323
16 3300046517 Ga0495630_0095668 Ga0495630_0095668_424_1440 323
17 3300005471 Ga0070698_100377504 Ga0070698_1003775042 325
18 3300009147 Ga0114129_10037295 Ga0114129_100372952 325
19 3300021384 Ga0213876_10002834 Ga0213876_100028346 325
20 3300028563 Ga0265319_1038353 Ga0265319_10383532 325
21 3300028800 Ga0265338_10233538 Ga0265338_102335382 325
22 3300031240 Ga0265320_10005261 Ga0265320_100052614 325
23 3300039437 Ga0436365_1682458 Ga0436365_1682458_13769_14749 325
24 3300042876 Ga0451577_0000048 Ga0451577_0000048_108593_109573 325
25 3300044673 Ga0453683_0001627 Ga0453683_0001627_5836_6816 325
26 3300044712 Ga0453684_0000161 Ga0453684_0000161_97391_98371 325
27 3300045051 Ga0451576_0000059 Ga0451576_0000059_199805_200785 325
28 3300009551 Ga0105238_10036513 Ga0105238_100365133 326
29 3300025924 Ga0207694_10094170 Ga0207694_100941702 326
30 3300005295 Ga0065707_10084102 Ga0065707_100841023 328
31 3300009094 Ga0111539_10020680 Ga0111539_100206807 328
32 3300027907 Ga0207428_10063599 Ga0207428_100635993 328
33 3300028558 Ga0265326_10000880 Ga0265326_100008806 328
34 3300028563 Ga0265319_1002075 Ga0265319_10020756 328
35 3300028653 Ga0265323_10002140 Ga0265323_100021402 328
36 3300028654 Ga0265322_10000346 Ga0265322_1000034612 328
37 3300028800 Ga0265338_10008480 Ga0265338_100084806 328
38 3300029957 Ga0265324_10013063 Ga0265324_100130633 328
39 3300031235 Ga0265330_10000367 Ga0265330_100003673 328
40 3300031238 Ga0265332_10001868 Ga0265332_100018685 328
41 3300031240 Ga0265320_10011023 Ga0265320_100110232 328
42 3300031242 Ga0265329_10000411 Ga0265329_1000041112 328
43 3300031247 Ga0265340_10031050 Ga0265340_100310502 328
44 3300031249 Ga0265339_10001804 Ga0265339_100018047 328
45 3300031250 Ga0265331_10001577 Ga0265331_100015776 328
46 3300031344 Ga0265316_10008002 Ga0265316_100080023 328
47 3300031711 Ga0265314_10001393 Ga0265314_1000139311 328
48 3300031712 Ga0265342_10004606 Ga0265342_100046065 328
49 3300050511 nmdc:mga08y16_15128_c1 nmdc:mga08y16_15128_c1_6057_7064 328
50 3300005577 Ga0068857_100015146 Ga0068857_1000151464 329
51 3300021388 Ga0213875_10016676 Ga0213875_100166763 329
52 3300026116 Ga0207674_10030834 Ga0207674_100308345 329
53 3300031728 Ga0316578_10040901 Ga0316578_100409011 329
54 3300035398 Ga0316574_0080071 Ga0316574_0080071_190_1236 329
55 3300037853 Ga0436364_0710990 Ga0436364_0710990_3201_4199 329
56 3300045051 Ga0451576_0153452 Ga0451576_0153452_982_2025 329
57 3300005471 Ga0070698_100134159 Ga0070698_1001341592 330
58 3300014326 Ga0157380_10391786 Ga0157380_103917862 330
59 3300031691 Ga0316579_10052773 Ga0316579_100527732 330
60 3300031728 Ga0316578_10017894 Ga0316578_100178942 330
61 3300036712 Ga0316584_0001906 Ga0316584_0001906_2495_3520 330
62 3300042876 Ga0451577_0170492 Ga0451577_0170492_227_1222 330
63 3300044673 Ga0453683_0045161 Ga0453683_0045161_593_1594 330
64 3300044712 Ga0453684_0003209 Ga0453684_0003209_6854_7849 330
65 3300046473 Ga0495582_0118158 Ga0495582_0118158_43_1068 330
66 3300049571 Ga0501034_0344386 Ga0501034_0344386_349_1398 330
67 3300049586 Ga0501070_0134617 Ga0501070_0134617_543_1592 330
68 3300049823 Ga0501044_0288163 Ga0501044_0288163_473_1522 330
69 3300005458 Ga0070681_10042617 Ga0070681_100426173 331
70 3300005563 Ga0068855_100351462 Ga0068855_1003514622 331
71 3300025912 Ga0207707_10047338 Ga0207707_100473382 331
72 3300025913 Ga0207695_10066572 Ga0207695_100665721 331
73 3300044712 Ga0453684_0460613 Ga0453684_0460613_137_1147 331
74 3300031344 Ga0265316_10020820 Ga0265316_100208203 332
75 3300042876 Ga0451577_0003005 Ga0451577_0003005_9711_10712 332
76 3300042876 Ga0451577_0031457 Ga0451577_0031457_946_1947 332
77 3300044673 Ga0453683_0000106 Ga0453683_0000106_8902_9903 332
78 3300044712 Ga0453684_0047416 Ga0453684_0047416_2702_3739 332
79 3300044712 Ga0453684_0062285 Ga0453684_0062285_78_1085 332
80 3300044712 Ga0453684_0106385 Ga0453684_0106385_1484_2485 332
81 3300044712 Ga0453684_0434838 Ga0453684_0434838_437_1438 332
82 3300044712 Ga0453684_0570372 Ga0453684_0570372_142_1173 332
83 3300045051 Ga0451576_0000293 Ga0451576_0000293_114192_115193 332
84 3300045051 Ga0451576_0009365 Ga0451576_0009365_6561_7598 332
85 3300046454 Ga0495592_0123009 Ga0495592_0123009_599_1747 332
86 3300046559 Ga0495667_0226036 Ga0495667_0226036_44_1087 332
87 3300047319 Ga0495674_0253939 Ga0495674_0253939_141_1289 332
88 3300047444 Ga0495675_0194507 Ga0495675_0194507_119_1222 332
89 3300005367 Ga0070667_100213123 Ga0070667_1002131231 333
90 3300005614 Ga0068856_100046768 Ga0068856_1000467682 333
91 3300026035 Ga0207703_10046332 Ga0207703_100463323 333
92 3300026078 Ga0207702_10010455 Ga0207702_100104552 333
93 3300031251 Ga0265327_10000063 Ga0265327_1000006314 333
94 3300031616 Ga0307508_10000229 Ga0307508_1000022927 333
95 3300035117 Ga0373953_0089300 Ga0373953_0089300_189_1232 333
96 3300005330 Ga0070690_100091924 Ga0070690_1000919242 334
97 3300005985 Ga0081539_10018419 Ga0081539_100184195 334
98 3300005439 Ga0070711_100031157 Ga0070711_1000311572 335
99 3300005439 Ga0070711_100222743 Ga0070711_1002227432 335
100 3300006847 Ga0075431_100457452 Ga0075431_1004574522 335
101 3300009147 Ga0114129_10001578 Ga0114129_1000157814 335
102 3300025906 Ga0207699_10023688 Ga0207699_100236882 335
103 3300025915 Ga0207693_10005011 Ga0207693_100050117 335
104 3300025916 Ga0207663_10022859 Ga0207663_100228593 335
105 3300025928 Ga0207700_10042487 Ga0207700_100424872 335
106 3300025939 Ga0207665_10032373 Ga0207665_100323732 335
107 3300028558 Ga0265326_10041711 Ga0265326_100417111 335
108 3300031239 Ga0265328_10051734 Ga0265328_100517342 335
109 3300031242 Ga0265329_10018626 Ga0265329_100186262 335
110 3300031344 Ga0265316_10069718 Ga0265316_100697183 335
111 3300031344 Ga0265316_10245591 Ga0265316_102455911 335
112 3300044712 Ga0453684_0086994 Ga0453684_0086994_466_1473 335
113 3300050507 nmdc:mga05p37_658_c1 nmdc:mga05p37_658_c1_14702_15709 335
114 3300050508 nmdc:mga09592_291786_c1 nmdc:mga09592_291786_c1_393_1400 335
115 3300050510 nmdc:mga06r32_167960_c2 nmdc:mga06r32_167960_c2_199_1206 335
116 3300028800 Ga0265338_10002193 Ga0265338_1000219312 336
117 3300031249 Ga0265339_10032841 Ga0265339_100328412 336
118 3300031344 Ga0265316_10000858 Ga0265316_1000085814 336
119 3300031711 Ga0265314_10032695 Ga0265314_100326952 336
120 3300035692 Ga0373935_0013423 Ga0373935_0013423_1052_2062 336
121 3300037068 Ga0373925_0039588 Ga0373925_0039588_459_1469 336
122 3300046517 Ga0495630_0117889 Ga0495630_0117889_973_1983 336
123 3300046533 Ga0495640_0090869 Ga0495640_0090869_903_1913 336
124 3300046559 Ga0495667_0012306 Ga0495667_0012306_4358_5368 336
125 3300053085 Ga0495619_0243985 Ga0495619_0243985_36_1046 336
126 3300028577 Ga0265318_10013592 Ga0265318_100135924 337
127 3300031240 Ga0265320_10063793 Ga0265320_100637932 337
128 3300005468 Ga0070707_100010237 Ga0070707_1000102376 338
129 3300025922 Ga0207646_10009506 Ga0207646_100095062 338
130 3300035398 Ga0316574_0262465 Ga0316574_0262465_20_1036 338
131 3300005843 Ga0068860_100224129 Ga0068860_1002241292 339
132 3300013306 Ga0163162_10097526 Ga0163162_100975262 339
133 3300026035 Ga0207703_10109496 Ga0207703_101094962 339
134 3300031711 Ga0265314_10042308 Ga0265314_100423083 339
135 3300033541 Ga0316596_1039706 Ga0316596_10397061 339
136 3300045051 Ga0451576_0000009 Ga0451576_0000009_288038_289081 339
137 3300005295 Ga0065707_10012578 Ga0065707_100125784 340
138 3300006844 Ga0075428_100130479 Ga0075428_1001304794 340
139 3300006852 Ga0075433_10363607 Ga0075433_103636072 340
140 3300009094 Ga0111539_10731893 Ga0111539_107318931 340
141 3300009147 Ga0114129_10055896 Ga0114129_100558962 340
142 3300009147 Ga0114129_10418835 Ga0114129_104188351 340
143 3300031251 Ga0265327_10024871 Ga0265327_100248713 340
144 3300050507 nmdc:mga05p37_24221_c1 nmdc:mga05p37_24221_c1_6066_7088 340
145 3300050508 nmdc:mga09592_319993_c1 nmdc:mga09592_319993_c1_18_1040 340
146 3300050515 nmdc:mga0a205_368840_c1 nmdc:mga0a205_368840_c1_108_1130 340
147 3300005338 Ga0068868_100297391 Ga0068868_1002973912 342
148 3300005843 Ga0068860_100532106 Ga0068860_1005321061 342
149 3300007788 Ga0099795_10039401 Ga0099795_100394012 342
150 3300013306 Ga0163162_10126173 Ga0163162_101261732 342
151 3300027512 Ga0209179_1000700 Ga0209179_10007003 342
152 3300028381 Ga0268264_10410281 Ga0268264_104102812 342
153 3300028653 Ga0265323_10001533 Ga0265323_100015334 342
154 3300028653 Ga0265323_10004584 Ga0265323_100045842 342
155 3300028653 Ga0265323_10015233 Ga0265323_100152332 342
156 3300028653 Ga0265323_10031553 Ga0265323_100315532 342
157 3300028654 Ga0265322_10000892 Ga0265322_100008924 342
158 3300031344 Ga0265316_10003398 Ga0265316_1000339810 342
159 3300031344 Ga0265316_10051086 Ga0265316_100510862 342
160 3300045051 Ga0451576_0015290 Ga0451576_0015290_3520_4560 342
161 3300049571 Ga0501034_0001195 Ga0501034_0001195_2119_3165 342
162 3300049571 Ga0501034_0140773 Ga0501034_0140773_252_1289 342
163 3300049573 Ga0501037_0015482 Ga0501037_0015482_2637_3674 342
164 3300049742 Ga0501080_0123501 Ga0501080_0123501_776_1813 342
165 3300049744 Ga0501083_0136701 Ga0501083_0136701_398_1444 342
166 3300049823 Ga0501044_0000926 Ga0501044_0000926_8317_9354 342
167 3300049823 Ga0501044_0005270 Ga0501044_0005270_9504_10550 342
168 3300031235 Ga0265330_10002086 Ga0265330_100020868 343
169 3300031247 Ga0265340_10000538 Ga0265340_1000053818 343
170 3300031344 Ga0265316_10000177 Ga0265316_100001779 343
171 3300031344 Ga0265316_10025905 Ga0265316_100259053 343
172 3300031344 Ga0265316_10085074 Ga0265316_100850743 343
173 3300031711 Ga0265314_10056511 Ga0265314_100565112 343
174 3300031712 Ga0265342_10002374 Ga0265342_100023744 343
175 3300039062 Ga0400483_275118 Ga0400483_275118_123_1157 343
176 3300029957 Ga0265324_10057270 Ga0265324_100572702 344
177 3300031235 Ga0265330_10096638 Ga0265330_100966381 344
178 3300031239 Ga0265328_10058292 Ga0265328_100582922 344
179 3300031240 Ga0265320_10004485 Ga0265320_100044852 344
180 3300031242 Ga0265329_10024727 Ga0265329_100247272 344
181 3300031247 Ga0265340_10014202 Ga0265340_100142024 344
182 3300031250 Ga0265331_10023435 Ga0265331_100234352 344
183 3300031344 Ga0265316_10000788 Ga0265316_100007883 344
184 3300031344 Ga0265316_10136164 Ga0265316_101361642 344
185 3300031711 Ga0265314_10003376 Ga0265314_100033764 344
186 3300039062 Ga0400483_076291 Ga0400483_076291_447_1508 344
187 3300046533 Ga0495640_0031460 Ga0495640_0031460_222_1262 344
188 3300046690 Ga0495624_0102232 Ga0495624_0102232_301_1341 344
189 3300047315 Ga0495581_0202720 Ga0495581_0202720_79_1119 344
190 3300005467 Ga0070706_100006177 Ga0070706_1000061774 345
191 3300005937 Ga0081455_10002687 Ga0081455_1000268710 345
192 3300006028 Ga0070717_10112545 Ga0070717_101125452 345
193 3300009093 Ga0105240_10001651 Ga0105240_1000165137 345
194 3300025910 Ga0207684_10020434 Ga0207684_100204342 345
195 3300025928 Ga0207700_10049040 Ga0207700_100490401 345
196 3300028556 Ga0265337_1002800 Ga0265337_10028008 345
197 3300028577 Ga0265318_10009517 Ga0265318_100095173 345
198 3300028653 Ga0265323_10000081 Ga0265323_100000819 345
199 3300028653 Ga0265323_10006353 Ga0265323_100063534 345
200 3300028653 Ga0265323_10020922 Ga0265323_100209223 345
201 3300028666 Ga0265336_10018127 Ga0265336_100181272 345
202 3300028800 Ga0265338_10000458 Ga0265338_1000045866 345
203 3300028800 Ga0265338_10001807 Ga0265338_100018077 345
204 3300028800 Ga0265338_10001870 Ga0265338_100018709 345
205 3300028800 Ga0265338_10001988 Ga0265338_100019886 345
206 3300028800 Ga0265338_10005663 Ga0265338_100056637 345
207 3300028800 Ga0265338_10014155 Ga0265338_100141554 345
208 3300028800 Ga0265338_10131739 Ga0265338_101317392 345
209 3300028800 Ga0265338_10139031 Ga0265338_101390312 345
210 3300029957 Ga0265324_10010211 Ga0265324_100102112 345
211 3300031239 Ga0265328_10062775 Ga0265328_100627751 345
212 3300031240 Ga0265320_10000471 Ga0265320_1000047120 345
213 3300031240 Ga0265320_10011822 Ga0265320_100118222 345
214 3300031240 Ga0265320_10013822 Ga0265320_100138221 345
215 3300031240 Ga0265320_10060753 Ga0265320_100607532 345
216 3300031240 Ga0265320_10110170 Ga0265320_101101702 345
217 3300031241 Ga0265325_10010256 Ga0265325_100102562 345
218 3300031241 Ga0265325_10019920 Ga0265325_100199204 345
219 3300031241 Ga0265325_10084932 Ga0265325_100849322 345
220 3300031242 Ga0265329_10002817 Ga0265329_100028176 345
221 3300031247 Ga0265340_10000342 Ga0265340_100003427 345
222 3300031247 Ga0265340_10024707 Ga0265340_100247071 345
223 3300031249 Ga0265339_10009046 Ga0265339_100090464 345
224 3300031250 Ga0265331_10024378 Ga0265331_100243782 345
225 3300031344 Ga0265316_10000109 Ga0265316_1000010924 345
226 3300031344 Ga0265316_10007725 Ga0265316_100077252 345
227 3300031344 Ga0265316_10014026 Ga0265316_100140264 345
228 3300031344 Ga0265316_10045318 Ga0265316_100453184 345
229 3300031344 Ga0265316_10128230 Ga0265316_101282302 345
230 3300031344 Ga0265316_10130408 Ga0265316_101304081 345
231 3300031344 Ga0265316_10195304 Ga0265316_101953041 345
232 3300031595 Ga0265313_10004128 Ga0265313_100041285 345
233 3300031595 Ga0265313_10043186 Ga0265313_100431862 345
234 3300031711 Ga0265314_10000210 Ga0265314_1000021032 345
235 3300031711 Ga0265314_10012535 Ga0265314_100125354 345
236 3300031712 Ga0265342_10016847 Ga0265342_100168472 345
237 3300031712 Ga0265342_10037283 Ga0265342_100372832 345
238 3300035119 Ga0373956_0050060 Ga0373956_0050060_763_1806 345
239 3300035170 Ga0373943_0051091 Ga0373943_0051091_112_1155 345
240 3300041512 Ga0451853_1137929 Ga0451853_1137929_26_1069 345
241 3300042876 Ga0451577_0112716 Ga0451577_0112716_1190_2233 345
242 3300044673 Ga0453683_0016524 Ga0453683_0016524_2656_3705 345
243 3300044712 Ga0453684_0002794 Ga0453684_0002794_16116_17159 345
244 3300044712 Ga0453684_0009650 Ga0453684_0009650_10009_11085 345
245 3300044712 Ga0453684_0032935 Ga0453684_0032935_2274_3317 345
246 3300044712 Ga0453684_0036777 Ga0453684_0036777_3305_4354 345
247 3300044712 Ga0453684_0051869 Ga0453684_0051869_976_2025 345
248 3300044712 Ga0453684_0087913 Ga0453684_0087913_2753_3799 345
249 3300045051 Ga0451576_0226311 Ga0451576_0226311_595_1644 345
250 3300046459 Ga0495629_0014793 Ga0495629_0014793_4297_5340 345
251 3300046514 Ga0495618_0025835 Ga0495618_0025835_900_1943 345
252 3300046517 Ga0495630_0195599 Ga0495630_0195599_46_1089 345
253 3300046535 Ga0495586_0008116 Ga0495586_0008116_3808_4851 345
254 3300046559 Ga0495667_0070686 Ga0495667_0070686_612_1655 345
255 3300046642 Ga0495634_0012736 Ga0495634_0012736_749_1792 345
256 3300046689 Ga0495613_0000999 Ga0495613_0000999_18662_19705 345
257 3300047322 Ga0495680_0047387 Ga0495680_0047387_2307_3350 345
258 iso_pu_bacteria 2920107658 2920113410 345
259 3300005439 Ga0070711_100008491 Ga0070711_1000084915 346
260 3300005444 Ga0070694_100197916 Ga0070694_1001979162 346
261 3300005614 Ga0068856_100165552 Ga0068856_1001655521 346
262 3300006028 Ga0070717_10059135 Ga0070717_100591353 346
263 3300007788 Ga0099795_10097200 Ga0099795_100972001 346
264 3300009093 Ga0105240_10009028 Ga0105240_100090289 346
265 3300009094 Ga0111539_10012394 Ga0111539_100123949 346
266 3300009551 Ga0105238_10011149 Ga0105238_100111496 346
267 3300010159 Ga0099796_10031476 Ga0099796_100314761 346
268 3300025913 Ga0207695_10210238 Ga0207695_102102382 346
269 3300025916 Ga0207663_10022551 Ga0207663_100225513 346
270 3300025924 Ga0207694_10013591 Ga0207694_100135914 346
271 3300025928 Ga0207700_10172574 Ga0207700_101725741 346
272 3300026078 Ga0207702_10088676 Ga0207702_100886762 346
273 3300028556 Ga0265337_1011791 Ga0265337_10117912 346
274 3300028653 Ga0265323_10000489 Ga0265323_1000048914 346
275 3300028666 Ga0265336_10003863 Ga0265336_100038634 346
276 3300028800 Ga0265338_10000593 Ga0265338_1000059314 346
277 3300028800 Ga0265338_10000942 Ga0265338_1000094217 346
278 3300028800 Ga0265338_10001055 Ga0265338_1000105524 346
279 3300028800 Ga0265338_10146292 Ga0265338_101462922 346
280 3300031235 Ga0265330_10026549 Ga0265330_100265491 346
281 3300031240 Ga0265320_10003990 Ga0265320_100039902 346
282 3300031344 Ga0265316_10008525 Ga0265316_100085256 346
283 3300031344 Ga0265316_10016327 Ga0265316_100163272 346
284 3300031344 Ga0265316_10027606 Ga0265316_100276062 346
285 3300044712 Ga0453684_0001311 Ga0453684_0001311_16882_17928 346
286 3300044712 Ga0453684_0002142 Ga0453684_0002142_6468_7514 346
287 3300045051 Ga0451576_0038728 Ga0451576_0038728_3879_4931 346
288 3300045051 Ga0451576_0188102 Ga0451576_0188102_385_1602 346
289 3300046683 Ga0495658_0006537 Ga0495658_0006537_2563_3609 346
290 3300050511 nmdc:mga08y16_201756_c1 nmdc:mga08y16_201756_c1_982_2025 346
291 3300005341 Ga0070691_10025040 Ga0070691_100250403 347
292 3300005563 Ga0068855_100041835 Ga0068855_1000418354 347
293 3300005614 Ga0068856_100000760 Ga0068856_10000076024 347
294 3300007265 Ga0099794_10000967 Ga0099794_100009671 347
295 3300009551 Ga0105238_10004756 Ga0105238_1000475614 347
296 3300009551 Ga0105238_10319077 Ga0105238_103190772 347
297 3300013307 Ga0157372_10176715 Ga0157372_101767152 347
298 3300025924 Ga0207694_10055776 Ga0207694_100557763 347
299 3300025924 Ga0207694_10213643 Ga0207694_102136432 347
300 3300025949 Ga0207667_10145964 Ga0207667_101459643 347
301 3300026078 Ga0207702_10000506 Ga0207702_1000050630 347
302 3300028556 Ga0265337_1000257 Ga0265337_10002578 347
303 3300028556 Ga0265337_1007053 Ga0265337_10070533 347
304 3300028556 Ga0265337_1026918 Ga0265337_10269182 347
305 3300028556 Ga0265337_1027725 Ga0265337_10277252 347
306 3300028558 Ga0265326_10029018 Ga0265326_100290182 347
307 3300028563 Ga0265319_1000019 Ga0265319_100001925 347
308 3300028800 Ga0265338_10001593 Ga0265338_1000159320 347
309 3300028800 Ga0265338_10023411 Ga0265338_100234111 347
310 3300028800 Ga0265338_10043311 Ga0265338_100433112 347
311 3300028800 Ga0265338_10168734 Ga0265338_101687342 347
312 3300029957 Ga0265324_10000568 Ga0265324_1000056826 347
313 3300029957 Ga0265324_10007982 Ga0265324_100079823 347
314 3300029957 Ga0265324_10008527 Ga0265324_100085272 347
315 3300029957 Ga0265324_10008796 Ga0265324_100087964 347
316 3300029957 Ga0265324_10034983 Ga0265324_100349832 347
317 3300031240 Ga0265320_10052605 Ga0265320_100526052 347
318 3300031241 Ga0265325_10025351 Ga0265325_100253513 347
319 3300031247 Ga0265340_10025439 Ga0265340_100254393 347
320 3300031247 Ga0265340_10065959 Ga0265340_100659592 347
321 3300031249 Ga0265339_10135492 Ga0265339_101354921 347
322 3300031251 Ga0265327_10008548 Ga0265327_100085483 347
323 3300031251 Ga0265327_10037891 Ga0265327_100378912 347
324 3300031251 Ga0265327_10076380 Ga0265327_100763802 347
325 3300031344 Ga0265316_10236917 Ga0265316_102369172 347
326 3300031595 Ga0265313_10102853 Ga0265313_101028532 347
327 3300031691 Ga0316579_10014823 Ga0316579_100148234 347
328 3300031691 Ga0316579_10021940 Ga0316579_100219402 347
329 3300031711 Ga0265314_10000420 Ga0265314_1000042041 347
330 3300031711 Ga0265314_10030772 Ga0265314_100307725 347
331 3300031712 Ga0265342_10013558 Ga0265342_100135583 347
332 3300031727 Ga0316576_10002173 Ga0316576_100021736 347
333 3300031727 Ga0316576_10018919 Ga0316576_100189194 347
334 3300031727 Ga0316576_10237749 Ga0316576_102377491 347
335 3300031728 Ga0316578_10008087 Ga0316578_100080876 347
336 3300031728 Ga0316578_10114778 Ga0316578_101147781 347
337 3300031733 Ga0316577_10003049 Ga0316577_100030494 347
338 3300031733 Ga0316577_10006081 Ga0316577_100060816 347
339 3300031733 Ga0316577_10014512 Ga0316577_100145123 347
340 3300031733 Ga0316577_10024013 Ga0316577_100240131 347
341 3300032137 Ga0316585_10000100 Ga0316585_100001009 347
342 3300032137 Ga0316585_10002703 Ga0316585_100027032 347
343 3300032137 Ga0316585_10043718 Ga0316585_100437181 347
344 3300032137 Ga0316585_10050091 Ga0316585_100500911 347
345 3300032168 Ga0316593_10004771 Ga0316593_100047714 347
346 3300033524 Ga0316592_1001836 Ga0316592_10018362 347
347 3300033524 Ga0316592_1008984 Ga0316592_10089842 347
348 3300034957 Ga0373938_0003918 Ga0373938_0003918_716_1765 347
349 3300035084 Ga0373928_0000080 Ga0373928_0000080_1806_2855 347
350 3300035085 Ga0373929_0000250 Ga0373929_0000250_7400_8449 347
351 3300035089 Ga0373944_0001761 Ga0373944_0001761_1495_2544 347
352 3300035090 Ga0373949_0000873 Ga0373949_0000873_877_1926 347
353 3300035091 Ga0373951_0001272 Ga0373951_0001272_4994_6043 347
354 3300035112 Ga0373932_0000001 Ga0373932_0000001_780574_781623 347
355 3300035171 Ga0373946_0058385 Ga0373946_0058385_308_1357 347
356 3300035242 Ga0373962_0000032 Ga0373962_0000032_28140_29189 347
357 3300035398 Ga0316574_0000861 Ga0316574_0000861_4488_5534 347
358 3300035398 Ga0316574_0019637 Ga0316574_0019637_1975_3021 347
359 3300035398 Ga0316574_0021676 Ga0316574_0021676_785_1831 347
360 3300035398 Ga0316574_0023451 Ga0316574_0023451_294_1340 347
361 3300035398 Ga0316574_0050023 Ga0316574_0050023_961_2007 347
362 3300035691 Ga0373931_0000008 Ga0373931_0000008_247148_248197 347
363 3300035692 Ga0373935_0009016 Ga0373935_0009016_1495_2544 347
364 3300035695 Ga0373927_0067480 Ga0373927_0067480_846_1895 347
365 3300036647 Ga0316582_0000303 Ga0316582_0000303_5584_6630 347
366 3300036647 Ga0316582_0031200 Ga0316582_0031200_1258_2325 347
367 3300036647 Ga0316582_0073330 Ga0316582_0073330_138_1184 347
368 3300036647 Ga0316582_0093359 Ga0316582_0093359_818_1864 347
369 3300036647 Ga0316582_0164356 Ga0316582_0164356_137_1183 347
370 3300036712 Ga0316584_0000743 Ga0316584_0000743_5669_6715 347
371 3300036712 Ga0316584_0013419 Ga0316584_0013419_1381_2448 347
372 3300036712 Ga0316584_0264104 Ga0316584_0264104_178_1224 347
373 3300037068 Ga0373925_0023775 Ga0373925_0023775_492_1541 347
374 3300037588 Ga0316581_0035866 Ga0316581_0035866_42_1109 347
375 3300042876 Ga0451577_0005102 Ga0451577_0005102_2425_3474 347
376 3300044712 Ga0453684_0004964 Ga0453684_0004964_25179_26228 347
377 3300044712 Ga0453684_0188099 Ga0453684_0188099_310_1359 347
378 3300045051 Ga0451576_0115081 Ga0451576_0115081_1491_2540 347
379 3300045051 Ga0451576_0144992 Ga0451576_0144992_824_1873 347
380 3300045051 Ga0451576_0185370 Ga0451576_0185370_48_1094 347
381 3300045051 Ga0451576_0402959 Ga0451576_0402959_302_1351 347
382 3300046461 Ga0495641_0059309 Ga0495641_0059309_484_1557 347
383 3300046473 Ga0495582_0011189 Ga0495582_0011189_2964_4037 347
384 3300046476 Ga0495662_0014177 Ga0495662_0014177_232_1305 347
385 3300046517 Ga0495630_0000137 Ga0495630_0000137_29963_31036 347
386 3300046642 Ga0495634_0012069 Ga0495634_0012069_1454_2527 347
387 3300046683 Ga0495658_0019921 Ga0495658_0019921_1600_2673 347
388 3300046689 Ga0495613_0046519 Ga0495613_0046519_598_1671 347
389 3300047319 Ga0495674_0012513 Ga0495674_0012513_2858_3931 347
390 3300049568 Ga0501031_0000871 Ga0501031_0000871_12550_13599 347
391 3300049569 Ga0501032_0007778 Ga0501032_0007778_5861_6910 347
392 3300049569 Ga0501032_0023386 Ga0501032_0023386_1942_2991 347
393 3300049570 Ga0501033_0002809 Ga0501033_0002809_4640_5689 347
394 3300049570 Ga0501033_0052568 Ga0501033_0052568_1736_2785 347
395 3300049580 Ga0501046_0285808 Ga0501046_0285808_144_1193 347
396 3300049822 Ga0501035_0002284 Ga0501035_0002284_4575_5624 347
397 3300049822 Ga0501035_0010127 Ga0501035_0010127_3138_4187 347
398 3300049822 Ga0501035_0097629 Ga0501035_0097629_83_1132 347
399 3300049823 Ga0501044_0000032 Ga0501044_0000032_155816_156865 347
400 3300049823 Ga0501044_0125071 Ga0501044_0125071_1049_2098 347
401 3300031728 Ga0316578_10016295 Ga0316578_100162955 348
402 3300036712 Ga0316584_0062582 Ga0316584_0062582_39_1091 348
403 3300044712 Ga0453684_0000044 Ga0453684_0000044_67321_68373 348
404 3300044712 Ga0453684_0001129 Ga0453684_0001129_71716_72768 348
405 3300044712 Ga0453684_0008244 Ga0453684_0008244_14329_15384 348
406 3300044712 Ga0453684_0016658 Ga0453684_0016658_184_1251 348
407 3300044712 Ga0453684_0045479 Ga0453684_0045479_1250_2302 348
408 3300044712 Ga0453684_0153734 Ga0453684_0153734_103_1170 348
409 3300044712 Ga0453684_0284322 Ga0453684_0284322_640_1692 348
410 3300006847 Ga0075431_100256894 Ga0075431_1002568942 349
411 3300009147 Ga0114129_10001366 Ga0114129_1000136611 349
412 3300050507 nmdc:mga05p37_299231_c1 nmdc:mga05p37_299231_c1_91_1140 349
413 3300050507 nmdc:mga05p37_937_c1 nmdc:mga05p37_937_c1_20384_21433 349
414 3300050508 nmdc:mga09592_2099_c1 nmdc:mga09592_2099_c1_8540_9589 349
415 3300050508 nmdc:mga09592_93123_c1 nmdc:mga09592_93123_c1_674_1723 349
416 2162886007 SwRhRL2b_contig_3539642 SwRhRL2b_0440.00003180 350
417 3300005289 Ga0065704_10080389 Ga0065704_100803894 350
418 3300005295 Ga0065707_10005667 Ga0065707_100056673 350
419 3300005444 Ga0070694_100123587 Ga0070694_1001235872 350
420 3300005617 Ga0068859_100255163 Ga0068859_1002551632 350
421 3300006852 Ga0075433_10006667 Ga0075433_100066676 350
422 3300006871 Ga0075434_100025798 Ga0075434_1000257983 350
423 3300006931 Ga0097620_100255148 Ga0097620_1002551482 350
424 3300009147 Ga0114129_10016502 Ga0114129_100165029 350
425 3300009147 Ga0114129_10019549 Ga0114129_100195495 350
426 3300044673 Ga0453683_0015709 Ga0453683_0015709_1316_2368 350
427 3300045051 Ga0451576_0050062 Ga0451576_0050062_420_1472 350
428 3300045051 Ga0451576_0453407 Ga0451576_0453407_174_1226 350
429 3300048909 Ga0496106_0250821 Ga0496106_0250821_15_1067 350
430 3300049591 Ga0501075_0048735 Ga0501075_0048735_506_1558 350
431 3300050507 nmdc:mga05p37_27702_c1 nmdc:mga05p37_27702_c1_4578_5630 350
432 3300050512 nmdc:mga0n895_614060_c1 nmdc:mga0n895_614060_c1_22_1074 350
433 3300050515 nmdc:mga0a205_8695_c1 nmdc:mga0a205_8695_c1_3742_4794 350

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05368

NmrA

NmrA-like family

76

293

0.89

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

76

322

0.86

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

77

298

0.84

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

77

385

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c5e-assembly1.cif.gz_B gdp-mannose-3', 5' -epimerase (arabidopsis thaliana), k217a, with gdp-alpha-d-mannose bound in the active site. 0.9159 10 346
2c59-assembly1.cif.gz_B gdp-mannose-3', 5' -epimerase (arabidopsis thaliana), with gdp-alpha-d-mannose and gdp-beta-l-galactose bound in the active site. 0.9082 10 346
2c5a-assembly1.cif.gz_B gdp-mannose-3', 5' -epimerase (arabidopsis thaliana),y174f, with gdp-beta-l-galactose bound in the active site 0.9042 10 346
3vps-assembly2.cif.gz_B structure of a novel nad dependent-ndp-hexosamine 5,6-dehydratase, tuna, involved in tunicamycin biosynthesis 0.8965 19 333
2c54-assembly1.cif.gz_B gdp-mannose-3', 5' -epimerase (arabidopsis thaliana),k178r, with gdp-beta-l-gulose and gdp-4-keto-beta-l-gulose bound in active site. 0.8957 10 346
ID Description Score Start End Superfamily
2c54B02 Alpha Beta;Alpha-Beta Complex;UDP-galactose 4-epimerase; domain 1;UDP-galactose 4-epimerase, domain 1 0.9304 191 341 3.90.25.10
af_Q93VR3_28_320_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9255 19 315 3.40.50.720
2c59B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9221 19 190 3.40.50.720
af_Q93VR3_28_320_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9132 19 315 3.40.50.720
6iweA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8858 14 46 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A848X053-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9776 13 309
AF-D5H563-F1-model_v4 Nucleoside-diphosphate-sugar epimerase (EC 5.1.3.-) 0.9743 10 342 GO:0003978
GO:0006012
AF-A0A848X053-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9743 13 309
AF-A0A3N5UCA1-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9732 1 299 GO:0006012
GO:0016853
AF-A0A2V5T1R3-F1-model_v4 NAD-dependent dehydratase 0.9727 37 339 GO:0050577

Feature Viewer

pLDDT pTM Quality
89.68 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map