F442897

General Info

Members Datasets Scaffolds Average Seq Length
433 260 866 184

Family's Representative Sequence

Representative Sequence 3300041456|Ga0451795_0732834|Ga0451795_0732834_84_713
Length 209
Sequence MLAAGRKLKGPPARREGLYSKGSFKVADTVVGATPDPHASGDDPSRRDFIHIAAGAAAVGAVAALAWPLVDQMNPAGDTLALASIEFDISKVEEGGHVTIKWRGKPLFVRNRTPAEIAKAVADDNAPMKDPAKDADRTKPGKEQWLVLIGNCTHLGCVPTFGGGEYGGWFCPCHGSVYDTAGRIRKGPAPLNLVLPDYTFLTDTRVKIG

Samples

Sample ID Description Type Environment
1 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
2 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
3 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
18 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
23 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
29 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
30 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
31 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
32 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
33 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
34 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
35 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
36 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
37 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
38 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
39 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
54 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
58 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
59 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
64 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
65 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
66 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
67 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
68 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
70 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
71 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
105 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
106 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
108 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
109 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
114 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
115 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
118 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
119 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
120 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
123 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
124 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
125 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
126 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
127 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
128 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
129 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
130 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
131 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
132 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
133 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
134 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
135 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
136 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
137 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
138 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
139 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
143 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
144 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
145 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
146 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
147 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
151 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
154 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
155 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
160 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
175 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
176 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
177 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
198 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
199 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
200 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
201 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
210 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
211 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
212 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
213 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
214 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
215 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
216 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
217 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
218 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
219 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
220 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
221 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
222 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
223 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
226 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
227 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
228 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
229 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
230 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
231 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
232 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
233 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
234 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
235 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
236 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
237 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
238 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
239 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
240 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
241 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
242 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
243 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
244 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
245 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
246 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
247 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
254 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
255 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
256 2643221640 Caulobacter sp. Root342 Isolate Unclassified
257 2643221642 Caulobacter sp. Root343 Isolate Unclassified
258 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
259 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
260 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.77
Metatranscriptomes 1.39
Isolates 1.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 21.71
Nodule 0
Rhizoplane 4.62
Rhizosphere 67.67
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451795_0732834 3300041456 Bacteria 763
2 Ga0055526_1015036 3300003771 Bacteria 3134
3 Ga0055536_1033303 3300003781 Bacteria 1318
4 Ga0055536_1033325 3300003781 Bacteria 1318
5 Ga0055530_10033624 3300003791 Bacteria 1320
6 Ga0055531_10002770 3300003794 Bacteria 11506
7 Ga0055531_10005810 3300003794 Bacteria 7142
8 Ga0055531_10011741 3300003794 Bacteria 4188
9 Ga0065165_1001609 3300005262 Bacteria 23073
10 Ga0065165_1002441 3300005262 Bacteria 15728
11 Ga0070670_100000032 3300005331 Bacteria 158514
12 Ga0070670_100990716 3300005331 Bacteria 764
13 Ga0068869_100291962 3300005334 Bacteria 1314
14 Ga0070666_10223123 3300005335 Bacteria 1330
15 Ga0070680_100196759 3300005336 Bacteria 1699
16 Ga0070660_100371484 3300005339 Bacteria 1180
17 Ga0070660_101166634 3300005339 Bacteria 653
18 Ga0070668_100000975 3300005347 Bacteria 20042
19 Ga0070668_100001585 3300005347 Bacteria 16458
20 Ga0070668_100224856 3300005347 Bacteria 1549
21 Ga0070668_100493960 3300005347 Bacteria 1058
22 Ga0070669_100015826 3300005353 Bacteria 5378
23 Ga0070673_100197823 3300005364 Bacteria 1730
24 Ga0070659_100000638 3300005366 Bacteria 25690
25 Ga0070659_100634023 3300005366 Bacteria 920
26 Ga0070667_100000110 3300005367 Bacteria 105201
27 Ga0070667_100113693 3300005367 Bacteria 2350
28 Ga0070667_100173475 3300005367 Bacteria 1905
29 Ga0070663_100372828 3300005455 Bacteria 1161
30 Ga0070663_100506978 3300005455 Bacteria 1003
31 Ga0070678_100209573 3300005456 Bacteria 1614
32 Ga0070662_100085627 3300005457 Bacteria 2355
33 Ga0070681_10054201 3300005458 Bacteria 3995
34 Ga0070679_100454998 3300005530 Bacteria 1225
35 Ga0070679_100808433 3300005530 Bacteria 881
36 Ga0068853_100376152 3300005539 Bacteria 1326
37 Ga0068853_100691448 3300005539 Bacteria 972
38 Ga0068853_100779593 3300005539 Bacteria 915
39 Ga0068853_100854456 3300005539 Bacteria 873
40 Ga0070672_100857934 3300005543 Bacteria 801
41 Ga0070665_100001257 3300005548 Bacteria 30554
42 Ga0070665_100022111 3300005548 Bacteria 6397
43 Ga0070665_100035301 3300005548 Bacteria 5027
44 Ga0070665_100279574 3300005548 Bacteria 1671
45 Ga0070665_100697218 3300005548 Bacteria 1028
46 Ga0068855_100452614 3300005563 Bacteria 1400
47 Ga0068852_100761853 3300005616 Bacteria 980
48 Ga0068859_100007383 3300005617 Bacteria 11152
49 Ga0068864_100011767 3300005618 Bacteria 7227
50 Ga0068864_100215337 3300005618 Bacteria 1770
51 Ga0068861_100148859 3300005719 Bacteria 1919
52 Ga0068863_100001377 3300005841 Bacteria 24126
53 Ga0068863_100004617 3300005841 Bacteria 13569
54 Ga0068863_100154913 3300005841 Bacteria 2194
55 Ga0068858_100006036 3300005842 Bacteria 11808
56 Ga0068858_100018099 3300005842 Bacteria 6599
57 Ga0068860_100000100 3300005843 Bacteria 144580
58 Ga0068860_100000167 3300005843 Bacteria 108234
59 Ga0068860_100005700 3300005843 Bacteria 12574
60 Ga0068862_100008644 3300005844 Bacteria 8423
61 Ga0068862_100064945 3300005844 Bacteria 3143
62 Ga0068862_100154050 3300005844 Bacteria 2047
63 Ga0068862_100164431 3300005844 Bacteria 1983
64 Ga0075368_10001626 3300006042 Bacteria 7216
65 Ga0075363_100004231 3300006048 Bacteria 6237
66 Ga0075364_10001989 3300006051 Bacteria 11387
67 Ga0075362_10010235 3300006177 Bacteria 3656
68 Ga0075367_10004580 3300006178 Bacteria 6767
69 Ga0075369_10002683 3300006186 Bacteria 6377
70 Ga0075369_10088255 3300006186 Bacteria 1382
71 Ga0075366_10048926 3300006195 Bacteria 2508
72 Ga0075370_10024762 3300006353 Bacteria 3318
73 Ga0075370_10034535 3300006353 Bacteria 2834
74 Ga0068865_100145944 3300006881 Bacteria 1789
75 Ga0097620_100007383 3300006931 Bacteria 11152
76 Ga0105240_10717139 3300009093 Bacteria 1090
77 Ga0105240_10758214 3300009093 Bacteria 1055
78 Ga0105240_11106740 3300009093 Bacteria 843
79 Ga0105243_10480961 3300009148 Bacteria 1172
80 Ga0105241_10033781 3300009174 Bacteria 3841
81 Ga0105242_10258217 3300009176 Bacteria 1573
82 Ga0105248_10000280 3300009177 Bacteria 60247
83 Ga0105248_10004080 3300009177 Bacteria 16149
84 Ga0105248_10099751 3300009177 Bacteria 3272
85 Ga0105248_10213864 3300009177 Bacteria 2172
86 Ga0105248_10397238 3300009177 Bacteria 1552
87 Ga0105248_10785046 3300009177 Bacteria 1075
88 Ga0105238_10005585 3300009551 Bacteria 12425
89 Ga0105238_11562578 3300009551 Bacteria 689
90 Ga0105249_10110912 3300009553 Bacteria 2593
91 Ga0105249_10128030 3300009553 Bacteria 2420
92 Ga0105249_10434785 3300009553 Bacteria 1349
93 Ga0105249_11115083 3300009553 Bacteria 859
94 Ga0105239_10943103 3300010375 Bacteria 991
95 Ga0157373_10001320 3300013100 Bacteria 18973
96 Ga0157373_10003865 3300013100 Bacteria 11319
97 Ga0157374_10252720 3300013296 Bacteria 1735
98 Ga0163162_10202432 3300013306 Bacteria 2114
99 Ga0163162_10338914 3300013306 Bacteria 1636
100 Ga0157372_10095445 3300013307 Bacteria 3388
101 Ga0157375_10200219 3300013308 Bacteria 2153
102 Ga0163163_10005530 3300014325 Bacteria 10941
103 Ga0163163_10200461 3300014325 Bacteria 2044
104 Ga0163163_10425259 3300014325 Bacteria 1387
105 Ga0163163_10524636 3300014325 Bacteria 1247
106 Ga0163163_10855676 3300014325 Bacteria 973
107 Ga0157380_10428609 3300014326 Bacteria 1264
108 Ga0182008_10174088 3300014497 Bacteria 1087
109 Ga0157377_10412783 3300014745 Bacteria 922
110 Ga0157379_10002605 3300014968 Bacteria 15162
111 Ga0157379_10143052 3300014968 Bacteria 2156
112 Ga0157379_10575086 3300014968 Bacteria 1050
113 Ga0157376_10498400 3300014969 Bacteria 1196
114 Ga0157376_10830702 3300014969 Bacteria 938
115 Ga0213872_10099406 3300021361 Bacteria 1298
116 Ga0209673_1056497 3300025273 Bacteria 1004
117 Ga0209676_1000467 3300025292 Bacteria 67659
118 Ga0209676_1000560 3300025292 Bacteria 56233
119 Ga0209564_1006954 3300025295 Bacteria 5943
120 Ga0209564_1016749 3300025295 Bacteria 2897
121 Ga0209758_1000331 3300025297 Bacteria 88922
122 Ga0209758_1006870 3300025297 Bacteria 7953
123 Ga0209050_1000130 3300025298 Bacteria 186070
124 Ga0209050_1000461 3300025298 Bacteria 72912
125 Ga0209050_1002433 3300025298 Bacteria 15998
126 Ga0209256_1011761 3300025299 Bacteria 3450
127 Ga0209257_1000059 3300025304 Bacteria 378097
128 Ga0209257_1000186 3300025304 Bacteria 154365
129 Ga0209257_1000246 3300025304 Bacteria 125942
130 Ga0209257_1041999 3300025304 Bacteria 1353
131 Ga0207680_10043668 3300025903 Bacteria 2630
132 Ga0207680_10158597 3300025903 Bacteria 1515
133 Ga0207680_10409085 3300025903 Bacteria 960
134 Ga0207705_10164050 3300025909 Bacteria 1670
135 Ga0207707_10104942 3300025912 Bacteria 2470
136 Ga0207695_10011375 3300025913 Bacteria 10785
137 Ga0207671_10164618 3300025914 Bacteria 1719
138 Ga0207657_10248641 3300025919 Bacteria 1418
139 Ga0207657_10304122 3300025919 Bacteria 1263
140 Ga0207652_10286976 3300025921 Bacteria 1485
141 Ga0207681_10004224 3300025923 Bacteria 8870
142 Ga0207681_10599439 3300025923 Bacteria 910
143 Ga0207694_10018259 3300025924 Bacteria 5302
144 Ga0207650_10000074 3300025925 Bacteria 134837
145 Ga0207690_10001176 3300025932 Bacteria 16564
146 Ga0207690_10006522 3300025932 Bacteria 6918
147 Ga0207706_10037299 3300025933 Bacteria 4316
148 Ga0207686_10124175 3300025934 Bacteria 1762
149 Ga0207709_10302875 3300025935 Bacteria 1189
150 Ga0207704_10001590 3300025938 Bacteria 10203
151 Ga0207691_10324007 3300025940 Bacteria 1321
152 Ga0207711_10002580 3300025941 Bacteria 16123
153 Ga0207711_10007049 3300025941 Bacteria 9418
154 Ga0207711_10103543 3300025941 Bacteria 2521
155 Ga0207711_10194592 3300025941 Bacteria 1849
156 Ga0207711_10389345 3300025941 Bacteria 1294
157 Ga0207689_10146028 3300025942 Bacteria 1949
158 Ga0207689_10385537 3300025942 Bacteria 1167
159 Ga0207667_10200677 3300025949 Bacteria 2046
160 Ga0207667_10342851 3300025949 Bacteria 1525
161 Ga0207651_10191846 3300025960 Bacteria 1630
162 Ga0207712_10022074 3300025961 Bacteria 4187
163 Ga0207712_10222525 3300025961 Bacteria 1510
164 Ga0207712_10821790 3300025961 Bacteria 818
165 Ga0207668_10000001 3300025972 Bacteria 266091
166 Ga0207668_10000246 3300025972 Bacteria 36387
167 Ga0207668_10012632 3300025972 Bacteria 5176
168 Ga0207668_10026970 3300025972 Bacteria 3737
169 Ga0207668_10194164 3300025972 Bacteria 1611
170 Ga0207640_10318599 3300025981 Bacteria 1237
171 Ga0207658_10000275 3300025986 Bacteria 53906
172 Ga0207658_10021114 3300025986 Bacteria 4515
173 Ga0207658_10186740 3300025986 Bacteria 1720
174 Ga0207677_10048132 3300026023 Bacteria 2869
175 Ga0207703_10017891 3300026035 Bacteria 5535
176 Ga0207703_10087283 3300026035 Bacteria 2615
177 Ga0207703_10332342 3300026035 Bacteria 1394
178 Ga0207639_10035580 3300026041 Bacteria 3686
179 Ga0207639_10371256 3300026041 Bacteria 1282
180 Ga0207639_10546941 3300026041 Bacteria 1063
181 Ga0207639_11333102 3300026041 Bacteria 673
182 Ga0207678_10182131 3300026067 Bacteria 1794
183 Ga0207678_10620696 3300026067 Bacteria 948
184 Ga0207702_10420736 3300026078 Bacteria 1292
185 Ga0207641_10001197 3300026088 Bacteria 26009
186 Ga0207641_10001917 3300026088 Bacteria 19953
187 Ga0207641_10206230 3300026088 Bacteria 1815
188 Ga0207676_10001101 3300026095 Bacteria 20425
189 Ga0207676_10038117 3300026095 Bacteria 3666
190 Ga0207676_10218428 3300026095 Bacteria 1696
191 Ga0207676_10304475 3300026095 Bacteria 1456
192 Ga0207683_10303518 3300026121 Bacteria 1461
193 Ga0207698_10311749 3300026142 Bacteria 1470
194 Ga0209981_1001900 3300027378 Bacteria 2661
195 Ga0210000_1009380 3300027462 Bacteria 1440
196 Ga0209999_1013847 3300027543 Bacteria 1462
197 Ga0209983_1009648 3300027665 Bacteria 1973
198 Ga0209813_10003607 3300027866 Bacteria 3636
199 Ga0209974_10055580 3300027876 Bacteria 1335
200 Ga0268266_10000289 3300028379 Bacteria 82515
201 Ga0268266_10038244 3300028379 Bacteria 4086
202 Ga0268266_10050459 3300028379 Bacteria 3570
203 Ga0268266_10333001 3300028379 Bacteria 1423
204 Ga0268266_10636829 3300028379 Bacteria 1025
205 Ga0268265_10000648 3300028380 Bacteria 34549
206 Ga0268265_10002515 3300028380 Bacteria 13726
207 Ga0268265_10249151 3300028380 Bacteria 1572
208 Ga0268265_10455098 3300028380 Bacteria 1196
209 Ga0268265_10594659 3300028380 Bacteria 1056
210 Ga0268264_10000002 3300028381 Bacteria 1153045
211 Ga0268264_10000068 3300028381 Bacteria 275708
212 Ga0265337_1057301 3300028556 Bacteria 1085
213 Ga0307517_10002267 3300028786 Bacteria 31005
214 Ga0307517_10033152 3300028786 Bacteria 5946
215 Ga0307517_10129140 3300028786 Bacteria 1828
216 Ga0307517_10135723 3300028786 Bacteria 1750
217 Ga0307513_10000790 3300031456 Bacteria 45976
218 Ga0307513_10004139 3300031456 Bacteria 19425
219 Ga0307408_100392194 3300031548 Bacteria 1190
220 Ga0307508_10084960 3300031616 Bacteria 2748
221 Ga0265314_10122925 3300031711 Bacteria 1631
222 Ga0307416_100976121 3300032002 Bacteria 950
223 Ga0307510_10295732 3300033180 Bacteria 1083
224 Ga0373931_0492682 3300035691 Bacteria 789
225 Ga0395899_0000004 3300037312 Bacteria 874267
226 Ga0395900_0100671 3300037418 Bacteria 2968
227 Ga0395898_0393398 3300037466 Bacteria 1321
228 Ga0395905_0200192 3300037471 Bacteria 1872
229 Ga0395905_0280153 3300037471 Bacteria 1553
230 Ga0395905_0577875 3300037471 Bacteria 1025
231 Ga0395905_0659376 3300037471 Bacteria 948
232 Ga0395905_0969637 3300037471 Bacteria 753
233 Ga0395901_0217205 3300038443 Bacteria 1999
234 Ga0436361_1028263 3300039447 Bacteria 1110
235 Ga0436362_0745879 3300039453 Bacteria 815
236 Ga0451789_0893595 3300041443 Bacteria 1345
237 Ga0451837_0221795 3300041494 Bacteria 994
238 Ga0451853_4088132 3300041512 Bacteria 1230
239 Ga0439459_0009247 3300042438 Bacteria 1701
240 Ga0450916_010002 3300042530 Bacteria 1179
241 Ga0466965_0395547 3300044683 Bacteria 763
242 Ga0466961_0055258 3300044693 Bacteria 2532
243 Ga0466960_0223063 3300044901 Bacteria 1038
244 Ga0495627_008977 3300046453 Bacteria 3697
245 Ga0495629_0164616 3300046459 Bacteria 1540
246 Ga0495638_0004112 3300046460 Bacteria 11128
247 Ga0495638_0129778 3300046460 Bacteria 1482
248 Ga0495650_0000114 3300046471 Bacteria 192527
249 Ga0495582_0252298 3300046473 Bacteria 1012
250 Ga0495607_0010068 3300046501 Bacteria 6367
251 Ga0495583_0000013 3300046506 Bacteria 323372
252 Ga0495583_0028770 3300046506 Bacteria 2728
253 Ga0495583_0239601 3300046506 Bacteria 729
254 Ga0495606_0015815 3300046507 Bacteria 5789
255 Ga0495606_0037933 3300046507 Bacteria 3267
256 Ga0495606_0146537 3300046507 Bacteria 1389
257 Ga0495610_0001820 3300046512 Bacteria 18544
258 Ga0495616_0000053 3300046513 Bacteria 104389
259 Ga0495620_0036865 3300046515 Bacteria 2183
260 Ga0495620_0062682 3300046515 Bacteria 1543
261 Ga0495630_0464167 3300046517 Bacteria 970
262 Ga0495631_0330411 3300046518 Bacteria 649
263 Ga0495632_0036021 3300046519 Bacteria 2519
264 Ga0495637_0029510 3300046520 Bacteria 2441
265 Ga0495643_0125778 3300046522 Bacteria 1291
266 Ga0495643_0157781 3300046522 Bacteria 1118
267 Ga0495644_0123739 3300046523 Bacteria 985
268 Ga0495648_0088051 3300046524 Bacteria 1746
269 Ga0495648_0097703 3300046524 Bacteria 1628
270 Ga0495663_0116895 3300046525 Bacteria 890
271 Ga0495642_0310284 3300046528 Bacteria 692
272 Ga0495654_0000082 3300046530 Bacteria 108599
273 Ga0495609_0012485 3300046538 Bacteria 4030
274 Ga0495621_0080856 3300046539 Bacteria 1211
275 Ga0495597_0018835 3300046542 Bacteria 3235
276 Ga0495597_0055271 3300046542 Bacteria 1741
277 Ga0495622_0005584 3300046557 Bacteria 5832
278 Ga0495668_0000342 3300046616 Bacteria 61973
279 Ga0495668_0012459 3300046616 Bacteria 5041
280 Ga0495668_0020755 3300046616 Bacteria 3775
281 Ga0495668_0080736 3300046616 Bacteria 1785
282 Ga0495668_0082691 3300046616 Bacteria 1761
283 Ga0495668_0252993 3300046616 Bacteria 964
284 Ga0495668_0612663 3300046616 Bacteria 601
285 Ga0495611_0022120 3300046648 Bacteria 2750
286 Ga0495625_0022778 3300046660 Bacteria 4794
287 Ga0495625_0029374 3300046660 Bacteria 4112
288 Ga0495625_0108989 3300046660 Bacteria 1894
289 Ga0495625_0191385 3300046660 Bacteria 1355
290 Ga0495659_0030862 3300046664 Bacteria 1867
291 Ga0495659_0033576 3300046664 Bacteria 1802
292 Ga0495599_0170584 3300046678 Bacteria 1343
293 Ga0495669_0000012 3300046684 Bacteria 157373
294 Ga0495669_0016956 3300046684 Bacteria 3124
295 Ga0495669_0250468 3300046684 Bacteria 850
296 Ga0495624_0045482 3300046690 Bacteria 2794
297 Ga0495671_0265932 3300046692 Bacteria 827
298 Ga0495671_0347636 3300046692 Bacteria 711
299 Ga0495589_0017961 3300046794 Bacteria 3628
300 Ga0495636_0010312 3300047318 Bacteria 3688
301 Ga0495636_0139590 3300047318 Bacteria 1082
302 Ga0495674_0333932 3300047319 Bacteria 1233
303 Ga0495672_0002135 3300047320 Bacteria 18531
304 Ga0495672_0062037 3300047320 Bacteria 2152
305 Ga0495687_067955 3300047443 Bacteria 1440
306 Ga0495677_0062198 3300047445 Bacteria 1385
307 Ga0495677_0191383 3300047445 Bacteria 794
308 Ga0495679_006318 3300047446 Bacteria 5123
309 Ga0495673_0000025 3300047469 Bacteria 512352
310 Ga0495673_0004316 3300047469 Bacteria 8951
311 Ga0495686_0006929 3300047472 Bacteria 8570
312 Ga0495686_0026005 3300047472 Bacteria 3831
313 Ga0495686_0030694 3300047472 Bacteria 3489
314 Ga0495686_0282657 3300047472 Bacteria 922
315 Ga0495602_0166062 3300048088 Bacteria 1718
316 Ga0495615_0043367 3300048090 Bacteria 1132
317 Ga0496100_0122199 3300048903 Bacteria 1823
318 Ga0496101_0041833 3300048904 Bacteria 3270
319 Ga0496101_0917448 3300048904 Bacteria 689
320 Ga0496102_0044030 3300048905 Bacteria 4049
321 Ga0496102_0480690 3300048905 Bacteria 1163
322 Ga0496103_0283715 3300048906 Bacteria 1065
323 Ga0496106_0015977 3300048909 Bacteria 5551
324 Ga0496106_0313827 3300048909 Bacteria 1258
325 Ga0496107_0000329 3300048910 Bacteria 25658
326 Ga0496108_0128864 3300048911 Bacteria 2174
327 Ga0496109_0007918 3300048912 Bacteria 9006
328 Ga0496110_0240834 3300048913 Bacteria 1646
329 Ga0496110_0981704 3300048913 Bacteria 752
330 Ga0496112_0123284 3300048915 Bacteria 2562
331 Ga0496113_0282910 3300048916 Bacteria 1326
332 Ga0496115_0000373 3300048918 Bacteria 36954
333 Ga0496115_0480391 3300048918 Bacteria 1001
334 Ga0496115_0705382 3300048918 Bacteria 793
335 Ga0496116_0050432 3300048919 Bacteria 2773
336 Ga0496117_0012409 3300048920 Bacteria 7515
337 Ga0496118_0005681 3300048921 Bacteria 14053
338 Ga0496119_0015319 3300048922 Bacteria 5914
339 Ga0496121_0001066 3300048924 Bacteria 48544
340 Ga0496121_0001417 3300048924 Bacteria 40646
341 Ga0496121_0166144 3300048924 Bacteria 1608
342 Ga0496122_0185278 3300048925 Bacteria 1236
343 Ga0496123_0052602 3300048926 Bacteria 2701
344 Ga0496124_0094305 3300048927 Bacteria 2434
345 Ga0496125_0006994 3300048928 Bacteria 12074
346 Ga0496126_0001304 3300048929 Bacteria 39731
347 Ga0495678_119679 3300049459 Bacteria 886
348 Ga0501032_0369152 3300049569 Bacteria 923
349 Ga0501032_0401078 3300049569 Bacteria 881
350 Ga0501032_0524757 3300049569 Bacteria 756
351 Ga0501033_0121952 3300049570 Bacteria 1891
352 Ga0501033_0384450 3300049570 Bacteria 980
353 Ga0501034_0762975 3300049571 Bacteria 862
354 Ga0501037_0388092 3300049573 Bacteria 959
355 Ga0501047_0014685 3300049581 Bacteria 7452
356 Ga0501047_0170950 3300049581 Bacteria 2042
357 Ga0501047_0363480 3300049581 Bacteria 1283
358 Ga0501257_000824 3300049686 Bacteria 6198
359 Ga0501044_0005225 3300049823 Bacteria 14446
360 Ga0501044_0460650 3300049823 Bacteria 1177
361 nmdc:mga03683_198117_c1 3300050489 Bacteria 921
362 nmdc:mga03683_82170_c1 3300050489 Bacteria 1393
363 nmdc:mga03n38_173585_c1 3300050490 Bacteria 1100
364 nmdc:mga03n38_225263_c1 3300050490 Bacteria 980
365 nmdc:mga03n38_3147_c1 3300050490 Bacteria 5253
366 nmdc:mga00v17_2988_c1 3300050491 Bacteria 8682
367 nmdc:mga0k408_178431_c1 3300050493 Bacteria 1267
368 nmdc:mga0k408_24012_c2 3300050493 Bacteria 3023
369 nmdc:mga06z11_189637_c1 3300050494 Bacteria 1190
370 nmdc:mga04h51_5853_c1 3300050495 Bacteria 3153
371 nmdc:mga07m45_38945_c1 3300050496 Bacteria 2655
372 nmdc:mga07m45_41213_c1 3300050496 Bacteria 2585
373 nmdc:mga0sz30_18206_c1 3300050516 Bacteria 2809
374 Ga0500578_0213191 3300053086 Bacteria 1177
375 Ga0500578_0222120 3300053086 Bacteria 1148
376 Ga0500643_000316 3300053087 Bacteria 39239
377 Ga0500643_016783 3300053087 Bacteria 2470
378 Ga0500651_0071528 3300053093 Bacteria 2158
379 Ga0500566_0078051 3300053094 Bacteria 1848
380 Ga0500640_148240 3300053095 Bacteria 899
381 Ga0500641_0000796 3300053096 Bacteria 11401
382 Ga0500554_010443 3300053102 Bacteria 2263
383 Ga0500556_0000558 3300053104 Bacteria 24866
384 Ga0500556_0002678 3300053104 Bacteria 5540
385 Ga0500556_0031466 3300053104 Bacteria 1805
386 Ga0500562_000146 3300053108 Bacteria 20862
387 Ga0500562_021879 3300053108 Bacteria 1665
388 Ga0500595_005023 3300053119 Bacteria 5823
389 Ga0500595_013749 3300053119 Bacteria 3095
390 Ga0500608_000187 3300053122 Bacteria 24884
391 Ga0500608_067451 3300053122 Bacteria 1705
392 Ga0500614_021621 3300053123 Bacteria 1494
393 Ga0500618_000319 3300053125 Bacteria 35375
394 Ga0500658_0006383 3300053134 Bacteria 4376
395 Ga0500658_0079669 3300053134 Bacteria 1398
396 Ga0500559_0000280 3300053136 Bacteria 39387
397 Ga0500559_0010232 3300053136 Bacteria 4032
398 Ga0500559_0041206 3300053136 Bacteria 2012
399 Ga0500564_242690 3300053138 Bacteria 718
400 Ga0500590_095136 3300053148 Bacteria 1440
401 Ga0500603_027666 3300053150 Bacteria 1442
402 Ga0500616_0014486 3300053153 Bacteria 4531
403 Ga0500616_0052272 3300053153 Bacteria 2149
404 Ga0500616_0103823 3300053153 Bacteria 1384
405 Ga0500616_0139083 3300053153 Bacteria 1137
406 Ga0500616_0191772 3300053153 Bacteria 912
407 Ga0500616_0195509 3300053153 Bacteria 900
408 Ga0500619_038928 3300053154 Bacteria 1492
409 Ga0500620_034252 3300053155 Bacteria 1630
410 Ga0500622_0015009 3300053156 Bacteria 4154
411 Ga0500622_0093475 3300053156 Bacteria 1489
412 Ga0500622_0099644 3300053156 Bacteria 1432
413 Ga0500627_0067671 3300053158 Bacteria 1578
414 Ga0500633_0108484 3300053160 Bacteria 1027
415 Ga0500636_0178720 3300053177 Bacteria 1141
416 Ga0500645_002871 3300053730 Bacteria 7378
417 Ga0500645_015795 3300053730 Bacteria 2387
418 Ga0500609_004757 3300053731 Bacteria 1868
419 Ga0500596_001528 3300053735 Bacteria 4685
420 Ga0587073_0084785 3300059492 Bacteria 794
421 Ga0587086_007446 3300059507 Bacteria 1254
422 Ga0587092_018753 3300059512 Bacteria 1047
423 Ga0587101_033707 3300059623 Bacteria 812
424 Ga0587128_012382 3300059630 Bacteria 1184
425 Ga0587111_0084522 3300060346 Bacteria 764
426 2511121727 2510917020 Bacteria 5657507
427 2587915356 2585428106 Bacteria 5179711
428 2643781351 2643221552 Bacteria 5708754
429 2644223911 2643221640 Bacteria 5258820
430 2644232897 2643221642 Bacteria 5357871
431 2857508042 2857504554 Bacteria 5369913
432 2884963134 2884960567 Bacteria 5437054
433 2928534802 2928531327 Bacteria 5101314
434 Ga0451795_0732834
435 Ga0055526_1015036
436 Ga0055536_1033303
437 Ga0055536_1033325
438 Ga0055530_10033624
439 Ga0055531_10002770
440 Ga0055531_10005810
441 Ga0055531_10011741
442 Ga0065165_1001609
443 Ga0065165_1002441
444 Ga0070670_100000032
445 Ga0070670_100990716
446 Ga0068869_100291962
447 Ga0070666_10223123
448 Ga0070680_100196759
449 Ga0070660_100371484
450 Ga0070660_101166634
451 Ga0070668_100000975
452 Ga0070668_100001585
453 Ga0070668_100224856
454 Ga0070668_100493960
455 Ga0070669_100015826
456 Ga0070673_100197823
457 Ga0070659_100000638
458 Ga0070659_100634023
459 Ga0070667_100000110
460 Ga0070667_100113693
461 Ga0070667_100173475
462 Ga0070663_100372828
463 Ga0070663_100506978
464 Ga0070678_100209573
465 Ga0070662_100085627
466 Ga0070681_10054201
467 Ga0070679_100454998
468 Ga0070679_100808433
469 Ga0068853_100376152
470 Ga0068853_100691448
471 Ga0068853_100779593
472 Ga0068853_100854456
473 Ga0070672_100857934
474 Ga0070665_100001257
475 Ga0070665_100022111
476 Ga0070665_100035301
477 Ga0070665_100279574
478 Ga0070665_100697218
479 Ga0068855_100452614
480 Ga0068852_100761853
481 Ga0068859_100007383
482 Ga0068864_100011767
483 Ga0068864_100215337
484 Ga0068861_100148859
485 Ga0068863_100001377
486 Ga0068863_100004617
487 Ga0068863_100154913
488 Ga0068858_100006036
489 Ga0068858_100018099
490 Ga0068860_100000100
491 Ga0068860_100000167
492 Ga0068860_100005700
493 Ga0068862_100008644
494 Ga0068862_100064945
495 Ga0068862_100154050
496 Ga0068862_100164431
497 Ga0075368_10001626
498 Ga0075363_100004231
499 Ga0075364_10001989
500 Ga0075362_10010235
501 Ga0075367_10004580
502 Ga0075369_10002683
503 Ga0075369_10088255
504 Ga0075366_10048926
505 Ga0075370_10024762
506 Ga0075370_10034535
507 Ga0068865_100145944
508 Ga0097620_100007383
509 Ga0105240_10717139
510 Ga0105240_10758214
511 Ga0105240_11106740
512 Ga0105243_10480961
513 Ga0105241_10033781
514 Ga0105242_10258217
515 Ga0105248_10000280
516 Ga0105248_10004080
517 Ga0105248_10099751
518 Ga0105248_10213864
519 Ga0105248_10397238
520 Ga0105248_10785046
521 Ga0105238_10005585
522 Ga0105238_11562578
523 Ga0105249_10110912
524 Ga0105249_10128030
525 Ga0105249_10434785
526 Ga0105249_11115083
527 Ga0105239_10943103
528 Ga0157373_10001320
529 Ga0157373_10003865
530 Ga0157374_10252720
531 Ga0163162_10202432
532 Ga0163162_10338914
533 Ga0157372_10095445
534 Ga0157375_10200219
535 Ga0163163_10005530
536 Ga0163163_10200461
537 Ga0163163_10425259
538 Ga0163163_10524636
539 Ga0163163_10855676
540 Ga0157380_10428609
541 Ga0182008_10174088
542 Ga0157377_10412783
543 Ga0157379_10002605
544 Ga0157379_10143052
545 Ga0157379_10575086
546 Ga0157376_10498400
547 Ga0157376_10830702
548 Ga0213872_10099406
549 Ga0209673_1056497
550 Ga0209676_1000467
551 Ga0209676_1000560
552 Ga0209564_1006954
553 Ga0209564_1016749
554 Ga0209758_1000331
555 Ga0209758_1006870
556 Ga0209050_1000130
557 Ga0209050_1000461
558 Ga0209050_1002433
559 Ga0209256_1011761
560 Ga0209257_1000059
561 Ga0209257_1000186
562 Ga0209257_1000246
563 Ga0209257_1041999
564 Ga0207680_10043668
565 Ga0207680_10158597
566 Ga0207680_10409085
567 Ga0207705_10164050
568 Ga0207707_10104942
569 Ga0207695_10011375
570 Ga0207671_10164618
571 Ga0207657_10248641
572 Ga0207657_10304122
573 Ga0207652_10286976
574 Ga0207681_10004224
575 Ga0207681_10599439
576 Ga0207694_10018259
577 Ga0207650_10000074
578 Ga0207690_10001176
579 Ga0207690_10006522
580 Ga0207706_10037299
581 Ga0207686_10124175
582 Ga0207709_10302875
583 Ga0207704_10001590
584 Ga0207691_10324007
585 Ga0207711_10002580
586 Ga0207711_10007049
587 Ga0207711_10103543
588 Ga0207711_10194592
589 Ga0207711_10389345
590 Ga0207689_10146028
591 Ga0207689_10385537
592 Ga0207667_10200677
593 Ga0207667_10342851
594 Ga0207651_10191846
595 Ga0207712_10022074
596 Ga0207712_10222525
597 Ga0207712_10821790
598 Ga0207668_10000001
599 Ga0207668_10000246
600 Ga0207668_10012632
601 Ga0207668_10026970
602 Ga0207668_10194164
603 Ga0207640_10318599
604 Ga0207658_10000275
605 Ga0207658_10021114
606 Ga0207658_10186740
607 Ga0207677_10048132
608 Ga0207703_10017891
609 Ga0207703_10087283
610 Ga0207703_10332342
611 Ga0207639_10035580
612 Ga0207639_10371256
613 Ga0207639_10546941
614 Ga0207639_11333102
615 Ga0207678_10182131
616 Ga0207678_10620696
617 Ga0207702_10420736
618 Ga0207641_10001197
619 Ga0207641_10001917
620 Ga0207641_10206230
621 Ga0207676_10001101
622 Ga0207676_10038117
623 Ga0207676_10218428
624 Ga0207676_10304475
625 Ga0207683_10303518
626 Ga0207698_10311749
627 Ga0209981_1001900
628 Ga0210000_1009380
629 Ga0209999_1013847
630 Ga0209983_1009648
631 Ga0209813_10003607
632 Ga0209974_10055580
633 Ga0268266_10000289
634 Ga0268266_10038244
635 Ga0268266_10050459
636 Ga0268266_10333001
637 Ga0268266_10636829
638 Ga0268265_10000648
639 Ga0268265_10002515
640 Ga0268265_10249151
641 Ga0268265_10455098
642 Ga0268265_10594659
643 Ga0268264_10000002
644 Ga0268264_10000068
645 Ga0265337_1057301
646 Ga0307517_10002267
647 Ga0307517_10033152
648 Ga0307517_10129140
649 Ga0307517_10135723
650 Ga0307513_10000790
651 Ga0307513_10004139
652 Ga0307408_100392194
653 Ga0307508_10084960
654 Ga0265314_10122925
655 Ga0307416_100976121
656 Ga0307510_10295732
657 Ga0373931_0492682
658 Ga0395899_0000004
659 Ga0395900_0100671
660 Ga0395898_0393398
661 Ga0395905_0200192
662 Ga0395905_0280153
663 Ga0395905_0577875
664 Ga0395905_0659376
665 Ga0395905_0969637
666 Ga0395901_0217205
667 Ga0436361_1028263
668 Ga0436362_0745879
669 Ga0451789_0893595
670 Ga0451837_0221795
671 Ga0451853_4088132
672 Ga0439459_0009247
673 Ga0450916_010002
674 Ga0466965_0395547
675 Ga0466961_0055258
676 Ga0466960_0223063
677 Ga0495627_008977
678 Ga0495629_0164616
679 Ga0495638_0004112
680 Ga0495638_0129778
681 Ga0495650_0000114
682 Ga0495582_0252298
683 Ga0495607_0010068
684 Ga0495583_0000013
685 Ga0495583_0028770
686 Ga0495583_0239601
687 Ga0495606_0015815
688 Ga0495606_0037933
689 Ga0495606_0146537
690 Ga0495610_0001820
691 Ga0495616_0000053
692 Ga0495620_0036865
693 Ga0495620_0062682
694 Ga0495630_0464167
695 Ga0495631_0330411
696 Ga0495632_0036021
697 Ga0495637_0029510
698 Ga0495643_0125778
699 Ga0495643_0157781
700 Ga0495644_0123739
701 Ga0495648_0088051
702 Ga0495648_0097703
703 Ga0495663_0116895
704 Ga0495642_0310284
705 Ga0495654_0000082
706 Ga0495609_0012485
707 Ga0495621_0080856
708 Ga0495597_0018835
709 Ga0495597_0055271
710 Ga0495622_0005584
711 Ga0495668_0000342
712 Ga0495668_0012459
713 Ga0495668_0020755
714 Ga0495668_0080736
715 Ga0495668_0082691
716 Ga0495668_0252993
717 Ga0495668_0612663
718 Ga0495611_0022120
719 Ga0495625_0022778
720 Ga0495625_0029374
721 Ga0495625_0108989
722 Ga0495625_0191385
723 Ga0495659_0030862
724 Ga0495659_0033576
725 Ga0495599_0170584
726 Ga0495669_0000012
727 Ga0495669_0016956
728 Ga0495669_0250468
729 Ga0495624_0045482
730 Ga0495671_0265932
731 Ga0495671_0347636
732 Ga0495589_0017961
733 Ga0495636_0010312
734 Ga0495636_0139590
735 Ga0495674_0333932
736 Ga0495672_0002135
737 Ga0495672_0062037
738 Ga0495687_067955
739 Ga0495677_0062198
740 Ga0495677_0191383
741 Ga0495679_006318
742 Ga0495673_0000025
743 Ga0495673_0004316
744 Ga0495686_0006929
745 Ga0495686_0026005
746 Ga0495686_0030694
747 Ga0495686_0282657
748 Ga0495602_0166062
749 Ga0495615_0043367
750 Ga0496100_0122199
751 Ga0496101_0041833
752 Ga0496101_0917448
753 Ga0496102_0044030
754 Ga0496102_0480690
755 Ga0496103_0283715
756 Ga0496106_0015977
757 Ga0496106_0313827
758 Ga0496107_0000329
759 Ga0496108_0128864
760 Ga0496109_0007918
761 Ga0496110_0240834
762 Ga0496110_0981704
763 Ga0496112_0123284
764 Ga0496113_0282910
765 Ga0496115_0000373
766 Ga0496115_0480391
767 Ga0496115_0705382
768 Ga0496116_0050432
769 Ga0496117_0012409
770 Ga0496118_0005681
771 Ga0496119_0015319
772 Ga0496121_0001066
773 Ga0496121_0001417
774 Ga0496121_0166144
775 Ga0496122_0185278
776 Ga0496123_0052602
777 Ga0496124_0094305
778 Ga0496125_0006994
779 Ga0496126_0001304
780 Ga0495678_119679
781 Ga0501032_0369152
782 Ga0501032_0401078
783 Ga0501032_0524757
784 Ga0501033_0121952
785 Ga0501033_0384450
786 Ga0501034_0762975
787 Ga0501037_0388092
788 Ga0501047_0014685
789 Ga0501047_0170950
790 Ga0501047_0363480
791 Ga0501257_000824
792 Ga0501044_0005225
793 Ga0501044_0460650
794 nmdc:mga03683_198117_c1
795 nmdc:mga03683_82170_c1
796 nmdc:mga03n38_173585_c1
797 nmdc:mga03n38_225263_c1
798 nmdc:mga03n38_3147_c1
799 nmdc:mga00v17_2988_c1
800 nmdc:mga0k408_178431_c1
801 nmdc:mga0k408_24012_c2
802 nmdc:mga06z11_189637_c1
803 nmdc:mga04h51_5853_c1
804 nmdc:mga07m45_38945_c1
805 nmdc:mga07m45_41213_c1
806 nmdc:mga0sz30_18206_c1
807 Ga0500578_0213191
808 Ga0500578_0222120
809 Ga0500643_000316
810 Ga0500643_016783
811 Ga0500651_0071528
812 Ga0500566_0078051
813 Ga0500640_148240
814 Ga0500641_0000796
815 Ga0500554_010443
816 Ga0500556_0000558
817 Ga0500556_0002678
818 Ga0500556_0031466
819 Ga0500562_000146
820 Ga0500562_021879
821 Ga0500595_005023
822 Ga0500595_013749
823 Ga0500608_000187
824 Ga0500608_067451
825 Ga0500614_021621
826 Ga0500618_000319
827 Ga0500658_0006383
828 Ga0500658_0079669
829 Ga0500559_0000280
830 Ga0500559_0010232
831 Ga0500559_0041206
832 Ga0500564_242690
833 Ga0500590_095136
834 Ga0500603_027666
835 Ga0500616_0014486
836 Ga0500616_0052272
837 Ga0500616_0103823
838 Ga0500616_0139083
839 Ga0500616_0191772
840 Ga0500616_0195509
841 Ga0500619_038928
842 Ga0500620_034252
843 Ga0500622_0015009
844 Ga0500622_0093475
845 Ga0500622_0099644
846 Ga0500627_0067671
847 Ga0500633_0108484
848 Ga0500636_0178720
849 Ga0500645_002871
850 Ga0500645_015795
851 Ga0500609_004757
852 Ga0500596_001528
853 Ga0587073_0084785
854 Ga0587086_007446
855 Ga0587092_018753
856 Ga0587101_033707
857 Ga0587128_012382
858 Ga0587111_0084522
859 2511121727
860 2587915356
861 2643781351
862 2644223911
863 2644232897
864 2857508042
865 2884963134
866 2928534802

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10399

UCR_Fe-S_N

Ubiquitinol-cytochrome C reductase Fe-S subunit TAT signal

37

76

0.96

PF00355

Rieske

Rieske [2Fe-2S] domain

86

199

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
1rie-assembly1.cif.gz_A structure of a water soluble fragment of the rieske iron-sulfur protein of the bovine heart mitochondrial cytochrome bc1-complex 0.9277 56 183
1rie-assembly1.cif.gz_A structure of a water soluble fragment of the rieske iron-sulfur protein of the bovine heart mitochondrial cytochrome bc1-complex 0.9142 56 183
2nvg-assembly1.cif.gz_A soluble domain of rieske iron sulfur protein. 0.8779 56 183
2num-assembly1.cif.gz_A soluble domain of rieske iron-sulfur protein 0.8771 56 183
2nuk-assembly1.cif.gz_A soluble domain of the rieske iron-sulfur protein from rhodobacter sphaeroides 0.877 56 183
ID Description Score Start End Superfamily
af_Q4DS82_165_295_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8862 53 183 2.102.10.10
af_Q4DS82_165_295_2.102.10.10 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8737 53 183 2.102.10.10
2yiuC02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.867 52 183 2.102.10.10
1l0nE02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8589 51 183 2.102.10.10
3l71E02 Mainly Beta;3-layer Sandwich;Rieske Iron-sulfur Protein;Rieske [2Fe-2S] iron-sulphur domain 0.8587 51 183 2.102.10.10
ID Description Score Start End GO Terms
AF-A0A2G9U2W1-F1-model_v4 Rieske domain-containing protein 0.9559 133 183 GO:0016020
GO:0046872
GO:0051537
AF-A0A3M7F5C9-F1-model_v4 Cytochrome b-c1 complex subunit Rieske, mitochondrial (EC 7.1.1.8) 0.9262 59 183 GO:0005743
GO:0008121
GO:0046872
GO:0051537
AF-A0A4Q3H7E1-F1-model_v4 Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) 0.9238 57 183 GO:0008121
GO:0016020
GO:0046872
GO:0051537
AF-V7FRN5-F1-model_v4 Ubiquinol-cytochrome c reductase iron-sulfur subunit (EC 7.1.1.8) 0.9213 59 183 GO:0008121
GO:0016020
GO:0046872
GO:0051537
AF-A0A3M7F5C9-F1-model_v4 Cytochrome b-c1 complex subunit Rieske, mitochondrial (EC 7.1.1.8) 0.9189 59 183 GO:0005743
GO:0008121
GO:0046872
GO:0051537

Map