F442813

General Info

Members Datasets Scaffolds Average Seq Length
433 298 866 215

Family's Representative Sequence

Representative Sequence 3300007788|Ga0099795_10041635|Ga0099795_100416353
Length 235
Sequence MARLRIGVLISGRGSNLQALIDAAADPAYPAEIVLVISNRAEAEGLRRAADAGIAHQVVAERDRTAFAAAANGALRQNGVELIALAGFMRLLDTGFVEAWRDRMVNIHPSLLPAFPGLHPQRQALMAGARFSGCTVHFVRTEVDTGPIIAQAVVPVHDDXXXESLSARILTAEHRLYPLALRLHAEGRLRIDGNRVSVAGGTAPDIAALNPLEALASRGGSAIPRAEISQRARRR

Samples

Sample ID Description Type Environment
1 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
52 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
55 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
60 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
74 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
75 3300012507 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.7.yng.070610 Metagenome Rhizosphere
76 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
77 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
78 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
91 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
92 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
141 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
142 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
143 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
150 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
151 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
154 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
157 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
158 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
159 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
160 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
161 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
172 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
185 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
189 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
190 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
193 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
199 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
205 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
206 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
212 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
213 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
218 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
219 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
220 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
221 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
222 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
225 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
226 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
227 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
228 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
229 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
230 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
231 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
239 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
240 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
241 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
242 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
256 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
276 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
277 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
278 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
284 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
285 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
288 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
289 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
290 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
291 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
292 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
293 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
296 2508501050 Microvirga lupini Lut6 Isolate Nodule
297 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
298 2773857925 Microvirga vignae BR3299 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.31
Metatranscriptomes 0
Isolates 0.69

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.85
Nodule 0.46
Rhizoplane 8.31
Rhizosphere 87.3
Stem 0
Stem Tuber 0
Unclassified 4.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099795_10041635 3300007788 Bacteria 1636
2 Ga0070658_10082464 3300005327 Bacteria 2642
3 Ga0070676_10058291 3300005328 Bacteria 2288
4 Ga0070683_100549889 3300005329 Bacteria 1104
5 Ga0070683_100896485 3300005329 Bacteria 851
6 Ga0068869_100513862 3300005334 Bacteria 1002
7 Ga0070666_10014445 3300005335 Bacteria 5028
8 Ga0070680_100135259 3300005336 Bacteria 2064
9 Ga0070680_100880957 3300005336 Bacteria 772
10 Ga0068868_100987400 3300005338 Unclassified 770
11 Ga0070660_100105585 3300005339 Bacteria 2236
12 Ga0070660_100517268 3300005339 Bacteria 994
13 Ga0070668_100163428 3300005347 Bacteria 1808
14 Ga0070668_100294609 3300005347 Bacteria 1359
15 Ga0070671_100325795 3300005355 Bacteria 1309
16 Ga0070659_100468478 3300005366 Bacteria 1071
17 Ga0070709_10003530 3300005434 Bacteria 8405
18 Ga0070714_100202879 3300005435 Bacteria 1814
19 Ga0070714_100284107 3300005435 Bacteria 1538
20 Ga0070713_100001980 3300005436 Bacteria 13222
21 Ga0070713_100004676 3300005436 Bacteria 9242
22 Ga0070713_100766905 3300005436 Unclassified 923
23 Ga0070710_10001979 3300005437 Bacteria 9711
24 Ga0070711_100128933 3300005439 Bacteria 1881
25 Ga0070711_100615256 3300005439 Bacteria 907
26 Ga0070708_100022231 3300005445 Bacteria 5376
27 Ga0070663_100058214 3300005455 Bacteria 2774
28 Ga0070662_100854666 3300005457 Unclassified 775
29 Ga0070681_10081987 3300005458 Bacteria 3181
30 Ga0070681_10195012 3300005458 Bacteria 1944
31 Ga0070681_10276625 3300005458 Bacteria 1590
32 Ga0070685_10007924 3300005466 Bacteria 5442
33 Ga0070706_100000049 3300005467 Bacteria 141287
34 Ga0070706_100014523 3300005467 Bacteria 7275
35 Ga0070707_100005499 3300005468 Bacteria 11845
36 Ga0070707_100013646 3300005468 Bacteria 7609
37 Ga0070698_100055749 3300005471 Bacteria 4005
38 Ga0070698_100311976 3300005471 Bacteria 1504
39 Ga0070699_100022639 3300005518 Bacteria 5416
40 Ga0070699_100835653 3300005518 Bacteria 843
41 Ga0070679_100383809 3300005530 Bacteria 1351
42 Ga0070679_100613673 3300005530 Bacteria 1031
43 Ga0070684_100133845 3300005535 Bacteria 2238
44 Ga0070684_100442595 3300005535 Bacteria 1200
45 Ga0070697_100045410 3300005536 Bacteria 3560
46 Ga0070696_100150462 3300005546 Unclassified 1708
47 Ga0070665_100531780 3300005548 Bacteria 1187
48 Ga0070665_100883827 3300005548 Unclassified 906
49 Ga0070704_100375127 3300005549 Bacteria 1207
50 Ga0068855_100397658 3300005563 Bacteria 1510
51 Ga0070664_100194793 3300005564 Bacteria 1806
52 Ga0070664_100375698 3300005564 Bacteria 1296
53 Ga0068857_100083595 3300005577 Bacteria 2852
54 Ga0068854_100073261 3300005578 Bacteria 2510
55 Ga0068856_100000082 3300005614 Bacteria 88302
56 Ga0068856_100025096 3300005614 Bacteria 5808
57 Ga0068856_100140564 3300005614 Bacteria 2421
58 Ga0068856_100185208 3300005614 Bacteria 2096
59 Ga0068856_100233714 3300005614 Bacteria 1854
60 Ga0070702_100013875 3300005615 Bacteria 4078
61 Ga0068852_100300174 3300005616 Bacteria 1554
62 Ga0068852_100398499 3300005616 Bacteria 1353
63 Ga0068859_100334467 3300005617 Bacteria 1609
64 Ga0068864_100027332 3300005618 Bacteria 4818
65 Ga0068861_100149395 3300005719 Bacteria 1916
66 Ga0068863_100033568 3300005841 Bacteria 4889
67 Ga0068858_100399478 3300005842 Unclassified 1320
68 Ga0068858_100401290 3300005842 Bacteria 1317
69 Ga0068860_100420010 3300005843 Bacteria 1325
70 Ga0070717_10000822 3300006028 Bacteria 20471
71 Ga0070717_10249235 3300006028 Bacteria 1568
72 Ga0075365_10188534 3300006038 Bacteria 1443
73 Ga0075365_10249487 3300006038 Bacteria 1247
74 Ga0070715_10001175 3300006163 Bacteria 7513
75 Ga0070716_100005712 3300006173 Bacteria 6042
76 Ga0097621_100024616 3300006237 Bacteria 4703
77 Ga0068871_100001532 3300006358 Bacteria 15499
78 Ga0075430_100057195 3300006846 Bacteria 3280
79 Ga0075431_100025010 3300006847 Bacteria 6121
80 Ga0075434_100029208 3300006871 Bacteria 5422
81 Ga0075434_100949254 3300006871 Bacteria 874
82 Ga0075429_100036912 3300006880 Bacteria 4253
83 Ga0068865_100087701 3300006881 Bacteria 2249
84 Ga0075436_100056593 3300006914 Bacteria 2708
85 Ga0075436_100063284 3300006914 Bacteria 2557
86 Ga0097620_100334490 3300006931 Bacteria 1609
87 Ga0075435_100033922 3300007076 Bacteria 4040
88 Ga0075435_100613804 3300007076 Unclassified 943
89 Ga0105251_10008054 3300009011 Bacteria 6390
90 Ga0105240_10136975 3300009093 Bacteria 2931
91 Ga0105240_10191584 3300009093 Bacteria 2404
92 Ga0105240_10379673 3300009093 Bacteria 1596
93 Ga0111539_10351389 3300009094 Bacteria 1716
94 Ga0111539_10367269 3300009094 Bacteria 1675
95 Ga0105247_10259743 3300009101 Bacteria 1190
96 Ga0105247_10484985 3300009101 Unclassified 898
97 Ga0114129_10109702 3300009147 Bacteria 3809
98 Ga0114129_10899833 3300009147 Bacteria 1121
99 Ga0105243_10029809 3300009148 Bacteria 4198
100 Ga0105243_10720439 3300009148 Bacteria 975
101 Ga0105241_10022839 3300009174 Bacteria 4637
102 Ga0105242_10056179 3300009176 Bacteria 3221
103 Ga0105238_10062579 3300009551 Bacteria 3722
104 Ga0105238_11415368 3300009551 Bacteria 723
105 Ga0105249_10313259 3300009553 Bacteria 1578
106 Ga0105249_10683174 3300009553 Bacteria 1086
107 Ga0099796_10000728 3300010159 Bacteria 5856
108 Ga0105239_11301131 3300010375 Bacteria 838
109 Ga0105246_10291287 3300011119 Bacteria 1314
110 Ga0157336_1005434 3300012477 Unclassified 840
111 Ga0157324_1001374 3300012506 Bacteria 1332
112 Ga0157342_1005995 3300012507 Bacteria 1135
113 Ga0157315_1013295 3300012508 Unclassified 772
114 Ga0157316_1003834 3300012510 Bacteria 1108
115 Ga0157338_1000859 3300012515 Bacteria 1989
116 Ga0157370_10266939 3300013104 Bacteria 1581
117 Ga0157369_10261006 3300013105 Bacteria 1806
118 Ga0157374_10736238 3300013296 Bacteria 1000
119 Ga0157378_10519291 3300013297 Bacteria 1192
120 Ga0163162_10154327 3300013306 Bacteria 2415
121 Ga0157375_10229961 3300013308 Bacteria 2013
122 Ga0163163_10241365 3300014325 Bacteria 1856
123 Ga0157380_10031592 3300014326 Bacteria 4066
124 Ga0157380_10208700 3300014326 Bacteria 1739
125 Ga0157380_10287073 3300014326 Bacteria 1509
126 Ga0182008_10034859 3300014497 Bacteria 2523
127 Ga0182008_10044487 3300014497 Bacteria 2208
128 Ga0157379_10679778 3300014968 Bacteria 965
129 Ga0157376_10499390 3300014969 Bacteria 1195
130 Ga0213873_10050225 3300021358 Bacteria 1102
131 Ga0213875_10049912 3300021388 Bacteria 1961
132 Ga0209676_1000159 3300025292 Bacteria 161731
133 Ga0209050_1015498 3300025298 Bacteria 3194
134 Ga0207710_10002649 3300025900 Bacteria 8253
135 Ga0207680_10021180 3300025903 Bacteria 3514
136 Ga0207699_10012841 3300025906 Bacteria 4267
137 Ga0207699_10103324 3300025906 Bacteria 1812
138 Ga0207645_10057842 3300025907 Bacteria 2476
139 Ga0207705_10256510 3300025909 Bacteria 1334
140 Ga0207684_10000011 3300025910 Bacteria 502991
141 Ga0207654_10142304 3300025911 Bacteria 1531
142 Ga0207707_10140953 3300025912 Bacteria 2108
143 Ga0207707_10185944 3300025912 Bacteria 1813
144 Ga0207695_10166456 3300025913 Bacteria 2132
145 Ga0207695_10504311 3300025913 Bacteria 1092
146 Ga0207671_10060791 3300025914 Bacteria 2803
147 Ga0207693_10009353 3300025915 Bacteria 7990
148 Ga0207693_10028814 3300025915 Bacteria 4389
149 Ga0207663_10291682 3300025916 Bacteria 1215
150 Ga0207657_10114608 3300025919 Bacteria 2222
151 Ga0207657_10525390 3300025919 Bacteria 926
152 Ga0207649_10107666 3300025920 Bacteria 1856
153 Ga0207652_10213676 3300025921 Bacteria 1737
154 Ga0207646_10008409 3300025922 Bacteria 10348
155 Ga0207646_10575859 3300025922 Bacteria 1011
156 Ga0207694_10270678 3300025924 Bacteria 1393
157 Ga0207659_10035596 3300025926 Bacteria 3443
158 Ga0207700_10008262 3300025928 Bacteria 6433
159 Ga0207700_10012467 3300025928 Bacteria 5484
160 Ga0207664_10027142 3300025929 Bacteria 4337
161 Ga0207644_10035998 3300025931 Bacteria 3472
162 Ga0207706_10353631 3300025933 Bacteria 1277
163 Ga0207686_10046149 3300025934 Bacteria 2686
164 Ga0207709_10224470 3300025935 Bacteria 1357
165 Ga0207669_10174528 3300025937 Bacteria 1534
166 Ga0207704_10105432 3300025938 Bacteria 1891
167 Ga0207665_10060309 3300025939 Bacteria 2569
168 Ga0207711_10017313 3300025941 Bacteria 5988
169 Ga0207689_10488844 3300025942 Bacteria 1031
170 Ga0207661_10039367 3300025944 Bacteria 3710
171 Ga0207661_10545863 3300025944 Bacteria 1062
172 Ga0207679_10063181 3300025945 Bacteria 2763
173 Ga0207679_10773537 3300025945 Bacteria 874
174 Ga0207667_10063548 3300025949 Bacteria 3857
175 Ga0207667_10713791 3300025949 Bacteria 1004
176 Ga0207651_10420713 3300025960 Bacteria 1141
177 Ga0207712_10574889 3300025961 Bacteria 972
178 Ga0207658_10049041 3300025986 Bacteria 3100
179 Ga0207677_10031724 3300026023 Bacteria 3387
180 Ga0207639_10639958 3300026041 Bacteria 983
181 Ga0207678_10029152 3300026067 Bacteria 4817
182 Ga0207678_10406922 3300026067 Bacteria 1178
183 Ga0207702_10000048 3300026078 Bacteria 143125
184 Ga0207702_10187257 3300026078 Bacteria 1910
185 Ga0207641_10096191 3300026088 Bacteria 2600
186 Ga0207676_10132064 3300026095 Bacteria 2124
187 Ga0207675_100068700 3300026118 Bacteria 3311
188 Ga0207683_10002032 3300026121 Bacteria 17891
189 Ga0209179_1005421 3300027512 Bacteria 1994
190 Ga0209974_10023829 3300027876 Bacteria 2025
191 Ga0268266_10025477 3300028379 Bacteria 5032
192 Ga0268266_10646640 3300028379 Bacteria 1017
193 Ga0265330_10062629 3300031235 Bacteria 1617
194 Ga0265330_10062985 3300031235 Bacteria 1612
195 Ga0265332_10000227 3300031238 Bacteria 45207
196 Ga0265332_10006558 3300031238 Bacteria 5278
197 Ga0265328_10084878 3300031239 Bacteria 1168
198 Ga0265320_10028991 3300031240 Bacteria 2869
199 Ga0265325_10005176 3300031241 Bacteria 8103
200 Ga0265325_10055397 3300031241 Bacteria 2027
201 Ga0265325_10336702 3300031241 Bacteria 668
202 Ga0265340_10001172 3300031247 Bacteria 15004
203 Ga0265340_10009212 3300031247 Bacteria 5305
204 Ga0265340_10082122 3300031247 Bacteria 1516
205 Ga0265340_10084863 3300031247 Bacteria 1486
206 Ga0265339_10009213 3300031249 Bacteria 6224
207 Ga0265339_10215320 3300031249 Bacteria 942
208 Ga0265331_10029749 3300031250 Bacteria 2724
209 Ga0265331_10097472 3300031250 Bacteria 1356
210 Ga0265331_10128203 3300031250 Bacteria 1158
211 Ga0265316_10094085 3300031344 Bacteria 2283
212 Ga0265316_10109203 3300031344 Bacteria 2096
213 Ga0265313_10011747 3300031595 Bacteria 5419
214 Ga0265313_10039343 3300031595 Bacteria 2346
215 Ga0265314_10041082 3300031711 Bacteria 3314
216 Ga0265314_10294290 3300031711 Bacteria 913
217 Ga0265342_10000137 3300031712 Bacteria 81963
218 Ga0307413_10313624 3300031824 Bacteria 1195
219 Ga0307409_100118738 3300031995 Bacteria 2234
220 Ga0307416_100009899 3300032002 Bacteria 6270
221 Ga0307416_100364353 3300032002 Bacteria 1469
222 Ga0307415_100905722 3300032126 Bacteria 813
223 Ga0316583_10001495 3300032133 Bacteria 7836
224 Ga0373926_0023735 3300035083 Bacteria 2131
225 Ga0373928_0006359 3300035084 Bacteria 2273
226 Ga0373929_0018390 3300035085 Bacteria 1388
227 Ga0373934_0183477 3300035086 Bacteria 860
228 Ga0373949_0007194 3300035090 Bacteria 2440
229 Ga0373923_0064322 3300035111 Bacteria 1564
230 Ga0373932_0008573 3300035112 Bacteria 2445
231 Ga0373936_0004917 3300035113 Bacteria 5037
232 Ga0373939_0010588 3300035114 Bacteria 2310
233 Ga0373941_0038530 3300035115 Bacteria 1464
234 Ga0373941_0070779 3300035115 Bacteria 1157
235 Ga0373945_0005304 3300035116 Bacteria 4125
236 Ga0373945_0013651 3300035116 Bacteria 2714
237 Ga0373954_0082316 3300035118 Bacteria 1539
238 Ga0373956_0022004 3300035119 Bacteria 2724
239 Ga0373943_0022616 3300035170 Unclassified 2916
240 Ga0373946_0008284 3300035171 Bacteria 3815
241 Ga0373955_0009249 3300035172 Bacteria 4613
242 Ga0373961_0010488 3300035241 Bacteria 2284
243 Ga0316574_0205844 3300035398 Bacteria 1263
244 Ga0373924_0082072 3300035410 Bacteria 1372
245 Ga0373931_0004866 3300035691 Bacteria 6170
246 Ga0373931_0091428 3300035691 Bacteria 1696
247 Ga0373935_0005794 3300035692 Bacteria 7311
248 Ga0373927_0029540 3300035695 Bacteria 3573
249 Ga0373927_0043235 3300035695 Bacteria 2918
250 Ga0373927_0063218 3300035695 Bacteria 2394
251 Ga0373933_0000041 3300035724 Bacteria 79805
252 Ga0373933_0012503 3300035724 Bacteria 4688
253 Ga0373947_0001639 3300035725 Bacteria 13730
254 Ga0373947_0004271 3300035725 Bacteria 8386
255 Ga0373937_0360385 3300036401 Bacteria 1378
256 Ga0373937_0901082 3300036401 Bacteria 833
257 Ga0373925_0023367 3300037068 Bacteria 4511
258 Ga0373925_0080248 3300037068 Bacteria 2479
259 Ga0373925_0258327 3300037068 Bacteria 1399
260 Ga0373925_0405341 3300037068 Bacteria 1112
261 Ga0436364_0633668 3300037853 Bacteria 9751
262 Ga0400486_18375 3300038742 Bacteria 2765
263 Ga0400487_58895 3300039110 Bacteria 4452
264 Ga0436365_0606451 3300039437 Bacteria 1210
265 Ga0436365_1652338 3300039437 Bacteria 19999
266 Ga0436360_0216104 3300039438 Bacteria 1419
267 Ga0436361_0156887 3300039447 Bacteria 2717
268 Ga0436361_0281489 3300039447 Bacteria 791
269 Ga0436363_0187609 3300039450 Bacteria 1069
270 Ga0436362_0149843 3300039453 Bacteria 1827
271 Ga0436362_1037706 3300039453 Bacteria 1099
272 Ga0451807_1259783 3300041486 Bacteria 860
273 Ga0450890_036348 3300042127 Unclassified 717
274 Ga0451577_0068018 3300042876 Bacteria 3177
275 Ga0451577_0102500 3300042876 Bacteria 2557
276 Ga0451577_0182799 3300042876 Bacteria 1890
277 Ga0451577_0472807 3300042876 Bacteria 1138
278 Ga0451577_0688097 3300042876 Bacteria 926
279 Ga0466963_0202405 3300044694 Bacteria 1389
280 Ga0453684_0006774 3300044712 Bacteria 21561
281 Ga0453684_0043386 3300044712 Bacteria 6045
282 Ga0453684_0166876 3300044712 Bacteria 2598
283 Ga0453684_0447258 3300044712 Bacteria 1439
284 Ga0466959_0015780 3300045049 Bacteria 5510
285 Ga0451576_0001069 3300045051 Bacteria 50249
286 Ga0451576_0006250 3300045051 Bacteria 14662
287 Ga0451576_0241404 3300045051 Bacteria 1887
288 Ga0451576_0343975 3300045051 Bacteria 1562
289 Ga0495592_0068767 3300046454 Bacteria 2584
290 Ga0495603_0105123 3300046455 Bacteria 1647
291 Ga0495629_0000688 3300046459 Bacteria 27364
292 Ga0495641_0020267 3300046461 Bacteria 3376
293 Ga0495641_0051428 3300046461 Bacteria 1881
294 Ga0495580_0027556 3300046472 Bacteria 4133
295 Ga0495580_0049994 3300046472 Bacteria 2957
296 Ga0495582_0002698 3300046473 Bacteria 9908
297 Ga0495582_0011725 3300046473 Bacteria 4830
298 Ga0495639_0045983 3300046475 Bacteria 1975
299 Ga0495662_0037447 3300046476 Bacteria 2342
300 Ga0495584_0054179 3300046491 Bacteria 2019
301 Ga0495585_0013732 3300046492 Bacteria 4732
302 Ga0495594_0019571 3300046499 Bacteria 3598
303 Ga0495628_0026351 3300046516 Bacteria 4742
304 Ga0495630_0036667 3300046517 Bacteria 3665
305 Ga0495630_0096341 3300046517 Bacteria 2237
306 Ga0495643_0121547 3300046522 Bacteria 1319
307 Ga0495663_0042432 3300046525 Unclassified 1386
308 Ga0495666_0010363 3300046526 Bacteria 4645
309 Ga0495665_0002653 3300046531 Bacteria 9656
310 Ga0495586_0150969 3300046535 Unclassified 1307
311 Ga0495587_0075784 3300046536 Bacteria 1953
312 Ga0495622_0061458 3300046557 Bacteria 1739
313 Ga0495633_0004645 3300046558 Bacteria 8651
314 Ga0495667_0040453 3300046559 Bacteria 3095
315 Ga0495656_0000194 3300046615 Bacteria 21724
316 Ga0495634_0155945 3300046642 Unclassified 1441
317 Ga0495611_0004273 3300046648 Bacteria 6209
318 Ga0495635_0023837 3300046663 Bacteria 4264
319 Ga0495659_0004606 3300046664 Bacteria 4341
320 Ga0495588_0013111 3300046674 Bacteria 3940
321 Ga0495599_0007081 3300046678 Bacteria 6789
322 Ga0495646_0022708 3300046680 Bacteria 3954
323 Ga0495647_0007046 3300046681 Bacteria 3748
324 Ga0495658_0000246 3300046683 Bacteria 31009
325 Ga0495658_0005203 3300046683 Bacteria 6397
326 Ga0495669_0111904 3300046684 Unclassified 1275
327 Ga0495613_0034537 3300046689 Bacteria 3755
328 Ga0495670_0000200 3300046691 Bacteria 26865
329 Ga0495600_0002311 3300046809 Bacteria 10878
330 Ga0495674_0105056 3300047319 Bacteria 2400
331 Ga0495676_0235276 3300047321 Bacteria 1256
332 Ga0495680_0010106 3300047322 Bacteria 8439
333 Ga0495684_0007729 3300047471 Bacteria 8323
334 Ga0495615_0155183 3300048090 Unclassified 684
335 Ga0496100_0008551 3300048903 Bacteria 5712
336 Ga0496101_0332575 3300048904 Bacteria 1192
337 Ga0496102_0073107 3300048905 Bacteria 3151
338 Ga0496102_0227043 3300048905 Bacteria 1760
339 Ga0496102_0465205 3300048905 Bacteria 1185
340 Ga0496103_0033955 3300048906 Bacteria 3118
341 Ga0496104_0073744 3300048907 Bacteria 3247
342 Ga0496104_0257887 3300048907 Bacteria 1656
343 Ga0496104_0383266 3300048907 Bacteria 1318
344 Ga0496105_0135060 3300048908 Bacteria 2032
345 Ga0496105_0208731 3300048908 Bacteria 1592
346 Ga0496105_0254597 3300048908 Bacteria 1421
347 Ga0496106_0004190 3300048909 Bacteria 10751
348 Ga0496106_0054273 3300048909 Bacteria 3027
349 Ga0496106_0467017 3300048909 Unclassified 1014
350 Ga0496107_0002077 3300048910 Bacteria 12815
351 Ga0496108_0044492 3300048911 Bacteria 3705
352 Ga0496108_0763924 3300048911 Unclassified 835
353 Ga0496109_0035768 3300048912 Bacteria 4482
354 Ga0496109_0545784 3300048912 Bacteria 1093
355 Ga0496110_0068069 3300048913 Bacteria 3151
356 Ga0496110_0407906 3300048913 Unclassified 1239
357 Ga0496111_0008831 3300048914 Bacteria 6696
358 Ga0496112_0037123 3300048915 Bacteria 4757
359 Ga0496112_0226985 3300048915 Bacteria 1822
360 Ga0496112_0257099 3300048915 Bacteria 1696
361 Ga0496112_0370632 3300048915 Unclassified 1373
362 Ga0496112_0615203 3300048915 Bacteria 1017
363 Ga0496113_0114978 3300048916 Bacteria 2098
364 Ga0496113_0326429 3300048916 Bacteria 1230
365 Ga0496113_0372824 3300048916 Bacteria 1145
366 Ga0496114_0072409 3300048917 Bacteria 2898
367 Ga0496115_0096756 3300048918 Bacteria 2417
368 Ga0496115_0201835 3300048918 Bacteria 1642
369 Ga0496115_0415287 3300048918 Bacteria 1090
370 Ga0496126_0073025 3300048929 Bacteria 3051
371 Ga0501032_0365024 3300049569 Bacteria 929
372 Ga0501033_0696586 3300049570 Bacteria 691
373 Ga0501034_0234959 3300049571 Bacteria 1781
374 Ga0501036_0042851 3300049572 Bacteria 3832
375 Ga0501036_1021184 3300049572 Bacteria 677
376 Ga0501038_0055518 3300049574 Bacteria 3402
377 Ga0501038_0062043 3300049574 Bacteria 3195
378 Ga0501038_0526967 3300049574 Bacteria 901
379 Ga0501041_0407429 3300049577 Bacteria 862
380 Ga0501043_0067086 3300049579 Bacteria 2818
381 Ga0501047_0001978 3300049581 Bacteria 19663
382 Ga0501047_0009534 3300049581 Bacteria 9176
383 Ga0501048_0877924 3300049582 Bacteria 645
384 Ga0501067_0089304 3300049583 Bacteria 1710
385 Ga0501068_0214262 3300049584 Bacteria 1223
386 Ga0501069_0001433 3300049585 Bacteria 11699
387 Ga0501070_0002086 3300049586 Bacteria 17544
388 Ga0501071_0729953 3300049587 Bacteria 763
389 Ga0501072_0065161 3300049588 Bacteria 2873
390 Ga0501073_0000593 3300049589 Bacteria 25499
391 Ga0501073_0214834 3300049589 Bacteria 1329
392 Ga0501074_0001408 3300049590 Bacteria 16023
393 Ga0501075_0526795 3300049591 Bacteria 902
394 Ga0501076_0222884 3300049592 Bacteria 1541
395 Ga0501079_0007049 3300049741 Bacteria 8479
396 Ga0501079_0326204 3300049741 Bacteria 1202
397 Ga0501080_0092806 3300049742 Bacteria 2803
398 Ga0501083_0011585 3300049744 Bacteria 6184
399 Ga0501083_0017058 3300049744 Bacteria 5070
400 Ga0501083_0046687 3300049744 Bacteria 2927
401 Ga0501035_0132923 3300049822 Bacteria 2168
402 Ga0501045_0114227 3300049824 Bacteria 2002
403 nmdc:mga0yw44_152744_c1 3300050492 Bacteria 1507
404 nmdc:mga05p37_91860_c1 3300050507 Bacteria 3740
405 nmdc:mga0qj67_97617_c1 3300050509 Bacteria 2366
406 nmdc:mga08y16_454710_c1 3300050511 Bacteria 1305
407 nmdc:mga0n895_171463_c1 3300050512 Bacteria 2202
408 nmdc:mga0n895_32642_c1 3300050512 Bacteria 4998
409 nmdc:mga0n895_38169_c1 3300050512 Bacteria 4652
410 nmdc:mga0n895_68061_c1 3300050512 Bacteria 3527
411 nmdc:mga0rr50_10090_c1 3300050513 Bacteria 5976
412 nmdc:mga0rr50_188303_c1 3300050513 Bacteria 1690
413 nmdc:mga0rr50_287629_c1 3300050513 Bacteria 1373
414 nmdc:mga0rr50_52036_c1 3300050513 Bacteria 3041
415 nmdc:mga08x19_235634_c1 3300050514 Bacteria 1261
416 nmdc:mga08x19_73533_c1 3300050514 Bacteria 2232
417 Ga0495601_0304068 3300053077 Bacteria 1039
418 Ga0495595_0028099 3300053084 Bacteria 2510
419 Ga0495619_0001867 3300053085 Bacteria 14031
420 Ga0500562_000071 3300053108 Bacteria 49821
421 Ga0500616_0022616 3300053153 Bacteria 3508
422 Ga0500645_029575 3300053730 Bacteria 1653
423 Ga0501084_0042100 3300054114 Bacteria 3820
424 Ga0501084_0084814 3300054114 Bacteria 2659
425 Ga0501084_0794522 3300054114 Bacteria 797
426 Ga0501082_0029814 3300060353 Bacteria 4700
427 Ga0501082_0056457 3300060353 Bacteria 3382
428 Ga0501082_0081946 3300060353 Bacteria 2784
429 Ga0501082_0107740 3300060353 Bacteria 2411
430 Ga0466962_0099665 3300061719 Bacteria 1395
431 2508728442 2508501050 Bacteria 9633614
432 2509078420 2508501114 Bacteria 7082538
433 2774872614 2773857925 Bacteria 6472445
434 Ga0099795_10041635
435 Ga0070658_10082464
436 Ga0070676_10058291
437 Ga0070683_100549889
438 Ga0070683_100896485
439 Ga0068869_100513862
440 Ga0070666_10014445
441 Ga0070680_100135259
442 Ga0070680_100880957
443 Ga0068868_100987400
444 Ga0070660_100105585
445 Ga0070660_100517268
446 Ga0070668_100163428
447 Ga0070668_100294609
448 Ga0070671_100325795
449 Ga0070659_100468478
450 Ga0070709_10003530
451 Ga0070714_100202879
452 Ga0070714_100284107
453 Ga0070713_100001980
454 Ga0070713_100004676
455 Ga0070713_100766905
456 Ga0070710_10001979
457 Ga0070711_100128933
458 Ga0070711_100615256
459 Ga0070708_100022231
460 Ga0070663_100058214
461 Ga0070662_100854666
462 Ga0070681_10081987
463 Ga0070681_10195012
464 Ga0070681_10276625
465 Ga0070685_10007924
466 Ga0070706_100000049
467 Ga0070706_100014523
468 Ga0070707_100005499
469 Ga0070707_100013646
470 Ga0070698_100055749
471 Ga0070698_100311976
472 Ga0070699_100022639
473 Ga0070699_100835653
474 Ga0070679_100383809
475 Ga0070679_100613673
476 Ga0070684_100133845
477 Ga0070684_100442595
478 Ga0070697_100045410
479 Ga0070696_100150462
480 Ga0070665_100531780
481 Ga0070665_100883827
482 Ga0070704_100375127
483 Ga0068855_100397658
484 Ga0070664_100194793
485 Ga0070664_100375698
486 Ga0068857_100083595
487 Ga0068854_100073261
488 Ga0068856_100000082
489 Ga0068856_100025096
490 Ga0068856_100140564
491 Ga0068856_100185208
492 Ga0068856_100233714
493 Ga0070702_100013875
494 Ga0068852_100300174
495 Ga0068852_100398499
496 Ga0068859_100334467
497 Ga0068864_100027332
498 Ga0068861_100149395
499 Ga0068863_100033568
500 Ga0068858_100399478
501 Ga0068858_100401290
502 Ga0068860_100420010
503 Ga0070717_10000822
504 Ga0070717_10249235
505 Ga0075365_10188534
506 Ga0075365_10249487
507 Ga0070715_10001175
508 Ga0070716_100005712
509 Ga0097621_100024616
510 Ga0068871_100001532
511 Ga0075430_100057195
512 Ga0075431_100025010
513 Ga0075434_100029208
514 Ga0075434_100949254
515 Ga0075429_100036912
516 Ga0068865_100087701
517 Ga0075436_100056593
518 Ga0075436_100063284
519 Ga0097620_100334490
520 Ga0075435_100033922
521 Ga0075435_100613804
522 Ga0105251_10008054
523 Ga0105240_10136975
524 Ga0105240_10191584
525 Ga0105240_10379673
526 Ga0111539_10351389
527 Ga0111539_10367269
528 Ga0105247_10259743
529 Ga0105247_10484985
530 Ga0114129_10109702
531 Ga0114129_10899833
532 Ga0105243_10029809
533 Ga0105243_10720439
534 Ga0105241_10022839
535 Ga0105242_10056179
536 Ga0105238_10062579
537 Ga0105238_11415368
538 Ga0105249_10313259
539 Ga0105249_10683174
540 Ga0099796_10000728
541 Ga0105239_11301131
542 Ga0105246_10291287
543 Ga0157336_1005434
544 Ga0157324_1001374
545 Ga0157342_1005995
546 Ga0157315_1013295
547 Ga0157316_1003834
548 Ga0157338_1000859
549 Ga0157370_10266939
550 Ga0157369_10261006
551 Ga0157374_10736238
552 Ga0157378_10519291
553 Ga0163162_10154327
554 Ga0157375_10229961
555 Ga0163163_10241365
556 Ga0157380_10031592
557 Ga0157380_10208700
558 Ga0157380_10287073
559 Ga0182008_10034859
560 Ga0182008_10044487
561 Ga0157379_10679778
562 Ga0157376_10499390
563 Ga0213873_10050225
564 Ga0213875_10049912
565 Ga0209676_1000159
566 Ga0209050_1015498
567 Ga0207710_10002649
568 Ga0207680_10021180
569 Ga0207699_10012841
570 Ga0207699_10103324
571 Ga0207645_10057842
572 Ga0207705_10256510
573 Ga0207684_10000011
574 Ga0207654_10142304
575 Ga0207707_10140953
576 Ga0207707_10185944
577 Ga0207695_10166456
578 Ga0207695_10504311
579 Ga0207671_10060791
580 Ga0207693_10009353
581 Ga0207693_10028814
582 Ga0207663_10291682
583 Ga0207657_10114608
584 Ga0207657_10525390
585 Ga0207649_10107666
586 Ga0207652_10213676
587 Ga0207646_10008409
588 Ga0207646_10575859
589 Ga0207694_10270678
590 Ga0207659_10035596
591 Ga0207700_10008262
592 Ga0207700_10012467
593 Ga0207664_10027142
594 Ga0207644_10035998
595 Ga0207706_10353631
596 Ga0207686_10046149
597 Ga0207709_10224470
598 Ga0207669_10174528
599 Ga0207704_10105432
600 Ga0207665_10060309
601 Ga0207711_10017313
602 Ga0207689_10488844
603 Ga0207661_10039367
604 Ga0207661_10545863
605 Ga0207679_10063181
606 Ga0207679_10773537
607 Ga0207667_10063548
608 Ga0207667_10713791
609 Ga0207651_10420713
610 Ga0207712_10574889
611 Ga0207658_10049041
612 Ga0207677_10031724
613 Ga0207639_10639958
614 Ga0207678_10029152
615 Ga0207678_10406922
616 Ga0207702_10000048
617 Ga0207702_10187257
618 Ga0207641_10096191
619 Ga0207676_10132064
620 Ga0207675_100068700
621 Ga0207683_10002032
622 Ga0209179_1005421
623 Ga0209974_10023829
624 Ga0268266_10025477
625 Ga0268266_10646640
626 Ga0265330_10062629
627 Ga0265330_10062985
628 Ga0265332_10000227
629 Ga0265332_10006558
630 Ga0265328_10084878
631 Ga0265320_10028991
632 Ga0265325_10005176
633 Ga0265325_10055397
634 Ga0265325_10336702
635 Ga0265340_10001172
636 Ga0265340_10009212
637 Ga0265340_10082122
638 Ga0265340_10084863
639 Ga0265339_10009213
640 Ga0265339_10215320
641 Ga0265331_10029749
642 Ga0265331_10097472
643 Ga0265331_10128203
644 Ga0265316_10094085
645 Ga0265316_10109203
646 Ga0265313_10011747
647 Ga0265313_10039343
648 Ga0265314_10041082
649 Ga0265314_10294290
650 Ga0265342_10000137
651 Ga0307413_10313624
652 Ga0307409_100118738
653 Ga0307416_100009899
654 Ga0307416_100364353
655 Ga0307415_100905722
656 Ga0316583_10001495
657 Ga0373926_0023735
658 Ga0373928_0006359
659 Ga0373929_0018390
660 Ga0373934_0183477
661 Ga0373949_0007194
662 Ga0373923_0064322
663 Ga0373932_0008573
664 Ga0373936_0004917
665 Ga0373939_0010588
666 Ga0373941_0038530
667 Ga0373941_0070779
668 Ga0373945_0005304
669 Ga0373945_0013651
670 Ga0373954_0082316
671 Ga0373956_0022004
672 Ga0373943_0022616
673 Ga0373946_0008284
674 Ga0373955_0009249
675 Ga0373961_0010488
676 Ga0316574_0205844
677 Ga0373924_0082072
678 Ga0373931_0004866
679 Ga0373931_0091428
680 Ga0373935_0005794
681 Ga0373927_0029540
682 Ga0373927_0043235
683 Ga0373927_0063218
684 Ga0373933_0000041
685 Ga0373933_0012503
686 Ga0373947_0001639
687 Ga0373947_0004271
688 Ga0373937_0360385
689 Ga0373937_0901082
690 Ga0373925_0023367
691 Ga0373925_0080248
692 Ga0373925_0258327
693 Ga0373925_0405341
694 Ga0436364_0633668
695 Ga0400486_18375
696 Ga0400487_58895
697 Ga0436365_0606451
698 Ga0436365_1652338
699 Ga0436360_0216104
700 Ga0436361_0156887
701 Ga0436361_0281489
702 Ga0436363_0187609
703 Ga0436362_0149843
704 Ga0436362_1037706
705 Ga0451807_1259783
706 Ga0450890_036348
707 Ga0451577_0068018
708 Ga0451577_0102500
709 Ga0451577_0182799
710 Ga0451577_0472807
711 Ga0451577_0688097
712 Ga0466963_0202405
713 Ga0453684_0006774
714 Ga0453684_0043386
715 Ga0453684_0166876
716 Ga0453684_0447258
717 Ga0466959_0015780
718 Ga0451576_0001069
719 Ga0451576_0006250
720 Ga0451576_0241404
721 Ga0451576_0343975
722 Ga0495592_0068767
723 Ga0495603_0105123
724 Ga0495629_0000688
725 Ga0495641_0020267
726 Ga0495641_0051428
727 Ga0495580_0027556
728 Ga0495580_0049994
729 Ga0495582_0002698
730 Ga0495582_0011725
731 Ga0495639_0045983
732 Ga0495662_0037447
733 Ga0495584_0054179
734 Ga0495585_0013732
735 Ga0495594_0019571
736 Ga0495628_0026351
737 Ga0495630_0036667
738 Ga0495630_0096341
739 Ga0495643_0121547
740 Ga0495663_0042432
741 Ga0495666_0010363
742 Ga0495665_0002653
743 Ga0495586_0150969
744 Ga0495587_0075784
745 Ga0495622_0061458
746 Ga0495633_0004645
747 Ga0495667_0040453
748 Ga0495656_0000194
749 Ga0495634_0155945
750 Ga0495611_0004273
751 Ga0495635_0023837
752 Ga0495659_0004606
753 Ga0495588_0013111
754 Ga0495599_0007081
755 Ga0495646_0022708
756 Ga0495647_0007046
757 Ga0495658_0000246
758 Ga0495658_0005203
759 Ga0495669_0111904
760 Ga0495613_0034537
761 Ga0495670_0000200
762 Ga0495600_0002311
763 Ga0495674_0105056
764 Ga0495676_0235276
765 Ga0495680_0010106
766 Ga0495684_0007729
767 Ga0495615_0155183
768 Ga0496100_0008551
769 Ga0496101_0332575
770 Ga0496102_0073107
771 Ga0496102_0227043
772 Ga0496102_0465205
773 Ga0496103_0033955
774 Ga0496104_0073744
775 Ga0496104_0257887
776 Ga0496104_0383266
777 Ga0496105_0135060
778 Ga0496105_0208731
779 Ga0496105_0254597
780 Ga0496106_0004190
781 Ga0496106_0054273
782 Ga0496106_0467017
783 Ga0496107_0002077
784 Ga0496108_0044492
785 Ga0496108_0763924
786 Ga0496109_0035768
787 Ga0496109_0545784
788 Ga0496110_0068069
789 Ga0496110_0407906
790 Ga0496111_0008831
791 Ga0496112_0037123
792 Ga0496112_0226985
793 Ga0496112_0257099
794 Ga0496112_0370632
795 Ga0496112_0615203
796 Ga0496113_0114978
797 Ga0496113_0326429
798 Ga0496113_0372824
799 Ga0496114_0072409
800 Ga0496115_0096756
801 Ga0496115_0201835
802 Ga0496115_0415287
803 Ga0496126_0073025
804 Ga0501032_0365024
805 Ga0501033_0696586
806 Ga0501034_0234959
807 Ga0501036_0042851
808 Ga0501036_1021184
809 Ga0501038_0055518
810 Ga0501038_0062043
811 Ga0501038_0526967
812 Ga0501041_0407429
813 Ga0501043_0067086
814 Ga0501047_0001978
815 Ga0501047_0009534
816 Ga0501048_0877924
817 Ga0501067_0089304
818 Ga0501068_0214262
819 Ga0501069_0001433
820 Ga0501070_0002086
821 Ga0501071_0729953
822 Ga0501072_0065161
823 Ga0501073_0000593
824 Ga0501073_0214834
825 Ga0501074_0001408
826 Ga0501075_0526795
827 Ga0501076_0222884
828 Ga0501079_0007049
829 Ga0501079_0326204
830 Ga0501080_0092806
831 Ga0501083_0011585
832 Ga0501083_0017058
833 Ga0501083_0046687
834 Ga0501035_0132923
835 Ga0501045_0114227
836 nmdc:mga0yw44_152744_c1
837 nmdc:mga05p37_91860_c1
838 nmdc:mga0qj67_97617_c1
839 nmdc:mga08y16_454710_c1
840 nmdc:mga0n895_171463_c1
841 nmdc:mga0n895_32642_c1
842 nmdc:mga0n895_38169_c1
843 nmdc:mga0n895_68061_c1
844 nmdc:mga0rr50_10090_c1
845 nmdc:mga0rr50_188303_c1
846 nmdc:mga0rr50_287629_c1
847 nmdc:mga0rr50_52036_c1
848 nmdc:mga08x19_235634_c1
849 nmdc:mga08x19_73533_c1
850 Ga0495601_0304068
851 Ga0495595_0028099
852 Ga0495619_0001867
853 Ga0500562_000071
854 Ga0500616_0022616
855 Ga0500645_029575
856 Ga0501084_0042100
857 Ga0501084_0084814
858 Ga0501084_0794522
859 Ga0501082_0029814
860 Ga0501082_0056457
861 Ga0501082_0081946
862 Ga0501082_0107740
863 Ga0466962_0099665
864 2508728442
865 2509078420
866 2774872614

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00551

Formyl_trans_N

Formyl transferase

4

181

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3auf-assembly1.cif.gz_A-2 crystal structure of glycinamide ribonucleotide transformylase 1 from symbiobacterium toebii 0.9715 3 202
2ywr-assembly1.cif.gz_A crystal structure of gar transformylase from aquifex aeolicus 0.9694 4 205
1c2t-assembly1.cif.gz_A new insights into inhibitor design from the crystal structure and nmr studies of e. coli gar transformylase in complex with beta-gar and 10-formyl-5,8,10-trideazafolic acid. 0.9662 5 204
5j9f-assembly2.cif.gz_A human gar transformylase in complex with gar and (4-{[2-(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)ethyl]amino}benzoyl)-l-glutamic acid (agf183) 0.9621 5 202
4zyv-assembly1.cif.gz_A human gar transformylase in complex with gar and n-({5-[(2-amino-4-oxo-4,7-dihydro-3h-pyrrolo[2,3-d]pyrimidin-6-yl)butyl]thiophen-2-yl}carbonyl)-l-glutamic acid (agf71) 0.9618 5 203
ID Description Score Start End Superfamily
af_Q20143_783_975_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9884 2 191 3.40.50.170
3aufA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9715 3 202 3.40.50.170
1njsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9635 5 202 3.40.50.170
2ywrA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9564 5 205 3.40.50.170
4s1nA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.9542 4 188 3.40.50.170
ID Description Score Start End GO Terms
AF-A0A326KWL4-F1-model_v4 deleted 0.9951 3 190
AF-A0A4R4DV83-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9925 2 215 GO:0004644
GO:0005829
GO:0006189
AF-A0A381TCJ8-F1-model_v4 phosphoribosylglycinamide formyltransferase 1 (EC 2.1.2.2) 0.9923 17 160 GO:0004644
GO:0005829
GO:0006189
AF-A0A061IBE4-F1-model_v4 Trifunctional purine biosynthetic protein adenosine-3 [Includes: Phosphoribosylamine--glycine ligase (EC 6.3.4.13) (Glycinamide ribonucleotide synthetase) (GARS) (Phosphoribosylglycinamide synthetase); Phosphoribosylformylglycinamidine cyclo-ligase (EC 6.3.3.1) (AIR synthase) (AIRS) (Phosphoribosyl-aminoimidazole synthetase); Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART)] 0.9922 2 187 GO:0004637
GO:0004641
GO:0004644
GO:0005524
GO:0005829
GO:0006189
GO:0046084
GO:0046872
AF-A0A1G7VXV0-F1-model_v4 Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2) (5'-phosphoribosylglycinamide transformylase) (GAR transformylase) (GART) 0.9919 2 217 GO:0004644
GO:0005829
GO:0006189

Map