F442450

General Info

Members Datasets Scaffolds Average Seq Length
431 220 423 299

Family's Representative Sequence

Representative Sequence 3300046692|Ga0495671_0051387|Ga0495671_0051387_849_1832
Length 327
Sequence LTDEASIKPSDPIQPATGTPESGGPKDTKKADKTAKGTDWWAEFKSIGLLVLAVLAFHSFIAKPFYIPSESMMPGMLVGDRLVVTKYAYGWSYVSPTIPNPAAIFRNVVLRMPAEPWGITLPFMKGRIWGKMPERGDIVIATPRHTNEDYIKRVIGLPGDLLEVRDGVVILNGTPVSQVTLPPLRLPVDANAPCDPRQFPGALQWQTDGSSVCVLPIKRETLPNGRTYVIIDMGPREIDWYGPIRIPEGEVFLMGDNRDNSADSRVSLEQQGLGGAIPWETIGGRAEFITFSLDGSTTLNPATWVSGFRSGRAGMSLHPQQTTPAKP

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
3 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
4 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
5 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
6 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
7 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
8 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
9 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
10 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
11 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
12 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
13 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
14 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
15 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
16 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
17 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
18 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
19 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
20 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
21 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
22 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
23 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
24 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
25 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
26 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
27 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
28 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
29 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
67 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
88 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
133 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
134 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
135 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
136 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
137 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
138 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
139 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
140 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
141 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
142 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
143 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
147 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
148 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
149 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
150 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
151 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
152 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
153 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
156 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
157 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
161 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
162 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
167 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
168 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
169 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
172 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
173 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
174 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
178 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
186 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
187 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
188 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
189 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
190 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
191 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
192 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049551 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
197 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
198 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
199 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
200 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
201 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
202 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
203 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
204 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
205 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
206 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
207 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
208 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
212 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
213 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
214 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
215 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
216 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
217 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
218 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.91
Metatranscriptomes 0.23
Isolates 1.86

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.57
Nodule 0
Rhizoplane 2.55
Rhizosphere 86.31
Stem 0
Stem Tuber 0
Unclassified 5.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2117351 2162886007 Bacteria 4365
2 SwRhRL2b_contig_3140714 2162886007 Bacteria 1886
3 JGI24736J21556_1007576 3300001904 Bacteria 1822
4 JGI24741J21665_1000122 3300001915 Bacteria 20977
5 JGI24752J21851_1000144 3300001976 Bacteria 9609
6 JGI24752J21851_1003532 3300001976 Bacteria 2059
7 JGI24740J21852_10003671 3300001979 Bacteria 6681
8 JGI24739J22299_10006212 3300001989 Bacteria 4513
9 JGI24737J22298_10003975 3300001990 Bacteria 5177
10 JGI24735J21928_10003977 3300002067 Bacteria 5001
11 JGI24738J21930_10001981 3300002075 Bacteria 5507
12 JGI24749J21850_1010613 3300002076 Bacteria 1292
13 JGI24034J26672_10000020 3300002239 Bacteria 122643
14 JGI24742J22300_10006615 3300002244 Bacteria 1911
15 Ga0065704_10000610 3300005289 Bacteria 15295
16 Ga0065704_10002566 3300005289 Bacteria 5008
17 Ga0065712_10092842 3300005290 Bacteria 2316
18 Ga0065715_10000342 3300005293 Bacteria 14168
19 Ga0070658_10142733 3300005327 Bacteria 2001
20 Ga0070658_10242500 3300005327 Bacteria 1528
21 Ga0070676_10025667 3300005328 Bacteria 3332
22 Ga0070690_100000181 3300005330 Bacteria 32447
23 Ga0070690_100163231 3300005330 Bacteria 1528
24 Ga0070670_100004423 3300005331 Bacteria 11771
25 Ga0070670_100027650 3300005331 Bacteria 4879
26 Ga0070677_10007105 3300005333 Bacteria 3729
27 Ga0070666_10000027 3300005335 Bacteria 151010
28 Ga0070666_10000116 3300005335 Bacteria 55252
29 Ga0070666_10093706 3300005335 Bacteria 2065
30 Ga0070666_10208120 3300005335 Bacteria 1377
31 Ga0070660_100443929 3300005339 Bacteria 1076
32 Ga0070689_100025504 3300005340 Bacteria 4442
33 Ga0070661_100025879 3300005344 Bacteria 4217
34 Ga0070668_100000360 3300005347 Bacteria 30094
35 Ga0070668_100008276 3300005347 Bacteria 7719
36 Ga0070668_100014980 3300005347 Bacteria 5792
37 Ga0070668_100034649 3300005347 Bacteria 3848
38 Ga0070669_100000004 3300005353 Bacteria 314707
39 Ga0070669_100000099 3300005353 Bacteria 85328
40 Ga0070669_100038882 3300005353 Bacteria 3455
41 Ga0070669_100065048 3300005353 Bacteria 2686
42 Ga0070675_100036089 3300005354 Bacteria 4020
43 Ga0070671_100000004 3300005355 Bacteria 262155
44 Ga0070671_100012010 3300005355 Bacteria 6966
45 Ga0070671_100206158 3300005355 Bacteria 1667
46 Ga0070674_100011729 3300005356 Bacteria 5346
47 Ga0070673_100012023 3300005364 Bacteria 5929
48 Ga0070688_100003794 3300005365 Bacteria 7834
49 Ga0070659_100127009 3300005366 Bacteria 2069
50 Ga0070667_100000051 3300005367 Bacteria 155117
51 Ga0070667_100002080 3300005367 Bacteria 17708
52 Ga0070667_100036759 3300005367 Bacteria 4106
53 Ga0070701_10209299 3300005438 Bacteria 1157
54 Ga0070705_100094880 3300005440 Bacteria 1869
55 Ga0070708_100080653 3300005445 Bacteria 2945
56 Ga0070663_100006741 3300005455 Bacteria 6935
57 Ga0070663_100053947 3300005455 Bacteria 2872
58 Ga0070662_100000256 3300005457 Bacteria 31436
59 Ga0070662_100031690 3300005457 Bacteria 3712
60 Ga0068867_100015138 3300005459 Bacteria 5469
61 Ga0070685_10000040 3300005466 Bacteria 77295
62 Ga0068853_100002388 3300005539 Bacteria 14035
63 Ga0068853_100018460 3300005539 Bacteria 5773
64 Ga0070672_100000621 3300005543 Bacteria 20802
65 Ga0070686_100000010 3300005544 Bacteria 192116
66 Ga0070665_100000331 3300005548 Bacteria 72744
67 Ga0070665_100020373 3300005548 Bacteria 6661
68 Ga0070665_100374977 3300005548 Bacteria 1430
69 Ga0068855_100000667 3300005563 Bacteria 41874
70 Ga0070664_100011185 3300005564 Bacteria 7279
71 Ga0070664_100029991 3300005564 Bacteria 4536
72 Ga0068857_100143203 3300005577 Bacteria 2162
73 Ga0068854_100127258 3300005578 Bacteria 1941
74 Ga0068856_100027241 3300005614 Bacteria 5576
75 Ga0068852_100404867 3300005616 Bacteria 1343
76 Ga0068859_100000965 3300005617 Bacteria 29425
77 Ga0068859_100001079 3300005617 Bacteria 27844
78 Ga0068859_100205304 3300005617 Bacteria 2055
79 Ga0068859_100255100 3300005617 Bacteria 1844
80 Ga0068864_100000544 3300005618 Bacteria 32111
81 Ga0068864_100016801 3300005618 Bacteria 6099
82 Ga0068864_100019971 3300005618 Bacteria 5602
83 Ga0068861_100000203 3300005719 Bacteria 31717
84 Ga0068863_100000028 3300005841 Bacteria 181662
85 Ga0068863_100000148 3300005841 Bacteria 73607
86 Ga0068863_100006139 3300005841 Bacteria 11783
87 Ga0068863_100010100 3300005841 Bacteria 9182
88 Ga0068863_100314666 3300005841 Bacteria 1520
89 Ga0068858_100000782 3300005842 Bacteria 33248
90 Ga0068858_100012984 3300005842 Bacteria 7853
91 Ga0068858_100150227 3300005842 Bacteria 2190
92 Ga0068860_100000080 3300005843 Bacteria 170152
93 Ga0068860_100002431 3300005843 Bacteria 19566
94 Ga0068860_100014490 3300005843 Bacteria 7719
95 Ga0068860_100038862 3300005843 Bacteria 4553
96 Ga0068862_100000115 3300005844 Bacteria 94951
97 Ga0068862_100000125 3300005844 Bacteria 89536
98 Ga0068862_100000716 3300005844 Bacteria 33750
99 Ga0068862_100018753 3300005844 Bacteria 5764
100 Ga0068862_100175310 3300005844 Bacteria 1922
101 Ga0081455_10000220 3300005937 Bacteria 73579
102 Ga0075368_10000788 3300006042 Bacteria 9738
103 Ga0075370_10021011 3300006353 Bacteria 3574
104 Ga0075370_10072979 3300006353 Bacteria 1965
105 Ga0097620_100000965 3300006931 Bacteria 29425
106 Ga0097620_100001079 3300006931 Bacteria 27844
107 Ga0097620_100205304 3300006931 Bacteria 2055
108 Ga0097620_100255114 3300006931 Bacteria 1844
109 Ga0105251_10009976 3300009011 Bacteria 5555
110 Ga0105240_10023652 3300009093 Bacteria 8116
111 Ga0111539_10090991 3300009094 Bacteria 3585
112 Ga0105247_10032283 3300009101 Bacteria 3181
113 Ga0105247_10127532 3300009101 Bacteria 1655
114 Ga0114129_10288778 3300009147 Bacteria 2189
115 Ga0105241_10012493 3300009174 Bacteria 6226
116 Ga0105248_10021643 3300009177 Bacteria 7122
117 Ga0105248_10111958 3300009177 Bacteria 3079
118 Ga0105248_10379822 3300009177 Bacteria 1591
119 Ga0105238_10071766 3300009551 Bacteria 3460
120 Ga0105238_10074003 3300009551 Bacteria 3400
121 Ga0105238_10491279 3300009551 Bacteria 1227
122 Ga0105249_10000015 3300009553 Bacteria 282138
123 Ga0105249_10000064 3300009553 Bacteria 151646
124 Ga0105249_10002202 3300009553 Bacteria 16889
125 Ga0105249_10027457 3300009553 Bacteria 5135
126 Ga0105249_10087935 3300009553 Bacteria 2901
127 Ga0105148_100168 3300009978 Bacteria 9710
128 Ga0157373_10168307 3300013100 Bacteria 1542
129 Ga0163162_10004217 3300013306 Bacteria 13820
130 Ga0163162_10413928 3300013306 Bacteria 1480
131 Ga0163162_10563180 3300013306 Bacteria 1267
132 Ga0163163_10055648 3300014325 Bacteria 3910
133 Ga0163163_10252812 3300014325 Bacteria 1813
134 Ga0157380_10002524 3300014326 Bacteria 12351
135 Ga0157380_10009996 3300014326 Bacteria 6811
136 Ga0157380_10106500 3300014326 Bacteria 2346
137 Ga0157380_10228692 3300014326 Bacteria 1669
138 Ga0157379_10010623 3300014968 Bacteria 8026
139 Ga0157379_10025000 3300014968 Bacteria 5302
140 Ga0163161_10002050 3300017792 Bacteria 14595
141 Ga0163161_10002866 3300017792 Bacteria 12225
142 Ga0163161_10194302 3300017792 Bacteria 1561
143 Ga0213875_10001550 3300021388 Bacteria 14740
144 Ga0209147_101579 3300025229 Bacteria 7727
145 Ga0207697_10000510 3300025315 Bacteria 21916
146 Ga0207697_10000699 3300025315 Bacteria 19087
147 Ga0207656_10026128 3300025321 Bacteria 2377
148 Ga0207713_1014322 3300025735 Bacteria 4129
149 Ga0207682_10000666 3300025893 Bacteria 16058
150 Ga0207710_10004106 3300025900 Bacteria 6395
151 Ga0207710_10008307 3300025900 Bacteria 4382
152 Ga0207688_10067846 3300025901 Bacteria 2019
153 Ga0207680_10000009 3300025903 Bacteria 464571
154 Ga0207680_10000253 3300025903 Bacteria 25735
155 Ga0207680_10048965 3300025903 Bacteria 2513
156 Ga0207647_10026225 3300025904 Bacteria 3816
157 Ga0207645_10019790 3300025907 Bacteria 4410
158 Ga0207654_10051853 3300025911 Bacteria 2363
159 Ga0207695_10030830 3300025913 Bacteria 5899
160 Ga0207657_10017233 3300025919 Bacteria 6936
161 Ga0207681_10000010 3300025923 Bacteria 403379
162 Ga0207681_10003625 3300025923 Bacteria 9599
163 Ga0207681_10010008 3300025923 Bacteria 5804
164 Ga0207681_10042469 3300025923 Bacteria 3038
165 Ga0207681_10058001 3300025923 Bacteria 2649
166 Ga0207681_10236051 3300025923 Bacteria 1421
167 Ga0207694_10085769 3300025924 Bacteria 2479
168 Ga0207650_10002156 3300025925 Bacteria 13756
169 Ga0207650_10002978 3300025925 Bacteria 11686
170 Ga0207650_10119304 3300025925 Bacteria 2051
171 Ga0207659_10005663 3300025926 Bacteria 7601
172 Ga0207644_10000007 3300025931 Bacteria 381778
173 Ga0207644_10272114 3300025931 Bacteria 1357
174 Ga0207706_10000890 3300025933 Bacteria 30672
175 Ga0207706_10032421 3300025933 Bacteria 4653
176 Ga0207670_10071222 3300025936 Bacteria 2403
177 Ga0207691_10003939 3300025940 Bacteria 14420
178 Ga0207691_10566704 3300025940 Bacteria 962
179 Ga0207711_10046882 3300025941 Bacteria 3693
180 Ga0207711_10082923 3300025941 Bacteria 2803
181 Ga0207711_10227987 3300025941 Bacteria 1706
182 Ga0207711_10264411 3300025941 Bacteria 1582
183 Ga0207679_10200265 3300025945 Bacteria 1667
184 Ga0207667_10003599 3300025949 Bacteria 19130
185 Ga0207667_10212027 3300025949 Bacteria 1985
186 Ga0207667_10345196 3300025949 Bacteria 1518
187 Ga0207651_10003751 3300025960 Bacteria 7519
188 Ga0207712_10000023 3300025961 Bacteria 282081
189 Ga0207712_10000044 3300025961 Bacteria 171240
190 Ga0207712_10009156 3300025961 Bacteria 6266
191 Ga0207712_10010030 3300025961 Bacteria 6004
192 Ga0207668_10000781 3300025972 Bacteria 19505
193 Ga0207668_10001156 3300025972 Bacteria 15685
194 Ga0207668_10007581 3300025972 Bacteria 6459
195 Ga0207668_10099722 3300025972 Bacteria 2155
196 Ga0207640_10007589 3300025981 Bacteria 5990
197 Ga0207658_10000057 3300025986 Bacteria 124003
198 Ga0207658_10000340 3300025986 Bacteria 46680
199 Ga0207658_10005466 3300025986 Bacteria 8714
200 Ga0207703_10002337 3300026035 Bacteria 16540
201 Ga0207703_10014818 3300026035 Bacteria 6084
202 Ga0207703_10016442 3300026035 Bacteria 5769
203 Ga0207639_10000263 3300026041 Bacteria 37984
204 Ga0207639_10002831 3300026041 Bacteria 11641
205 Ga0207639_10007777 3300026041 Bacteria 7321
206 Ga0207639_10177109 3300026041 Bacteria 1811
207 Ga0207678_10000427 3300026067 Bacteria 38170
208 Ga0207678_10026437 3300026067 Bacteria 5062
209 Ga0207702_10003972 3300026078 Bacteria 13278
210 Ga0207641_10000014 3300026088 Bacteria 336170
211 Ga0207641_10000672 3300026088 Bacteria 37136
212 Ga0207641_10004614 3300026088 Bacteria 11895
213 Ga0207641_10284330 3300026088 Bacteria 1557
214 Ga0207676_10001067 3300026095 Bacteria 20877
215 Ga0207676_10001455 3300026095 Bacteria 17617
216 Ga0207676_10026890 3300026095 Bacteria 4280
217 Ga0207674_10000748 3300026116 Bacteria 42600
218 Ga0207674_10038660 3300026116 Bacteria 4949
219 Ga0207674_10059907 3300026116 Bacteria 3851
220 Ga0207675_100000329 3300026118 Bacteria 45296
221 Ga0207675_100001681 3300026118 Bacteria 22129
222 Ga0207675_100025310 3300026118 Bacteria 5522
223 Ga0207683_10029943 3300026121 Bacteria 4715
224 Ga0207698_10098839 3300026142 Bacteria 2412
225 Ga0207698_10163347 3300026142 Bacteria 1951
226 Ga0209967_1009484 3300027364 Bacteria 1349
227 Ga0209813_10000036 3300027866 Bacteria 58545
228 Ga0268266_10000069 3300028379 Bacteria 239714
229 Ga0268266_10015032 3300028379 Bacteria 6645
230 Ga0268265_10000049 3300028380 Bacteria 177242
231 Ga0268265_10000058 3300028380 Bacteria 154702
232 Ga0268265_10000100 3300028380 Bacteria 108659
233 Ga0268265_10025071 3300028380 Bacteria 4227
234 Ga0268265_10058528 3300028380 Bacteria 2943
235 Ga0268264_10000106 3300028381 Bacteria 210031
236 Ga0268264_10000131 3300028381 Bacteria 181459
237 Ga0268264_10004912 3300028381 Bacteria 11332
238 Ga0268264_10017061 3300028381 Bacteria 5946
239 Ga0307513_10032566 3300031456 Bacteria 5875
240 Ga0307408_100008614 3300031548 Bacteria 6736
241 Ga0307408_100021102 3300031548 Bacteria 4403
242 Ga0307408_100083213 3300031548 Bacteria 2397
243 Ga0307408_100312667 3300031548 Bacteria 1320
244 Ga0307405_10034136 3300031731 Bacteria 3024
245 Ga0307405_10100632 3300031731 Bacteria 1937
246 Ga0307405_10233072 3300031731 Bacteria 1358
247 Ga0307405_10328254 3300031731 Bacteria 1171
248 Ga0307413_10001771 3300031824 Bacteria 8446
249 Ga0307413_10032390 3300031824 Bacteria 2962
250 Ga0307413_10082179 3300031824 Bacteria 2068
251 Ga0307413_10372510 3300031824 Bacteria 1109
252 Ga0307410_10011091 3300031852 Bacteria 5139
253 Ga0307410_10020928 3300031852 Bacteria 4014
254 Ga0307410_10027404 3300031852 Bacteria 3601
255 Ga0307410_10027899 3300031852 Bacteria 3573
256 Ga0307410_10049433 3300031852 Bacteria 2823
257 Ga0307410_10059985 3300031852 Bacteria 2598
258 Ga0307410_10287256 3300031852 Bacteria 1293
259 Ga0307406_10033614 3300031901 Bacteria 3141
260 Ga0307406_10053147 3300031901 Bacteria 2579
261 Ga0307407_10036414 3300031903 Bacteria 2712
262 Ga0307407_10094766 3300031903 Bacteria 1838
263 Ga0307407_10098577 3300031903 Bacteria 1808
264 Ga0307407_10227097 3300031903 Bacteria 1266
265 Ga0307412_10017451 3300031911 Bacteria 4296
266 Ga0307412_10019089 3300031911 Bacteria 4141
267 Ga0307412_10025530 3300031911 Bacteria 3661
268 Ga0307412_10041908 3300031911 Bacteria 2970
269 Ga0307412_10091484 3300031911 Bacteria 2129
270 Ga0307412_10148667 3300031911 Bacteria 1725
271 Ga0307409_100064124 3300031995 Bacteria 2885
272 Ga0307409_100089784 3300031995 Bacteria 2513
273 Ga0307409_100189730 3300031995 Bacteria 1828
274 Ga0307409_100211893 3300031995 Bacteria 1742
275 Ga0307409_100308995 3300031995 Bacteria 1474
276 Ga0307409_100518053 3300031995 Bacteria 1164
277 Ga0307416_100062682 3300032002 Bacteria 3041
278 Ga0307416_100062862 3300032002 Bacteria 3037
279 Ga0307416_100098057 3300032002 Bacteria 2540
280 Ga0307416_100130057 3300032002 Bacteria 2264
281 Ga0307416_100149479 3300032002 Bacteria 2139
282 Ga0307416_100162545 3300032002 Bacteria 2066
283 Ga0307416_100415631 3300032002 Bacteria 1387
284 Ga0307414_10000391 3300032004 Bacteria 23877
285 Ga0307414_10004205 3300032004 Bacteria 7790
286 Ga0307414_10015813 3300032004 Bacteria 4568
287 Ga0307414_10042547 3300032004 Bacteria 3087
288 Ga0307414_10103244 3300032004 Bacteria 2150
289 Ga0307414_10112436 3300032004 Bacteria 2076
290 Ga0307414_10123727 3300032004 Bacteria 1993
291 Ga0307414_10284737 3300032004 Bacteria 1391
292 Ga0307411_10002491 3300032005 Bacteria 8174
293 Ga0307411_10064759 3300032005 Bacteria 2448
294 Ga0307411_10104009 3300032005 Bacteria 2015
295 Ga0307411_10206028 3300032005 Bacteria 1514
296 Ga0307411_10251042 3300032005 Bacteria 1391
297 Ga0307411_10263017 3300032005 Bacteria 1363
298 Ga0307415_100012775 3300032126 Bacteria 4870
299 Ga0307415_100017044 3300032126 Bacteria 4347
300 Ga0395899_0238529 3300037312 Bacteria 1252
301 Ga0395900_0001132 3300037418 Bacteria 33674
302 Ga0395905_0000083 3300037471 Bacteria 158407
303 Ga0436364_1172297 3300037853 Bacteria 30221
304 Ga0395901_0022949 3300038443 Bacteria 6397
305 Ga0395901_0242614 3300038443 Bacteria 1879
306 Ga0237819_00837 3300038705 Bacteria 9719
307 Ga0237816_01351 3300039145 Bacteria 1985
308 Ga0436363_0767314 3300039450 Bacteria 1592
309 Ga0495617_006370 3300046452 Bacteria 4144
310 Ga0495617_092836 3300046452 Bacteria 984
311 Ga0495627_000225 3300046453 Bacteria 60005
312 Ga0495627_000304 3300046453 Bacteria 48657
313 Ga0495627_023408 3300046453 Bacteria 2024
314 Ga0495638_0000014 3300046460 Bacteria 417060
315 Ga0495638_0051791 3300046460 Bacteria 2560
316 Ga0495650_0001497 3300046471 Bacteria 22267
317 Ga0495650_0054848 3300046471 Bacteria 1625
318 Ga0495584_0044240 3300046491 Bacteria 2247
319 Ga0495583_0000557 3300046506 Bacteria 52013
320 Ga0495610_0000085 3300046512 Bacteria 112390
321 Ga0495616_0001201 3300046513 Bacteria 18292
322 Ga0495632_0000006 3300046519 Bacteria 345883
323 Ga0495632_0000446 3300046519 Bacteria 39306
324 Ga0495637_0008235 3300046520 Bacteria 5127
325 Ga0495643_0000021 3300046522 Bacteria 293465
326 Ga0495648_0000021 3300046524 Bacteria 246945
327 Ga0495648_0061730 3300046524 Bacteria 2224
328 Ga0495663_0000008 3300046525 Bacteria 260614
329 Ga0495663_0000495 3300046525 Bacteria 14217
330 Ga0495654_0003819 3300046530 Bacteria 9110
331 Ga0495598_0005392 3300046537 Bacteria 2831
332 Ga0495633_0000111 3300046558 Bacteria 109982
333 Ga0495633_0006742 3300046558 Bacteria 6755
334 Ga0495633_0012002 3300046558 Bacteria 4631
335 Ga0495633_0031232 3300046558 Bacteria 2584
336 Ga0495668_0013337 3300046616 Bacteria 4852
337 Ga0495668_0028528 3300046616 Bacteria 3156
338 Ga0495668_0236037 3300046616 Bacteria 1001
339 Ga0495625_0019526 3300046660 Bacteria 5253
340 Ga0495625_0222883 3300046660 Bacteria 1235
341 Ga0495670_0010859 3300046691 Bacteria 4475
342 Ga0495670_0018770 3300046691 Bacteria 3406
343 Ga0495670_0036638 3300046691 Bacteria 2444
344 Ga0495670_0175344 3300046691 Bacteria 1130
345 Ga0495670_0204078 3300046691 Bacteria 1047
346 Ga0495671_0000017 3300046692 Bacteria 293465
347 Ga0495671_0000028 3300046692 Bacteria 234938
348 Ga0495671_0051387 3300046692 Bacteria 2050
349 Ga0495672_0122738 3300047320 Bacteria 1378
350 Ga0495677_0006959 3300047445 Bacteria 4247
351 Ga0495677_0013632 3300047445 Bacteria 2959
352 Ga0495673_0000058 3300047469 Bacteria 235044
353 Ga0495681_0000013 3300047470 Bacteria 189155
354 Ga0495681_0005553 3300047470 Bacteria 8422
355 Ga0495686_0030537 3300047472 Bacteria 3499
356 Ga0495686_0079548 3300047472 Bacteria 2004
357 Ga0495686_0141849 3300047472 Bacteria 1417
358 Ga0496101_0096721 3300048904 Bacteria 2204
359 Ga0496102_0015704 3300048905 Bacteria 6597
360 Ga0496103_0003007 3300048906 Bacteria 10406
361 Ga0496103_0132810 3300048906 Bacteria 1590
362 Ga0496104_0120478 3300048907 Bacteria 2519
363 Ga0496107_0147585 3300048910 Bacteria 1739
364 Ga0496108_0032484 3300048911 Bacteria 4335
365 Ga0496108_0082084 3300048911 Bacteria 2733
366 Ga0496110_0207959 3300048913 Bacteria 1778
367 Ga0496110_0239014 3300048913 Bacteria 1653
368 Ga0496111_0173183 3300048914 Bacteria 1604
369 Ga0496117_0007931 3300048920 Bacteria 10203
370 Ga0496117_0012887 3300048920 Bacteria 7330
371 Ga0496118_0024094 3300048921 Bacteria 5264
372 Ga0496119_0102822 3300048922 Bacteria 1601
373 Ga0496121_0001561 3300048924 Bacteria 38247
374 Ga0496122_0000359 3300048925 Bacteria 97927
375 Ga0496122_0022674 3300048925 Bacteria 5573
376 Ga0496123_0002200 3300048926 Bacteria 24799
377 Ga0496123_0141476 3300048926 Bacteria 1315
378 Ga0496124_0016138 3300048927 Bacteria 7123
379 Ga0496124_0142620 3300048927 Bacteria 1888
380 Ga0496125_0019357 3300048928 Bacteria 6423
381 Ga0496125_0040525 3300048928 Bacteria 3994
382 Ga0496125_0135608 3300048928 Bacteria 1722
383 Ga0496125_0144903 3300048928 Bacteria 1644
384 Ga0496126_0017533 3300048929 Bacteria 7132
385 Ga0496126_0025141 3300048929 Bacteria 5735
386 Ga0501335_003882 3300049551 Bacteria 1285
387 Ga0501034_0116472 3300049571 Bacteria 2660
388 Ga0501211_001796 3300049658 Bacteria 2291
389 Ga0501223_000041 3300049663 Bacteria 44520
390 Ga0501223_000186 3300049663 Bacteria 16330
391 Ga0501224_000022 3300049664 Bacteria 64882
392 Ga0501233_001865 3300049668 Bacteria 3660
393 Ga0501235_005053 3300049669 Bacteria 2862
394 Ga0501235_007869 3300049669 Bacteria 2323
395 Ga0501236_008049 3300049670 Bacteria 1332
396 Ga0501221_003750 3300049704 Bacteria 2507
397 Ga0501225_0000056 3300049705 Bacteria 38609
398 Ga0501225_0000342 3300049705 Bacteria 14699
399 Ga0501225_0006128 3300049705 Bacteria 3513
400 Ga0501234_002520 3300049707 Bacteria 2882
401 Ga0501234_014813 3300049707 Bacteria 1225
402 Ga0501226_000090 3300049853 Bacteria 25039
403 nmdc:mga06z11_40_c1 3300050494 Bacteria 53122
404 nmdc:mga04h51_177_c1 3300050495 Bacteria 17972
405 nmdc:mga07m45_53249_c1 3300050496 Bacteria 2286
406 nmdc:mga05p37_597153_c1 3300050507 Bacteria 1247
407 nmdc:mga08y16_77403_c1 3300050511 Bacteria 3468
408 Ga0500643_001804 3300053087 Bacteria 11721
409 Ga0500643_002227 3300053087 Bacteria 10238
410 Ga0500643_004691 3300053087 Bacteria 6084
411 Ga0500643_009705 3300053087 Bacteria 3655
412 Ga0500647_0141354 3300053091 Bacteria 1129
413 Ga0500556_0000158 3300053104 Bacteria 55541
414 Ga0500594_0004016 3300053118 Bacteria 3241
415 Ga0500642_0000001 3300053130 Bacteria 1468402
416 Ga0500559_0001586 3300053136 Bacteria 12679
417 Ga0500559_0043216 3300053136 Bacteria 1968
418 Ga0500624_000012 3300053157 Bacteria 165895
419 Ga0500624_000095 3300053157 Bacteria 43267
420 Ga0500627_0000845 3300053158 Bacteria 8189
421 Ga0500627_0001510 3300053158 Bacteria 6542
422 Ga0500645_002048 3300053730 Bacteria 9388
423 Ga0500661_000132 3300055283 Bacteria 12634

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046691 Ga0495670_0018770 Ga0495670_0018770_2570_3391 252
2 3300031901 Ga0307406_10033614 Ga0307406_100336142 263
3 3300037312 Ga0395899_0238529 Ga0395899_0238529_341_1195 263
4 3300037418 Ga0395900_0001132 Ga0395900_0001132_14610_15464 263
5 3300037471 Ga0395905_0000083 Ga0395905_0000083_44877_45731 263
6 3300038443 Ga0395901_0022949 Ga0395901_0022949_1739_2593 263
7 3300046691 Ga0495670_0036638 Ga0495670_0036638_184_1059 267
8 3300002075 JGI24738J21930_10001981 JGI24738J21930_100019815 271
9 3300005841 Ga0068863_100006139 Ga0068863_10000613912 275
10 3300005843 Ga0068860_100002431 Ga0068860_10000243114 275
11 3300005844 Ga0068862_100000125 Ga0068862_10000012523 275
12 3300009553 Ga0105249_10000015 Ga0105249_10000015139 275
13 3300025961 Ga0207712_10000023 Ga0207712_10000023146 275
14 3300026088 Ga0207641_10004614 Ga0207641_100046144 275
15 3300028380 Ga0268265_10000049 Ga0268265_10000049118 275
16 3300028381 Ga0268264_10004912 Ga0268264_1000491210 275
17 3300031824 Ga0307413_10082179 Ga0307413_100821791 275
18 3300031852 Ga0307410_10020928 Ga0307410_100209284 275
19 3300031852 Ga0307410_10049433 Ga0307410_100494332 275
20 3300031995 Ga0307409_100189730 Ga0307409_1001897302 275
21 3300032002 Ga0307416_100062862 Ga0307416_1000628623 275
22 3300032005 Ga0307411_10002491 Ga0307411_100024916 275
23 3300005617 Ga0068859_100205304 Ga0068859_1002053042 276
24 3300006931 Ga0097620_100205304 Ga0097620_1002053042 276
25 3300009101 Ga0105247_10032283 Ga0105247_100322834 276
26 3300025900 Ga0207710_10008307 Ga0207710_100083074 276
27 3300053087 Ga0500643_009705 Ga0500643_009705_1693_2529 276
28 3300046453 Ga0495627_023408 Ga0495627_023408_493_1437 277
29 3300053157 Ga0500624_000095 Ga0500624_000095_33188_34132 277
30 3300031731 Ga0307405_10034136 Ga0307405_100341362 278
31 3300031852 Ga0307410_10027899 Ga0307410_100278993 278
32 3300031903 Ga0307407_10094766 Ga0307407_100947662 278
33 3300031911 Ga0307412_10017451 Ga0307412_100174515 278
34 3300031995 Ga0307409_100064124 Ga0307409_1000641242 278
35 3300032002 Ga0307416_100062682 Ga0307416_1000626824 278
36 3300032002 Ga0307416_100098057 Ga0307416_1000980574 278
37 3300032126 Ga0307415_100012775 Ga0307415_1000127754 278
38 3300046460 Ga0495638_0051791 Ga0495638_0051791_1465_2463 278
39 3300046660 Ga0495625_0019526 Ga0495625_0019526_3463_4461 278
40 3300053104 Ga0500556_0000158 Ga0500556_0000158_50825_51823 278
41 3300053130 Ga0500642_0000001 Ga0500642_0000001_1284191_1285189 278
42 3300053730 Ga0500645_002048 Ga0500645_002048_3546_4547 278
43 3300005844 Ga0068862_100175310 Ga0068862_1001753103 279
44 3300027364 Ga0209967_1009484 Ga0209967_10094842 279
45 3300028380 Ga0268265_10058528 Ga0268265_100585284 279
46 3300032004 Ga0307414_10123727 Ga0307414_101237272 279
47 3300005339 Ga0070660_100443929 Ga0070660_1004439292 280
48 3300005563 Ga0068855_100000667 Ga0068855_1000006676 280
49 3300005616 Ga0068852_100404867 Ga0068852_1004048672 280
50 3300009093 Ga0105240_10023652 Ga0105240_100236525 280
51 3300009551 Ga0105238_10074003 Ga0105238_100740032 280
52 3300025913 Ga0207695_10030830 Ga0207695_100308306 280
53 3300025949 Ga0207667_10003599 Ga0207667_100035996 280
54 3300026041 Ga0207639_10177109 Ga0207639_101771092 280
55 3300026142 Ga0207698_10163347 Ga0207698_101633473 280
56 3300046691 Ga0495670_0010859 Ga0495670_0010859_176_1108 280
57 3300047445 Ga0495677_0006959 Ga0495677_0006959_1463_2395 280
58 3300049663 Ga0501223_000041 Ga0501223_000041_16773_17669 280
59 3300049705 Ga0501225_0000056 Ga0501225_0000056_16957_17853 280
60 3300002076 JGI24749J21850_1010613 JGI24749J21850_10106131 281
61 3300005290 Ga0065712_10092842 Ga0065712_100928422 281
62 3300005293 Ga0065715_10000342 Ga0065715_1000034214 281
63 3300005328 Ga0070676_10025667 Ga0070676_100256672 281
64 3300005330 Ga0070690_100163231 Ga0070690_1001632312 281
65 3300005333 Ga0070677_10007105 Ga0070677_100071053 281
66 3300005335 Ga0070666_10208120 Ga0070666_102081202 281
67 3300005347 Ga0070668_100014980 Ga0070668_1000149805 281
68 3300005353 Ga0070669_100038882 Ga0070669_1000388825 281
69 3300005354 Ga0070675_100036089 Ga0070675_1000360894 281
70 3300005355 Ga0070671_100012010 Ga0070671_1000120109 281
71 3300005356 Ga0070674_100011729 Ga0070674_1000117296 281
72 3300005364 Ga0070673_100012023 Ga0070673_1000120234 281
73 3300005366 Ga0070659_100127009 Ga0070659_1001270093 281
74 3300005438 Ga0070701_10209299 Ga0070701_102092991 281
75 3300005455 Ga0070663_100053947 Ga0070663_1000539473 281
76 3300005457 Ga0070662_100000256 Ga0070662_10000025629 281
77 3300005459 Ga0068867_100015138 Ga0068867_1000151386 281
78 3300005543 Ga0070672_100000621 Ga0070672_10000062114 281
79 3300005564 Ga0070664_100011185 Ga0070664_1000111853 281
80 3300005617 Ga0068859_100000965 Ga0068859_1000009656 281
81 3300005618 Ga0068864_100019971 Ga0068864_1000199713 281
82 3300005841 Ga0068863_100314666 Ga0068863_1003146662 281
83 3300005844 Ga0068862_100018753 Ga0068862_1000187535 281
84 3300006931 Ga0097620_100000965 Ga0097620_1000009656 281
85 3300009094 Ga0111539_10090991 Ga0111539_100909913 281
86 3300009553 Ga0105249_10027457 Ga0105249_100274572 281
87 3300014326 Ga0157380_10009996 Ga0157380_100099966 281
88 3300025315 Ga0207697_10000510 Ga0207697_100005109 281
89 3300025893 Ga0207682_10000666 Ga0207682_100006666 281
90 3300025901 Ga0207688_10067846 Ga0207688_100678462 281
91 3300025903 Ga0207680_10048965 Ga0207680_100489651 281
92 3300025907 Ga0207645_10019790 Ga0207645_100197902 281
93 3300025923 Ga0207681_10010008 Ga0207681_100100083 281
94 3300025923 Ga0207681_10058001 Ga0207681_100580012 281
95 3300025925 Ga0207650_10002156 Ga0207650_1000215618 281
96 3300025926 Ga0207659_10005663 Ga0207659_100056636 281
97 3300025931 Ga0207644_10272114 Ga0207644_102721142 281
98 3300025933 Ga0207706_10000890 Ga0207706_1000089030 281
99 3300025940 Ga0207691_10003939 Ga0207691_100039395 281
100 3300025940 Ga0207691_10566704 Ga0207691_105667041 281
101 3300025960 Ga0207651_10003751 Ga0207651_100037516 281
102 3300025961 Ga0207712_10009156 Ga0207712_100091566 281
103 3300025972 Ga0207668_10007581 Ga0207668_100075813 281
104 3300026067 Ga0207678_10026437 Ga0207678_100264372 281
105 3300026088 Ga0207641_10284330 Ga0207641_102843302 281
106 3300026095 Ga0207676_10026890 Ga0207676_100268905 281
107 3300026118 Ga0207675_100025310 Ga0207675_1000253106 281
108 3300026121 Ga0207683_10029943 Ga0207683_100299433 281
109 3300028380 Ga0268265_10025071 Ga0268265_100250714 281
110 3300046525 Ga0495663_0000495 Ga0495663_0000495_8247_9176 281
111 3300046537 Ga0495598_0005392 Ga0495598_0005392_645_1574 281
112 3300046558 Ga0495633_0012002 Ga0495633_0012002_3404_4333 281
113 3300046691 Ga0495670_0204078 Ga0495670_0204078_46_978 281
114 3300047445 Ga0495677_0013632 Ga0495677_0013632_574_1503 281
115 3300050511 nmdc:mga08y16_77403_c1 nmdc:mga08y16_77403_c1_832_1764 281
116 3300025941 Ga0207711_10227987 Ga0207711_102279872 282
117 3300031548 Ga0307408_100021102 Ga0307408_1000211026 282
118 3300031548 Ga0307408_100083213 Ga0307408_1000832132 282
119 3300031731 Ga0307405_10100632 Ga0307405_101006323 282
120 3300031731 Ga0307405_10233072 Ga0307405_102330721 282
121 3300031731 Ga0307405_10328254 Ga0307405_103282542 282
122 3300031824 Ga0307413_10001771 Ga0307413_100017719 282
123 3300031824 Ga0307413_10372510 Ga0307413_103725102 282
124 3300031852 Ga0307410_10011091 Ga0307410_100110913 282
125 3300031852 Ga0307410_10059985 Ga0307410_100599851 282
126 3300031852 Ga0307410_10287256 Ga0307410_102872562 282
127 3300031901 Ga0307406_10053147 Ga0307406_100531472 282
128 3300031903 Ga0307407_10036414 Ga0307407_100364141 282
129 3300031903 Ga0307407_10098577 Ga0307407_100985772 282
130 3300031903 Ga0307407_10227097 Ga0307407_102270972 282
131 3300031911 Ga0307412_10025530 Ga0307412_100255304 282
132 3300031911 Ga0307412_10041908 Ga0307412_100419082 282
133 3300031995 Ga0307409_100089784 Ga0307409_1000897842 282
134 3300031995 Ga0307409_100211893 Ga0307409_1002118932 282
135 3300031995 Ga0307409_100308995 Ga0307409_1003089952 282
136 3300032002 Ga0307416_100130057 Ga0307416_1001300573 282
137 3300032002 Ga0307416_100149479 Ga0307416_1001494792 282
138 3300032002 Ga0307416_100162545 Ga0307416_1001625452 282
139 3300032002 Ga0307416_100415631 Ga0307416_1004156312 282
140 3300032004 Ga0307414_10004205 Ga0307414_100042056 282
141 3300032004 Ga0307414_10103244 Ga0307414_101032442 282
142 3300032004 Ga0307414_10112436 Ga0307414_101124362 282
143 3300032005 Ga0307411_10104009 Ga0307411_101040091 282
144 3300032005 Ga0307411_10206028 Ga0307411_102060282 282
145 3300032005 Ga0307411_10263017 Ga0307411_102630172 282
146 3300032126 Ga0307415_100017044 Ga0307415_1000170446 282
147 3300048929 Ga0496126_0025141 Ga0496126_0025141_2043_2933 282
148 3300049704 Ga0501221_003750 Ga0501221_003750_779_1711 282
149 3300049707 Ga0501234_014813 Ga0501234_014813_191_1123 282
150 3300005347 Ga0070668_100034649 Ga0070668_1000346495 283
151 3300014326 Ga0157380_10106500 Ga0157380_101065002 283
152 3300014326 Ga0157380_10228692 Ga0157380_102286921 283
153 3300025972 Ga0207668_10099722 Ga0207668_100997222 283
154 3300032004 Ga0307414_10000391 Ga0307414_1000039116 283
155 3300038705 Ga0237819_00837 Ga0237819_00837_6866_7741 283
156 3300039145 Ga0237816_01351 Ga0237816_01351_107_982 283
157 iso_pu_bacteria 2896429255 2896432011 283
158 3300005457 Ga0070662_100031690 Ga0070662_1000316905 284
159 3300005539 Ga0068853_100018460 Ga0068853_1000184606 284
160 3300005577 Ga0068857_100143203 Ga0068857_1001432033 284
161 3300005578 Ga0068854_100127258 Ga0068854_1001272582 284
162 3300009147 Ga0114129_10288778 Ga0114129_102887782 284
163 3300009551 Ga0105238_10071766 Ga0105238_100717662 284
164 3300021388 Ga0213875_10001550 Ga0213875_100015504 284
165 3300025949 Ga0207667_10345196 Ga0207667_103451962 284
166 3300026041 Ga0207639_10007777 Ga0207639_100077779 284
167 3300026116 Ga0207674_10038660 Ga0207674_100386603 284
168 3300031548 Ga0307408_100312667 Ga0307408_1003126671 284
169 3300031911 Ga0307412_10148667 Ga0307412_101486672 284
170 3300037853 Ga0436364_1172297 Ga0436364_1172297_28018_28926 284
171 3300050507 nmdc:mga05p37_597153_c1 nmdc:mga05p37_597153_c1_307_1224 284
172 3300001976 JGI24752J21851_1000144 JGI24752J21851_10001448 285
173 3300002239 JGI24034J26672_10000020 JGI24034J26672_1000002061 285
174 3300002244 JGI24742J22300_10006615 JGI24742J22300_100066152 285
175 3300005330 Ga0070690_100000181 Ga0070690_10000018110 285
176 3300005331 Ga0070670_100027650 Ga0070670_1000276504 285
177 3300005335 Ga0070666_10000027 Ga0070666_1000002796 285
178 3300005340 Ga0070689_100025504 Ga0070689_1000255043 285
179 3300005353 Ga0070669_100000099 Ga0070669_10000009987 285
180 3300005355 Ga0070671_100206158 Ga0070671_1002061582 285
181 3300005365 Ga0070688_100003794 Ga0070688_1000037944 285
182 3300005367 Ga0070667_100036759 Ga0070667_1000367593 285
183 3300005466 Ga0070685_10000040 Ga0070685_1000004013 285
184 3300005544 Ga0070686_100000010 Ga0070686_10000001074 285
185 3300005548 Ga0070665_100000331 Ga0070665_1000003318 285
186 3300005617 Ga0068859_100255100 Ga0068859_1002551002 285
187 3300005618 Ga0068864_100016801 Ga0068864_1000168016 285
188 3300005841 Ga0068863_100000148 Ga0068863_10000014874 285
189 3300005842 Ga0068858_100012984 Ga0068858_1000129846 285
190 3300005843 Ga0068860_100000080 Ga0068860_10000008074 285
191 3300005844 Ga0068862_100000115 Ga0068862_10000011591 285
192 3300005937 Ga0081455_10000220 Ga0081455_1000022044 285
193 3300006931 Ga0097620_100255114 Ga0097620_1002551142 285
194 3300009101 Ga0105247_10127532 Ga0105247_101275322 285
195 3300009177 Ga0105248_10111958 Ga0105248_101119583 285
196 3300009553 Ga0105249_10000064 Ga0105249_1000006497 285
197 3300013306 Ga0163162_10563180 Ga0163162_105631802 285
198 3300014325 Ga0163163_10252812 Ga0163163_102528122 285
199 3300014326 Ga0157380_10002524 Ga0157380_1000252412 285
200 3300014968 Ga0157379_10025000 Ga0157379_100250003 285
201 3300017792 Ga0163161_10002050 Ga0163161_100020508 285
202 3300025903 Ga0207680_10000009 Ga0207680_1000000977 285
203 3300025923 Ga0207681_10003625 Ga0207681_1000362512 285
204 3300025925 Ga0207650_10119304 Ga0207650_101193042 285
205 3300025936 Ga0207670_10071222 Ga0207670_100712224 285
206 3300025941 Ga0207711_10082923 Ga0207711_100829233 285
207 3300025961 Ga0207712_10000044 Ga0207712_1000004474 285
208 3300025986 Ga0207658_10000340 Ga0207658_1000034033 285
209 3300026035 Ga0207703_10014818 Ga0207703_100148184 285
210 3300026088 Ga0207641_10000672 Ga0207641_1000067216 285
211 3300026095 Ga0207676_10001067 Ga0207676_1000106717 285
212 3300026118 Ga0207675_100001681 Ga0207675_10000168113 285
213 3300028379 Ga0268266_10000069 Ga0268266_1000006976 285
214 3300028380 Ga0268265_10000100 Ga0268265_1000010045 285
215 3300028381 Ga0268264_10000131 Ga0268264_1000013174 285
216 3300031824 Ga0307413_10032390 Ga0307413_100323902 285
217 3300031911 Ga0307412_10091484 Ga0307412_100914842 285
218 3300032004 Ga0307414_10015813 Ga0307414_100158135 285
219 3300032004 Ga0307414_10042547 Ga0307414_100425474 285
220 3300032004 Ga0307414_10284737 Ga0307414_102847372 285
221 3300032005 Ga0307411_10064759 Ga0307411_100647593 285
222 3300032005 Ga0307411_10251042 Ga0307411_102510422 285
223 3300046530 Ga0495654_0003819 Ga0495654_0003819_3814_4683 285
224 3300046616 Ga0495668_0028528 Ga0495668_0028528_485_1354 285
225 3300048904 Ga0496101_0096721 Ga0496101_0096721_141_1010 285
226 3300048905 Ga0496102_0015704 Ga0496102_0015704_4033_4902 285
227 3300048906 Ga0496103_0003007 Ga0496103_0003007_3762_4631 285
228 3300048907 Ga0496104_0120478 Ga0496104_0120478_859_1728 285
229 3300048910 Ga0496107_0147585 Ga0496107_0147585_846_1715 285
230 3300048920 Ga0496117_0012887 Ga0496117_0012887_2433_3302 285
231 3300048921 Ga0496118_0024094 Ga0496118_0024094_415_1284 285
232 3300049571 Ga0501034_0116472 Ga0501034_0116472_265_1137 285
233 3300053158 Ga0500627_0001510 Ga0500627_0001510_1935_2804 285
234 iso_pu_bacteria 2919709256 2919712684 285
235 3300005548 Ga0070665_100374977 Ga0070665_1003749771 286
236 3300031456 Ga0307513_10032566 Ga0307513_100325667 286
237 3300001976 JGI24752J21851_1003532 JGI24752J21851_10035322 287
238 3300005331 Ga0070670_100004423 Ga0070670_1000044235 287
239 3300005335 Ga0070666_10000116 Ga0070666_1000011663 287
240 3300005347 Ga0070668_100008276 Ga0070668_1000082765 287
241 3300005353 Ga0070669_100000004 Ga0070669_100000004294 287
242 3300005355 Ga0070671_100000004 Ga0070671_10000000494 287
243 3300005367 Ga0070667_100002080 Ga0070667_10000208011 287
244 3300005440 Ga0070705_100094880 Ga0070705_1000948802 287
245 3300005445 Ga0070708_100080653 Ga0070708_1000806532 287
246 3300005539 Ga0068853_100002388 Ga0068853_10000238814 287
247 3300005548 Ga0070665_100020373 Ga0070665_1000203732 287
248 3300005617 Ga0068859_100001079 Ga0068859_10000107927 287
249 3300005618 Ga0068864_100000544 Ga0068864_10000054411 287
250 3300005719 Ga0068861_100000203 Ga0068861_10000020326 287
251 3300005841 Ga0068863_100010100 Ga0068863_1000101004 287
252 3300005842 Ga0068858_100000782 Ga0068858_10000078213 287
253 3300005843 Ga0068860_100014490 Ga0068860_1000144905 287
254 3300005844 Ga0068862_100000716 Ga0068862_10000071627 287
255 3300006931 Ga0097620_100001079 Ga0097620_10000107927 287
256 3300009177 Ga0105248_10021643 Ga0105248_100216434 287
257 3300009553 Ga0105249_10002202 Ga0105249_1000220210 287
258 3300013306 Ga0163162_10004217 Ga0163162_100042176 287
259 3300014325 Ga0163163_10055648 Ga0163163_100556485 287
260 3300014968 Ga0157379_10010623 Ga0157379_100106236 287
261 3300017792 Ga0163161_10194302 Ga0163161_101943022 287
262 3300025315 Ga0207697_10000699 Ga0207697_1000069910 287
263 3300025900 Ga0207710_10004106 Ga0207710_100041066 287
264 3300025903 Ga0207680_10000253 Ga0207680_1000025313 287
265 3300025923 Ga0207681_10000010 Ga0207681_10000010114 287
266 3300025925 Ga0207650_10002978 Ga0207650_100029784 287
267 3300025931 Ga0207644_10000007 Ga0207644_10000007100 287
268 3300025941 Ga0207711_10046882 Ga0207711_100468824 287
269 3300025961 Ga0207712_10010030 Ga0207712_100100302 287
270 3300025972 Ga0207668_10001156 Ga0207668_1000115612 287
271 3300025986 Ga0207658_10005466 Ga0207658_1000546610 287
272 3300026035 Ga0207703_10002337 Ga0207703_1000233714 287
273 3300026041 Ga0207639_10000263 Ga0207639_1000026338 287
274 3300026095 Ga0207676_10001455 Ga0207676_100014553 287
275 3300026116 Ga0207674_10000748 Ga0207674_1000074828 287
276 3300026118 Ga0207675_100000329 Ga0207675_10000032942 287
277 3300028379 Ga0268266_10015032 Ga0268266_100150328 287
278 3300028380 Ga0268265_10000058 Ga0268265_1000005871 287
279 3300028381 Ga0268264_10000106 Ga0268264_10000106191 287
280 3300048906 Ga0496103_0132810 Ga0496103_0132810_292_1182 287
281 3300053087 Ga0500643_004691 Ga0500643_004691_1298_2245 287
282 3300053091 Ga0500647_0141354 Ga0500647_0141354_245_1111 287
283 3300046471 Ga0495650_0001497 Ga0495650_0001497_3745_4623 288
284 3300046660 Ga0495625_0222883 Ga0495625_0222883_225_1124 288
285 3300048925 Ga0496122_0000359 Ga0496122_0000359_75850_76749 288
286 3300048926 Ga0496123_0002200 Ga0496123_0002200_19639_20538 288
287 3300048929 Ga0496126_0017533 Ga0496126_0017533_1216_2106 288
288 iso_pu_bacteria 2512564014 2512644010 288
289 iso_pu_bacteria 2808606401 2809064789 288
290 iso_pu_bacteria 2808606404 2809080756 288
291 iso_pu_bacteria 2808606405 2809085121 288
292 iso_pu_bacteria 2880518877 2880521817 288
293 3300046616 Ga0495668_0236037 Ga0495668_0236037_10_963 289
294 3300049663 Ga0501223_000186 Ga0501223_000186_11358_12242 289
295 3300049664 Ga0501224_000022 Ga0501224_000022_42584_43468 289
296 3300049668 Ga0501233_001865 Ga0501233_001865_111_995 289
297 3300049669 Ga0501235_005053 Ga0501235_005053_506_1390 289
298 3300049705 Ga0501225_0000342 Ga0501225_0000342_11362_12246 289
299 3300049707 Ga0501234_002520 Ga0501234_002520_442_1326 289
300 3300049853 Ga0501226_000090 Ga0501226_000090_16327_17211 289
301 3300006353 Ga0075370_10021011 Ga0075370_100210115 290
302 3300025229 Ga0209147_101579 Ga0209147_1015794 290
303 3300039450 Ga0436363_0767314 Ga0436363_0767314_358_1257 290
304 3300046692 Ga0495671_0051387 Ga0495671_0051387_849_1832 290
305 3300048928 Ga0496125_0135608 Ga0496125_0135608_405_1358 290
306 3300053087 Ga0500643_002227 Ga0500643_002227_3254_4252 290
307 3300053118 Ga0500594_0004016 Ga0500594_0004016_1692_2675 290
308 3300053136 Ga0500559_0043216 Ga0500559_0043216_200_1105 290
309 3300013100 Ga0157373_10168307 Ga0157373_101683072 291
310 3300013306 Ga0163162_10413928 Ga0163162_104139282 291
311 3300046471 Ga0495650_0054848 Ga0495650_0054848_77_979 291
312 3300046491 Ga0495584_0044240 Ga0495584_0044240_1285_2205 291
313 3300046513 Ga0495616_0001201 Ga0495616_0001201_3382_4284 291
314 3300046519 Ga0495632_0000006 Ga0495632_0000006_196273_197202 291
315 3300046520 Ga0495637_0008235 Ga0495637_0008235_3680_4600 291
316 3300046522 Ga0495643_0000021 Ga0495643_0000021_191647_192567 291
317 3300046524 Ga0495648_0061730 Ga0495648_0061730_1050_1979 291
318 3300046525 Ga0495663_0000008 Ga0495663_0000008_148682_149611 291
319 3300046558 Ga0495633_0000111 Ga0495633_0000111_28657_29586 291
320 3300046558 Ga0495633_0006742 Ga0495633_0006742_5719_6648 291
321 3300046616 Ga0495668_0013337 Ga0495668_0013337_3717_4619 291
322 3300046691 Ga0495670_0175344 Ga0495670_0175344_142_1038 291
323 3300046692 Ga0495671_0000017 Ga0495671_0000017_100899_101819 291
324 3300047470 Ga0495681_0005553 Ga0495681_0005553_3772_4692 291
325 3300047472 Ga0495686_0141849 Ga0495686_0141849_234_1163 291
326 3300053087 Ga0500643_001804 Ga0500643_001804_2878_3774 291
327 3300053136 Ga0500559_0001586 Ga0500559_0001586_7953_8849 291
328 3300053158 Ga0500627_0000845 Ga0500627_0000845_5122_6024 291
329 3300055283 Ga0500661_000132 Ga0500661_000132_7951_8847 291
330 3300005327 Ga0070658_10142733 Ga0070658_101427332 292
331 3300005335 Ga0070666_10093706 Ga0070666_100937062 292
332 3300005347 Ga0070668_100000360 Ga0070668_10000036035 292
333 3300005353 Ga0070669_100065048 Ga0070669_1000650483 292
334 3300005367 Ga0070667_100000051 Ga0070667_10000005136 292
335 3300005841 Ga0068863_100000028 Ga0068863_10000002864 292
336 3300005843 Ga0068860_100038862 Ga0068860_1000388623 292
337 3300025923 Ga0207681_10236051 Ga0207681_102360512 292
338 3300025972 Ga0207668_10000781 Ga0207668_1000078119 292
339 3300025986 Ga0207658_10000057 Ga0207658_1000005736 292
340 3300026088 Ga0207641_10000014 Ga0207641_10000014211 292
341 3300028381 Ga0268264_10017061 Ga0268264_100170613 292
342 3300038443 Ga0395901_0242614 Ga0395901_0242614_942_1832 292
343 3300046452 Ga0495617_006370 Ga0495617_006370_461_1390 292
344 3300046453 Ga0495627_000225 Ga0495627_000225_55141_56070 292
345 3300046512 Ga0495610_0000085 Ga0495610_0000085_35175_36104 292
346 3300047320 Ga0495672_0122738 Ga0495672_0122738_470_1354 292
347 3300047470 Ga0495681_0000013 Ga0495681_0000013_38218_39147 292
348 3300047472 Ga0495686_0030537 Ga0495686_0030537_2112_3041 292
349 3300047472 Ga0495686_0079548 Ga0495686_0079548_357_1286 292
350 iso_pu_bacteria 2775507255 2778126661 292
351 3300005842 Ga0068858_100150227 Ga0068858_1001502273 293
352 3300026035 Ga0207703_10016442 Ga0207703_100164422 293
353 3300046452 Ga0495617_092836 Ga0495617_092836_14_904 293
354 3300046460 Ga0495638_0000014 Ga0495638_0000014_185865_186755 293
355 3300046506 Ga0495583_0000557 Ga0495583_0000557_3833_4723 293
356 3300046519 Ga0495632_0000446 Ga0495632_0000446_2174_3064 293
357 3300046524 Ga0495648_0000021 Ga0495648_0000021_241930_242820 293
358 3300046692 Ga0495671_0000028 Ga0495671_0000028_3956_4846 293
359 3300047469 Ga0495673_0000058 Ga0495673_0000058_230145_231035 293
360 3300048911 Ga0496108_0082084 Ga0496108_0082084_1379_2275 293
361 3300048914 Ga0496111_0173183 Ga0496111_0173183_576_1472 293
362 3300048920 Ga0496117_0007931 Ga0496117_0007931_498_1391 293
363 3300048922 Ga0496119_0102822 Ga0496119_0102822_193_1086 293
364 3300048928 Ga0496125_0144903 Ga0496125_0144903_731_1627 293
365 3300009011 Ga0105251_10009976 Ga0105251_100099766 294
366 3300009177 Ga0105248_10379822 Ga0105248_103798223 294
367 3300009553 Ga0105249_10087935 Ga0105249_100879353 294
368 3300017792 Ga0163161_10002866 Ga0163161_1000286611 294
369 3300025735 Ga0207713_1014322 Ga0207713_10143225 294
370 3300025941 Ga0207711_10264411 Ga0207711_102644111 294
371 3300046453 Ga0495627_000304 Ga0495627_000304_28006_28935 294
372 3300048913 Ga0496110_0207959 Ga0496110_0207959_631_1521 294
373 3300048925 Ga0496122_0022674 Ga0496122_0022674_2694_3584 294
374 3300048927 Ga0496124_0016138 Ga0496124_0016138_4624_5514 294
375 3300048928 Ga0496125_0040525 Ga0496125_0040525_1936_2826 294
376 2162886007 SwRhRL2b_contig_2117351 SwRhRL2b_0650.00008170 296
377 2162886007 SwRhRL2b_contig_3140714 SwRhRL2b_0858.00001570 296
378 3300001904 JGI24736J21556_1007576 JGI24736J21556_10075762 296
379 3300001915 JGI24741J21665_1000122 JGI24741J21665_100012216 296
380 3300001979 JGI24740J21852_10003671 JGI24740J21852_100036716 296
381 3300001989 JGI24739J22299_10006212 JGI24739J22299_100062123 296
382 3300001990 JGI24737J22298_10003975 JGI24737J22298_100039753 296
383 3300002067 JGI24735J21928_10003977 JGI24735J21928_100039774 296
384 3300005289 Ga0065704_10000610 Ga0065704_100006106 296
385 3300005289 Ga0065704_10002566 Ga0065704_100025664 296
386 3300005327 Ga0070658_10242500 Ga0070658_102425001 296
387 3300005344 Ga0070661_100025879 Ga0070661_1000258794 296
388 3300005455 Ga0070663_100006741 Ga0070663_1000067416 296
389 3300005564 Ga0070664_100029991 Ga0070664_1000299915 296
390 3300005614 Ga0068856_100027241 Ga0068856_1000272414 296
391 3300006042 Ga0075368_10000788 Ga0075368_100007887 296
392 3300006353 Ga0075370_10072979 Ga0075370_100729792 296
393 3300009174 Ga0105241_10012493 Ga0105241_100124934 296
394 3300009551 Ga0105238_10491279 Ga0105238_104912792 296
395 3300009978 Ga0105148_100168 Ga0105148_1001685 296
396 3300025321 Ga0207656_10026128 Ga0207656_100261282 296
397 3300025904 Ga0207647_10026225 Ga0207647_100262254 296
398 3300025911 Ga0207654_10051853 Ga0207654_100518534 296
399 3300025919 Ga0207657_10017233 Ga0207657_100172336 296
400 3300025923 Ga0207681_10042469 Ga0207681_100424692 296
401 3300025924 Ga0207694_10085769 Ga0207694_100857694 296
402 3300025933 Ga0207706_10032421 Ga0207706_100324215 296
403 3300025945 Ga0207679_10200265 Ga0207679_102002652 296
404 3300025949 Ga0207667_10212027 Ga0207667_102120272 296
405 3300025981 Ga0207640_10007589 Ga0207640_100075895 296
406 3300026041 Ga0207639_10002831 Ga0207639_100028315 296
407 3300026067 Ga0207678_10000427 Ga0207678_1000042726 296
408 3300026078 Ga0207702_10003972 Ga0207702_100039723 296
409 3300026116 Ga0207674_10059907 Ga0207674_100599072 296
410 3300026142 Ga0207698_10098839 Ga0207698_100988394 296
411 3300027866 Ga0209813_10000036 Ga0209813_1000003658 296
412 3300031548 Ga0307408_100008614 Ga0307408_1000086147 296
413 3300031852 Ga0307410_10027404 Ga0307410_100274043 296
414 3300031911 Ga0307412_10019089 Ga0307412_100190892 296
415 3300031995 Ga0307409_100518053 Ga0307409_1005180532 296
416 3300046558 Ga0495633_0031232 Ga0495633_0031232_1613_2539 296
417 3300048911 Ga0496108_0032484 Ga0496108_0032484_1012_1902 296
418 3300048913 Ga0496110_0239014 Ga0496110_0239014_191_1081 296
419 3300048924 Ga0496121_0001561 Ga0496121_0001561_4177_5067 296
420 3300048926 Ga0496123_0141476 Ga0496123_0141476_213_1103 296
421 3300048927 Ga0496124_0142620 Ga0496124_0142620_216_1106 296
422 3300048928 Ga0496125_0019357 Ga0496125_0019357_3961_4851 296
423 3300049551 Ga0501335_003882 Ga0501335_003882_206_1102 296
424 3300049658 Ga0501211_001796 Ga0501211_001796_1203_2099 296
425 3300049669 Ga0501235_007869 Ga0501235_007869_182_1078 296
426 3300049670 Ga0501236_008049 Ga0501236_008049_412_1308 296
427 3300049705 Ga0501225_0006128 Ga0501225_0006128_393_1289 296
428 3300050494 nmdc:mga06z11_40_c1 nmdc:mga06z11_40_c1_3792_4691 296
429 3300050495 nmdc:mga04h51_177_c1 nmdc:mga04h51_177_c1_3811_4710 296
430 3300050496 nmdc:mga07m45_53249_c1 nmdc:mga07m45_53249_c1_795_1694 296
431 3300053157 Ga0500624_000012 Ga0500624_000012_21870_22796 296

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10502

Peptidase_S26

Signal peptidase, peptidase S26

40

291

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7807 55 259
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7799 55 259
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7136 55 259
4k8w-assembly1.cif.gz_A-2 an arm-swapped dimer of the s. pyogenes pilin specific assembly factor sipa 0.7084 94 255
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.6958 55 259
ID Description Score Start End Superfamily
1kn9D01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.9119 53 262 2.10.109.10
1b12C01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8636 53 285 2.10.109.10
af_Q54RP1_162_281_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8318 56 256 2.10.109.10
1b12C01 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8302 53 285 2.10.109.10
af_A0A5K1K8B7_164_341_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.8263 101 259 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A3D4M147-F1-model_v4 deleted 0.9341 169 294
AF-A0A2N3D0N3-F1-model_v4 Signal peptidase I (EC 3.4.21.89) (Leader peptidase I) 0.9288 133 291 GO:0004252
GO:0006465
GO:0016020
AF-A0A7G9L5Y1-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9174 47 295 GO:0004252
GO:0006465
GO:0016020
AF-A0A258GDQ6-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9097 52 294 GO:0004252
GO:0006465
GO:0016020
AF-A0A7Y0G9E4-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.9094 41 295 GO:0004252
GO:0006465
GO:0016020

Feature Viewer

pLDDT pTM Quality
80.24 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map