F442407

General Info

Members Datasets Scaffolds Average Seq Length
431 212 862 358

Family's Representative Sequence

Representative Sequence 3300035091|Ga0373951_0000909|Ga0373951_0000909_2066_3301
Length 395
Sequence LFTGFEEGFSRKYAKAQRKTQRVEEVHMSTAGQAVSLTEVGSPVPKTPLNSFLRSPMNWLLLFIPITVGLEHLAHVPAPVLFFMAAVAIVPIAAQIVSATEQLAVRTGDAIGGLLNATFGNAPELIIAFVALKAGLLEMVRASLVGAILANLMLALGVAFLLGGLRFHQQRFNPTAARAYSTMMFLAAVSMTVPSAFSRVIAPNEVIRQEKLLNIGIAILLLIAYALYILFSLRTHTAAFASVDSEHQXXXEQQWSVARAVITLLAASVLAAWMSEILVGAAEETGKALGMSQLFIGIVFVAKNKMDLSVGIASGSCIQIALFVAPVLVLASYFVAPHPLELAFGRAEIGSLFIAVLIGALVSGDGESNWYKGVQLITVYAIIALMFYLMPQLPT

Samples

Sample ID Description Type Environment
1 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
94 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
136 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
146 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
147 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
148 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
149 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
150 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
153 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
154 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
158 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
159 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
160 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
161 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
162 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
163 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
165 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
166 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
170 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
172 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
173 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
174 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
175 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
176 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
177 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
178 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
179 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
180 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
181 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
182 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
183 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
184 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
185 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
186 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
187 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
188 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
189 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
190 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
191 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
196 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
197 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
203 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
204 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
205 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
209 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
212 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.7
Nodule 0
Rhizoplane 1.62
Rhizosphere 97.45
Stem 0
Stem Tuber 0
Unclassified 10.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373951_0000909 3300035091 Bacteria 7969
2 JGI24751J29686_10000015 3300002459 Bacteria 112804
3 rootL2_10076781 3300003322 Bacteria 8044
4 Ga0065714_10139206 3300005288 Bacteria 1185
5 Ga0065712_10001043 3300005290 Bacteria 7097
6 Ga0065712_10005208 3300005290 Unclassified 3919
7 Ga0065712_10014649 3300005290 Bacteria 4413
8 Ga0065715_10000849 3300005293 Bacteria 8125
9 Ga0065715_10106046 3300005293 Bacteria 2854
10 Ga0065707_10091749 3300005295 Bacteria 3885
11 Ga0070658_10150157 3300005327 Bacteria 1951
12 Ga0070676_10003877 3300005328 Bacteria 7855
13 Ga0070676_10007147 3300005328 Bacteria 5980
14 Ga0070676_10108906 3300005328 Bacteria 1722
15 Ga0070690_100058912 3300005330 Bacteria 2468
16 Ga0070690_100061887 3300005330 Bacteria 2412
17 Ga0070670_100000182 3300005331 Bacteria 57532
18 Ga0070670_100011280 3300005331 Bacteria 7640
19 Ga0070670_100011588 3300005331 Bacteria 7536
20 Ga0070670_100049570 3300005331 Bacteria 3610
21 Ga0070670_100324932 3300005331 Bacteria 1348
22 Ga0068869_100224018 3300005334 Unclassified 1492
23 Ga0070666_10012011 3300005335 Bacteria 5450
24 Ga0070680_100030611 3300005336 Bacteria 4324
25 Ga0070680_100077951 3300005336 Bacteria 2730
26 Ga0070682_100000223 3300005337 Bacteria 41046
27 Ga0070682_100001111 3300005337 Bacteria 15402
28 Ga0070660_100026745 3300005339 Bacteria 4299
29 Ga0070689_100000729 3300005340 Bacteria 20093
30 Ga0070689_100249147 3300005340 Bacteria 1465
31 Ga0070689_100267569 3300005340 Unclassified 1414
32 Ga0070691_10079118 3300005341 Bacteria 1607
33 Ga0070687_100070332 3300005343 Bacteria 1877
34 Ga0070687_100105386 3300005343 Bacteria 1586
35 Ga0070692_10008918 3300005345 Bacteria 4496
36 Ga0070692_10021169 3300005345 Bacteria 3161
37 Ga0070668_100169424 3300005347 Bacteria 1777
38 Ga0070669_100004704 3300005353 Bacteria 9851
39 Ga0070669_100056022 3300005353 Unclassified 2890
40 Ga0070675_100038381 3300005354 Unclassified 3903
41 Ga0070675_100053660 3300005354 Bacteria 3316
42 Ga0070671_100001599 3300005355 Bacteria 17049
43 Ga0070671_100107878 3300005355 Bacteria 2338
44 Ga0070674_100023432 3300005356 Bacteria 3996
45 Ga0070673_100058988 3300005364 Unclassified 3037
46 Ga0070667_100012690 3300005367 Bacteria 6965
47 Ga0070701_10132458 3300005438 Bacteria 1418
48 Ga0070705_100001740 3300005440 Bacteria 11314
49 Ga0070700_100000085 3300005441 Bacteria 62514
50 Ga0070700_100038813 3300005441 Bacteria 2905
51 Ga0070700_100132942 3300005441 Bacteria 1681
52 Ga0070694_100009467 3300005444 Bacteria 5976
53 Ga0070694_100022175 3300005444 Bacteria 4067
54 Ga0070694_100024870 3300005444 Bacteria 3869
55 Ga0070694_100035731 3300005444 Bacteria 3287
56 Ga0070694_100116300 3300005444 Bacteria 1913
57 Ga0070678_100009585 3300005456 Bacteria 5875
58 Ga0070662_100012450 3300005457 Bacteria 5642
59 Ga0070662_100078571 3300005457 Unclassified 2452
60 Ga0070662_100080688 3300005457 Bacteria 2422
61 Ga0070662_100093056 3300005457 Bacteria 2267
62 Ga0070681_10010657 3300005458 Bacteria 9086
63 Ga0068867_100037560 3300005459 Bacteria 3521
64 Ga0068867_100218442 3300005459 Bacteria 1535
65 Ga0070706_100108008 3300005467 Bacteria 2589
66 Ga0070697_100050800 3300005536 Bacteria 3367
67 Ga0070695_100006843 3300005545 Bacteria 6751
68 Ga0070695_100060968 3300005545 Bacteria 2446
69 Ga0070695_100077361 3300005545 Bacteria 2192
70 Ga0070693_100000409 3300005547 Bacteria 19458
71 Ga0070665_100054966 3300005548 Bacteria 3993
72 Ga0070704_100028444 3300005549 Archaea 3719
73 Ga0070704_100204782 3300005549 Bacteria 1595
74 Ga0068855_100079448 3300005563 Unclassified 3804
75 Ga0070664_100012874 3300005564 Bacteria 6806
76 Ga0070664_100024118 3300005564 Bacteria 5029
77 Ga0068857_100027546 3300005577 Bacteria 5013
78 Ga0068857_100369673 3300005577 Bacteria 1330
79 Ga0068856_100214363 3300005614 Bacteria 1941
80 Ga0070702_100061697 3300005615 Unclassified 2183
81 Ga0070702_100071570 3300005615 Bacteria 2050
82 Ga0070702_100127558 3300005615 Bacteria 1602
83 Ga0068852_100122131 3300005616 Archaea 2387
84 Ga0068852_100235097 3300005616 Unclassified 1749
85 Ga0068859_100000908 3300005617 Bacteria 30261
86 Ga0068859_100002516 3300005617 Bacteria 18607
87 Ga0068859_100030430 3300005617 Bacteria 5417
88 Ga0068859_100043729 3300005617 Bacteria 4502
89 Ga0068859_100047210 3300005617 Unclassified 4326
90 Ga0068859_100186712 3300005617 Unclassified 2157
91 Ga0068859_100206757 3300005617 Bacteria 2048
92 Ga0068864_100013212 3300005618 Bacteria 6838
93 Ga0068864_100042857 3300005618 Bacteria 3873
94 Ga0068864_100375127 3300005618 Unclassified 1347
95 Ga0068866_10009089 3300005718 Bacteria 4212
96 Ga0068861_100003329 3300005719 Bacteria 10633
97 Ga0068861_100254000 3300005719 Bacteria 1501
98 Ga0068861_100420079 3300005719 Bacteria 1191
99 Ga0068851_10000906 3300005834 Bacteria 12779
100 Ga0068870_10021374 3300005840 Bacteria 3164
101 Ga0068863_100030685 3300005841 Bacteria 5132
102 Ga0068858_100196072 3300005842 Bacteria 1908
103 Ga0068860_100143620 3300005843 Bacteria 2295
104 Ga0068860_100164727 3300005843 Unclassified 2139
105 Ga0068862_100007726 3300005844 Bacteria 8893
106 Ga0068862_100122043 3300005844 Bacteria 2297
107 Ga0081455_10006409 3300005937 Bacteria 12621
108 Ga0081455_10066434 3300005937 Bacteria 3012
109 Ga0081538_10023774 3300005981 Bacteria 4392
110 Ga0097621_100101236 3300006237 Unclassified 2424
111 Ga0097621_100171726 3300006237 Bacteria 1869
112 Ga0068871_100048143 3300006358 Unclassified 3440
113 Ga0075428_100000118 3300006844 Bacteria 68029
114 Ga0075428_100141525 3300006844 Bacteria 2615
115 Ga0075430_100000578 3300006846 Bacteria 27850
116 Ga0075430_100090957 3300006846 Bacteria 2552
117 Ga0075431_100004617 3300006847 Bacteria 13519
118 Ga0075431_100016143 3300006847 Bacteria 7576
119 Ga0075431_100217525 3300006847 Bacteria 1950
120 Ga0075433_10009187 3300006852 Bacteria 7899
121 Ga0075433_10020524 3300006852 Bacteria 5527
122 Ga0075434_100017625 3300006871 Bacteria 6883
123 Ga0075434_100033752 3300006871 Bacteria 5051
124 Ga0075434_100035673 3300006871 Bacteria 4916
125 Ga0075434_100081438 3300006871 Bacteria 3234
126 Ga0075429_100000849 3300006880 Bacteria 23991
127 Ga0075429_100007935 3300006880 Bacteria 9224
128 Ga0097620_100000908 3300006931 Bacteria 30261
129 Ga0097620_100002516 3300006931 Bacteria 18607
130 Ga0097620_100030425 3300006931 Bacteria 5417
131 Ga0097620_100043726 3300006931 Bacteria 4502
132 Ga0097620_100047210 3300006931 Unclassified 4326
133 Ga0097620_100186720 3300006931 Unclassified 2157
134 Ga0097620_100206743 3300006931 Bacteria 2048
135 Ga0075435_100022919 3300007076 Bacteria 4820
136 Ga0075435_100053075 3300007076 Bacteria 3268
137 Ga0075435_100270414 3300007076 Bacteria 1449
138 Ga0105240_10195899 3300009093 Bacteria 2372
139 Ga0111539_10001500 3300009094 Bacteria 31168
140 Ga0111539_10002748 3300009094 Bacteria 23349
141 Ga0111539_10003183 3300009094 Bacteria 21718
142 Ga0111539_10004234 3300009094 Bacteria 18802
143 Ga0111539_10012042 3300009094 Bacteria 10849
144 Ga0111539_10041235 3300009094 Bacteria 5551
145 Ga0111539_10061813 3300009094 Bacteria 4436
146 Ga0111539_10080811 3300009094 Bacteria 3824
147 Ga0111539_10231583 3300009094 Bacteria 2151
148 Ga0105245_10102742 3300009098 Bacteria 2647
149 Ga0105247_10000512 3300009101 Bacteria 31789
150 Ga0105247_10012911 3300009101 Bacteria 5010
151 Ga0105247_10060660 3300009101 Unclassified 2344
152 Ga0114129_10008409 3300009147 Bacteria 14699
153 Ga0114129_10011582 3300009147 Bacteria 12556
154 Ga0114129_10162218 3300009147 Unclassified 3052
155 Ga0114129_10167599 3300009147 Bacteria 2996
156 Ga0114129_10257642 3300009147 Bacteria 2339
157 Ga0114129_10291978 3300009147 Bacteria 2175
158 Ga0114129_10637018 3300009147 Bacteria 1377
159 Ga0114129_10738085 3300009147 Bacteria 1262
160 Ga0105241_10043066 3300009174 Bacteria 3418
161 Ga0105242_10000362 3300009176 Bacteria 36296
162 Ga0105242_10075034 3300009176 Bacteria 2814
163 Ga0105248_10000970 3300009177 Bacteria 32005
164 Ga0105248_10004162 3300009177 Bacteria 16001
165 Ga0105248_10095687 3300009177 Bacteria 3343
166 Ga0105248_10219935 3300009177 Bacteria 2138
167 Ga0105237_10002502 3300009545 Bacteria 22771
168 Ga0105237_10158832 3300009545 Bacteria 2258
169 Ga0105238_10001162 3300009551 Bacteria 26555
170 Ga0105238_10034132 3300009551 Bacteria 5177
171 Ga0105249_10000857 3300009553 Bacteria 27153
172 Ga0105249_10001330 3300009553 Bacteria 21636
173 Ga0105249_10033851 3300009553 Bacteria 4628
174 Ga0105239_10164150 3300010375 Bacteria 2483
175 Ga0157371_10141737 3300013102 Bacteria 1712
176 Ga0157370_10148802 3300013104 Bacteria 2179
177 Ga0157374_10027812 3300013296 Bacteria 5105
178 Ga0157378_10129025 3300013297 Unclassified 2338
179 Ga0163162_10003397 3300013306 Bacteria 15202
180 Ga0163162_10068673 3300013306 Bacteria 3596
181 Ga0163162_10235321 3300013306 Bacteria 1962
182 Ga0157372_10070806 3300013307 Bacteria 3925
183 Ga0157375_10004555 3300013308 Bacteria 12045
184 Ga0157375_10011429 3300013308 Bacteria 7838
185 Ga0157375_10083475 3300013308 Bacteria 3240
186 Ga0157375_10222019 3300013308 Bacteria 2048
187 Ga0163163_10000142 3300014325 Bacteria 74753
188 Ga0163163_10009552 3300014325 Bacteria 8666
189 Ga0163163_10017266 3300014325 Bacteria 6729
190 Ga0163163_10022127 3300014325 Bacteria 6013
191 Ga0163163_10070600 3300014325 Bacteria 3478
192 Ga0163163_10207079 3300014325 Bacteria 2010
193 Ga0157380_10000008 3300014326 Bacteria 154993
194 Ga0157380_10011853 3300014326 Bacteria 6305
195 Ga0157376_10011690 3300014969 Bacteria 6481
196 Ga0209050_1001521 3300025298 Bacteria 24443
197 Ga0207426_1026077 3300025302 Bacteria 1962
198 Ga0207697_10004256 3300025315 Bacteria 6868
199 Ga0207656_10002841 3300025321 Bacteria 5895
200 Ga0207653_10009792 3300025885 Bacteria 2989
201 Ga0207682_10007933 3300025893 Bacteria 4214
202 Ga0207710_10000453 3300025900 Bacteria 26495
203 Ga0207710_10021028 3300025900 Unclassified 2793
204 Ga0207645_10045066 3300025907 Bacteria 2820
205 Ga0207645_10061152 3300025907 Bacteria 2406
206 Ga0207643_10013468 3300025908 Bacteria 4431
207 Ga0207643_10039200 3300025908 Bacteria 2665
208 Ga0207643_10132473 3300025908 Unclassified 1484
209 Ga0207671_10022708 3300025914 Bacteria 4740
210 Ga0207663_10103868 3300025916 Bacteria 1915
211 Ga0207660_10064053 3300025917 Bacteria 2652
212 Ga0207657_10007332 3300025919 Bacteria 11315
213 Ga0207652_10244587 3300025921 Unclassified 1617
214 Ga0207681_10007124 3300025923 Bacteria 6856
215 Ga0207681_10007228 3300025923 Bacteria 6810
216 Ga0207694_10000994 3300025924 Bacteria 24824
217 Ga0207650_10000017 3300025925 Bacteria 354674
218 Ga0207650_10018715 3300025925 Bacteria 4863
219 Ga0207650_10092578 3300025925 Bacteria 2312
220 Ga0207650_10102157 3300025925 Bacteria 2208
221 Ga0207644_10018782 3300025931 Unclassified 4682
222 Ga0207706_10012387 3300025933 Bacteria 7768
223 Ga0207706_10031753 3300025933 Bacteria 4703
224 Ga0207706_10040072 3300025933 Unclassified 4152
225 Ga0207686_10001283 3300025934 Bacteria 14436
226 Ga0207686_10030143 3300025934 Bacteria 3209
227 Ga0207670_10000352 3300025936 Bacteria 27297
228 Ga0207670_10197636 3300025936 Bacteria 1526
229 Ga0207670_10300927 3300025936 Bacteria 1256
230 Ga0207669_10022715 3300025937 Bacteria 3337
231 Ga0207669_10036417 3300025937 Bacteria 2812
232 Ga0207691_10005918 3300025940 Bacteria 11810
233 Ga0207691_10009189 3300025940 Bacteria 9488
234 Ga0207711_10000805 3300025941 Bacteria 30800
235 Ga0207711_10003783 3300025941 Bacteria 13026
236 Ga0207711_10040972 3300025941 Bacteria 3942
237 Ga0207711_10077786 3300025941 Bacteria 2892
238 Ga0207711_10244624 3300025941 Bacteria 1646
239 Ga0207689_10056071 3300025942 Bacteria 3242
240 Ga0207689_10346127 3300025942 Bacteria 1235
241 Ga0207712_10000650 3300025961 Bacteria 27103
242 Ga0207712_10028443 3300025961 Bacteria 3739
243 Ga0207712_10186741 3300025961 Bacteria 1633
244 Ga0207668_10333323 3300025972 Bacteria 1263
245 Ga0207658_10156051 3300025986 Bacteria 1865
246 Ga0207658_10238987 3300025986 Bacteria 1538
247 Ga0207677_10097169 3300026023 Bacteria 2157
248 Ga0207703_10048137 3300026035 Unclassified 3439
249 Ga0207703_10107349 3300026035 Bacteria 2376
250 Ga0207639_10149738 3300026041 Bacteria 1953
251 Ga0207678_10022428 3300026067 Bacteria 5529
252 Ga0207678_10147914 3300026067 Bacteria 2005
253 Ga0207708_10000042 3300026075 Bacteria 123302
254 Ga0207708_10016726 3300026075 Bacteria 5519
255 Ga0207708_10041054 3300026075 Bacteria 3528
256 Ga0207708_10049892 3300026075 Bacteria 3187
257 Ga0207708_10050118 3300026075 Unclassified 3179
258 Ga0207708_10185172 3300026075 Bacteria 1654
259 Ga0207708_10266330 3300026075 Bacteria 1384
260 Ga0207702_10109130 3300026078 Bacteria 2456
261 Ga0207641_10068123 3300026088 Bacteria 3050
262 Ga0207641_10130137 3300026088 Bacteria 2259
263 Ga0207641_10369295 3300026088 Unclassified 1372
264 Ga0207648_10034325 3300026089 Bacteria 4472
265 Ga0207648_10059033 3300026089 Bacteria 3345
266 Ga0207648_10182659 3300026089 Bacteria 1857
267 Ga0207676_10009824 3300026095 Bacteria 6806
268 Ga0207676_10309398 3300026095 Unclassified 1446
269 Ga0207676_10343177 3300026095 Unclassified 1379
270 Ga0207674_10034913 3300026116 Bacteria 5251
271 Ga0207674_10143122 3300026116 Bacteria 2350
272 Ga0207674_10276324 3300026116 Bacteria 1628
273 Ga0207674_10293594 3300026116 Bacteria 1574
274 Ga0207675_100004854 3300026118 Bacteria 12958
275 Ga0207675_100062503 3300026118 Bacteria 3477
276 Ga0207675_100103130 3300026118 Bacteria 2688
277 Ga0207675_100215415 3300026118 Bacteria 1849
278 Ga0207683_10004566 3300026121 Bacteria 11924
279 Ga0207428_10015573 3300027907 Bacteria 6572
280 Ga0207428_10015946 3300027907 Bacteria 6480
281 Ga0207428_10070202 3300027907 Bacteria 2753
282 Ga0207428_10071519 3300027907 Bacteria 2724
283 Ga0268265_10101243 3300028380 Bacteria 2327
284 Ga0268264_10120364 3300028381 Bacteria 2313
285 Ga0307408_100027216 3300031548 Bacteria 3938
286 Ga0307405_10004666 3300031731 Bacteria 6510
287 Ga0307410_10027212 3300031852 Bacteria 3612
288 Ga0307410_10308532 3300031852 Bacteria 1251
289 Ga0307406_10018158 3300031901 Bacteria 4104
290 Ga0307416_100013012 3300032002 Bacteria 5637
291 Ga0307414_10008476 3300032004 Bacteria 5831
292 Ga0307411_10015400 3300032005 Bacteria 4294
293 Ga0307415_100002175 3300032126 Bacteria 9727
294 Ga0373942_0007069 3300035207 Bacteria 2595
295 Ga0373925_0008141 3300037068 Bacteria 7634
296 Ga0242420_002279 3300038996 Unclassified 2722
297 Ga0451577_0006340 3300042876 Bacteria 11820
298 Ga0451577_0009627 3300042876 Bacteria 9274
299 Ga0451577_0077386 3300042876 Unclassified 2966
300 Ga0451577_0346845 3300042876 Unclassified 1347
301 Ga0453683_0016139 3300044673 Bacteria 4826
302 Ga0453684_0002019 3300044712 Bacteria 51893
303 Ga0453684_0044801 3300044712 Bacteria 5912
304 Ga0453684_0087124 3300044712 Unclassified 3871
305 Ga0451576_0007346 3300045051 Bacteria 13212
306 Ga0451576_0037929 3300045051 Bacteria 5102
307 Ga0495638_0000008 3300046460 Bacteria 565643
308 Ga0495639_0068154 3300046475 Bacteria 1640
309 Ga0495628_0026046 3300046516 Bacteria 4775
310 Ga0495663_0000316 3300046525 Bacteria 18091
311 Ga0495666_0080914 3300046526 Bacteria 1537
312 Ga0495586_0042487 3300046535 Bacteria 2448
313 Ga0496106_0054694 3300048909 Bacteria 3016
314 Ga0496112_0013603 3300048915 Bacteria 7520
315 Ga0496112_0240245 3300048915 Bacteria 1764
316 Ga0496113_0115316 3300048916 Bacteria 2096
317 Ga0496113_0126482 3300048916 Archaea 2002
318 Ga0496113_0152211 3300048916 Unclassified 1825
319 Ga0496113_0247812 3300048916 Bacteria 1422
320 Ga0501292_007936 3300049515 Bacteria 1542
321 Ga0501295_014593 3300049518 Bacteria 1328
322 Ga0501298_013627 3300049521 Bacteria 1442
323 Ga0501299_021821 3300049522 Unclassified 1177
324 Ga0501036_0109114 3300049572 Bacteria 2338
325 Ga0501038_0033265 3300049574 Bacteria 4542
326 Ga0501038_0119719 3300049574 Bacteria 2173
327 Ga0501039_0011433 3300049575 Bacteria 6758
328 Ga0501040_0000468 3300049576 Bacteria 24032
329 Ga0501041_0004372 3300049577 Bacteria 8177
330 Ga0501041_0055587 3300049577 Bacteria 2417
331 Ga0501042_0003735 3300049578 Bacteria 9618
332 Ga0501046_0003167 3300049580 Bacteria 15195
333 Ga0501046_0047502 3300049580 Bacteria 3403
334 Ga0501048_0049300 3300049582 Bacteria 3001
335 Ga0501048_0100002 3300049582 Bacteria 2046
336 Ga0501048_0124585 3300049582 Bacteria 1822
337 Ga0501068_0003395 3300049584 Bacteria 8561
338 Ga0501068_0023618 3300049584 Bacteria 3605
339 Ga0501071_0013387 3300049587 Bacteria 5589
340 Ga0501071_0028542 3300049587 Bacteria 3934
341 Ga0501071_0135076 3300049587 Bacteria 1835
342 Ga0501071_0186441 3300049587 Bacteria 1555
343 Ga0501072_0002309 3300049588 Bacteria 14288
344 Ga0501072_0117638 3300049588 Bacteria 2117
345 Ga0501072_0145486 3300049588 Bacteria 1890
346 Ga0501073_0008777 3300049589 Bacteria 7481
347 Ga0501074_0003281 3300049590 Bacteria 11438
348 Ga0501075_0001512 3300049591 Bacteria 15168
349 Ga0501075_0055655 3300049591 Bacteria 2977
350 Ga0501075_0066957 3300049591 Bacteria 2711
351 Ga0501075_0149686 3300049591 Unclassified 1779
352 Ga0501076_0002043 3300049592 Bacteria 13822
353 Ga0501077_0027017 3300049593 Bacteria 3645
354 Ga0501198_001583 3300049649 Unclassified 2999
355 Ga0501216_009179 3300049660 Unclassified 1573
356 Ga0501217_000059 3300049661 Bacteria 13120
357 Ga0501223_000996 3300049663 Bacteria 6699
358 Ga0501223_002792 3300049663 Bacteria 3828
359 Ga0501223_013526 3300049663 Unclassified 1625
360 Ga0501224_001525 3300049664 Unclassified 3083
361 Ga0501227_000127 3300049665 Bacteria 13576
362 Ga0501227_003455 3300049665 Bacteria 3424
363 Ga0501230_002057 3300049667 Bacteria 2518
364 Ga0501233_001675 3300049668 Bacteria 3810
365 Ga0501233_006220 3300049668 Bacteria 2239
366 Ga0501233_026165 3300049668 Unclassified 1287
367 Ga0501243_001180 3300049675 Bacteria 3729
368 Ga0501225_0001376 3300049705 Bacteria 7583
369 Ga0501225_0001434 3300049705 Bacteria 7447
370 Ga0501225_0003532 3300049705 Bacteria 4714
371 Ga0501234_001631 3300049707 Bacteria 3509
372 Ga0501245_010352 3300049708 Bacteria 1346
373 Ga0501079_0003303 3300049741 Bacteria 11820
374 Ga0501079_0003948 3300049741 Bacteria 10958
375 Ga0501079_0014978 3300049741 Bacteria 5911
376 Ga0501079_0150959 3300049741 Bacteria 1811
377 Ga0501080_0002326 3300049742 Bacteria 16585
378 Ga0501080_0091247 3300049742 Bacteria 2830
379 Ga0501081_0006521 3300049743 Bacteria 7580
380 Ga0501081_0024721 3300049743 Bacteria 4035
381 Ga0501083_0041924 3300049744 Bacteria 3104
382 Ga0501270_005540 3300049767 Bacteria 1472
383 Ga0501272_004127 3300049769 Unclassified 1501
384 Ga0501283_000338 3300049779 Bacteria 6236
385 Ga0501035_0022144 3300049822 Bacteria 5837
386 Ga0501045_0003445 3300049824 Bacteria 10826
387 Ga0501045_0168959 3300049824 Bacteria 1629
388 Ga0501226_000483 3300049853 Bacteria 5580
389 nmdc:mga05p37_110706_c1 3300050507 Bacteria 3378
390 nmdc:mga05p37_124953_c1 3300050507 Bacteria 3159
391 nmdc:mga05p37_237239_c1 3300050507 Bacteria 2194
392 nmdc:mga05p37_238757_c1 3300050507 Bacteria 2186
393 nmdc:mga05p37_7567_c1 3300050507 Bacteria 12812
394 nmdc:mga09592_35092_c1 3300050508 Bacteria 4196
395 nmdc:mga09592_41284_c1 3300050508 Bacteria 3878
396 nmdc:mga0qj67_7148_c1 3300050509 Bacteria 8236
397 nmdc:mga0qj67_99797_c1 3300050509 Bacteria 2340
398 nmdc:mga06r32_1451_c1 3300050510 Bacteria 21420
399 nmdc:mga06r32_221375_c1 3300050510 Bacteria 1881
400 nmdc:mga06r32_30259_c1 3300050510 Bacteria 5080
401 nmdc:mga06r32_352982_c1 3300050510 Unclassified 1455
402 nmdc:mga08y16_21613_c1 3300050511 Bacteria 6795
403 nmdc:mga08y16_28333_c1 3300050511 Bacteria 5905
404 nmdc:mga08y16_31261_c1 3300050511 Bacteria 5600
405 nmdc:mga08y16_4941_c1 3300050511 Bacteria 13931
406 nmdc:mga08y16_57829_c1 3300050511 Bacteria 4051
407 nmdc:mga08y16_77822_c1 3300050511 Bacteria 3458
408 nmdc:mga08y16_950_c1 3300050511 Bacteria 28167
409 nmdc:mga0n895_17883_c1 3300050512 Bacteria 6548
410 nmdc:mga0n895_45350_c1 3300050512 Bacteria 4290
411 nmdc:mga0n895_95923_c1 3300050512 Bacteria 2971
412 nmdc:mga0rr50_16926_c1 3300050513 Bacteria 4855
413 nmdc:mga0rr50_191808_c1 3300050513 Unclassified 1675
414 nmdc:mga0rr50_224581_c1 3300050513 Bacteria 1552
415 nmdc:mga0a205_11751_c1 3300050515 Bacteria 8076
416 nmdc:mga0a205_1637_c1 3300050515 Bacteria 9734
417 nmdc:mga0a205_25709_c1 3300050515 Bacteria 5611
418 nmdc:mga0a205_30789_c1 3300050515 Bacteria 5139
419 nmdc:mga0a205_41017_c1 3300050515 Bacteria 4457
420 nmdc:mga0a205_71143_c1 3300050515 Bacteria 3359
421 Ga0500616_0000003 3300053153 Bacteria 1220687
422 Ga0501084_0005379 3300054114 Bacteria 10494
423 Ga0501084_0036453 3300054114 Bacteria 4108
424 Ga0501084_0057527 3300054114 Bacteria 3253
425 Ga0501082_0000463 3300060353 Bacteria 35880
426 Ga0501082_0091887 3300060353 Bacteria 2621
427 Ga0501082_0109683 3300060353 Bacteria 2389
428 Ga0501082_0323193 3300060353 Bacteria 1344
429 Ga0530510_0001827 3300061734 Bacteria 14525
430 Ga0530510_0008058 3300061734 Bacteria 7349
431 Ga0530510_0119557 3300061734 Bacteria 1933
432 Ga0373951_0000909
433 JGI24751J29686_10000015
434 rootL2_10076781
435 Ga0065714_10139206
436 Ga0065712_10001043
437 Ga0065712_10005208
438 Ga0065712_10014649
439 Ga0065715_10000849
440 Ga0065715_10106046
441 Ga0065707_10091749
442 Ga0070658_10150157
443 Ga0070676_10003877
444 Ga0070676_10007147
445 Ga0070676_10108906
446 Ga0070690_100058912
447 Ga0070690_100061887
448 Ga0070670_100000182
449 Ga0070670_100011280
450 Ga0070670_100011588
451 Ga0070670_100049570
452 Ga0070670_100324932
453 Ga0068869_100224018
454 Ga0070666_10012011
455 Ga0070680_100030611
456 Ga0070680_100077951
457 Ga0070682_100000223
458 Ga0070682_100001111
459 Ga0070660_100026745
460 Ga0070689_100000729
461 Ga0070689_100249147
462 Ga0070689_100267569
463 Ga0070691_10079118
464 Ga0070687_100070332
465 Ga0070687_100105386
466 Ga0070692_10008918
467 Ga0070692_10021169
468 Ga0070668_100169424
469 Ga0070669_100004704
470 Ga0070669_100056022
471 Ga0070675_100038381
472 Ga0070675_100053660
473 Ga0070671_100001599
474 Ga0070671_100107878
475 Ga0070674_100023432
476 Ga0070673_100058988
477 Ga0070667_100012690
478 Ga0070701_10132458
479 Ga0070705_100001740
480 Ga0070700_100000085
481 Ga0070700_100038813
482 Ga0070700_100132942
483 Ga0070694_100009467
484 Ga0070694_100022175
485 Ga0070694_100024870
486 Ga0070694_100035731
487 Ga0070694_100116300
488 Ga0070678_100009585
489 Ga0070662_100012450
490 Ga0070662_100078571
491 Ga0070662_100080688
492 Ga0070662_100093056
493 Ga0070681_10010657
494 Ga0068867_100037560
495 Ga0068867_100218442
496 Ga0070706_100108008
497 Ga0070697_100050800
498 Ga0070695_100006843
499 Ga0070695_100060968
500 Ga0070695_100077361
501 Ga0070693_100000409
502 Ga0070665_100054966
503 Ga0070704_100028444
504 Ga0070704_100204782
505 Ga0068855_100079448
506 Ga0070664_100012874
507 Ga0070664_100024118
508 Ga0068857_100027546
509 Ga0068857_100369673
510 Ga0068856_100214363
511 Ga0070702_100061697
512 Ga0070702_100071570
513 Ga0070702_100127558
514 Ga0068852_100122131
515 Ga0068852_100235097
516 Ga0068859_100000908
517 Ga0068859_100002516
518 Ga0068859_100030430
519 Ga0068859_100043729
520 Ga0068859_100047210
521 Ga0068859_100186712
522 Ga0068859_100206757
523 Ga0068864_100013212
524 Ga0068864_100042857
525 Ga0068864_100375127
526 Ga0068866_10009089
527 Ga0068861_100003329
528 Ga0068861_100254000
529 Ga0068861_100420079
530 Ga0068851_10000906
531 Ga0068870_10021374
532 Ga0068863_100030685
533 Ga0068858_100196072
534 Ga0068860_100143620
535 Ga0068860_100164727
536 Ga0068862_100007726
537 Ga0068862_100122043
538 Ga0081455_10006409
539 Ga0081455_10066434
540 Ga0081538_10023774
541 Ga0097621_100101236
542 Ga0097621_100171726
543 Ga0068871_100048143
544 Ga0075428_100000118
545 Ga0075428_100141525
546 Ga0075430_100000578
547 Ga0075430_100090957
548 Ga0075431_100004617
549 Ga0075431_100016143
550 Ga0075431_100217525
551 Ga0075433_10009187
552 Ga0075433_10020524
553 Ga0075434_100017625
554 Ga0075434_100033752
555 Ga0075434_100035673
556 Ga0075434_100081438
557 Ga0075429_100000849
558 Ga0075429_100007935
559 Ga0097620_100000908
560 Ga0097620_100002516
561 Ga0097620_100030425
562 Ga0097620_100043726
563 Ga0097620_100047210
564 Ga0097620_100186720
565 Ga0097620_100206743
566 Ga0075435_100022919
567 Ga0075435_100053075
568 Ga0075435_100270414
569 Ga0105240_10195899
570 Ga0111539_10001500
571 Ga0111539_10002748
572 Ga0111539_10003183
573 Ga0111539_10004234
574 Ga0111539_10012042
575 Ga0111539_10041235
576 Ga0111539_10061813
577 Ga0111539_10080811
578 Ga0111539_10231583
579 Ga0105245_10102742
580 Ga0105247_10000512
581 Ga0105247_10012911
582 Ga0105247_10060660
583 Ga0114129_10008409
584 Ga0114129_10011582
585 Ga0114129_10162218
586 Ga0114129_10167599
587 Ga0114129_10257642
588 Ga0114129_10291978
589 Ga0114129_10637018
590 Ga0114129_10738085
591 Ga0105241_10043066
592 Ga0105242_10000362
593 Ga0105242_10075034
594 Ga0105248_10000970
595 Ga0105248_10004162
596 Ga0105248_10095687
597 Ga0105248_10219935
598 Ga0105237_10002502
599 Ga0105237_10158832
600 Ga0105238_10001162
601 Ga0105238_10034132
602 Ga0105249_10000857
603 Ga0105249_10001330
604 Ga0105249_10033851
605 Ga0105239_10164150
606 Ga0157371_10141737
607 Ga0157370_10148802
608 Ga0157374_10027812
609 Ga0157378_10129025
610 Ga0163162_10003397
611 Ga0163162_10068673
612 Ga0163162_10235321
613 Ga0157372_10070806
614 Ga0157375_10004555
615 Ga0157375_10011429
616 Ga0157375_10083475
617 Ga0157375_10222019
618 Ga0163163_10000142
619 Ga0163163_10009552
620 Ga0163163_10017266
621 Ga0163163_10022127
622 Ga0163163_10070600
623 Ga0163163_10207079
624 Ga0157380_10000008
625 Ga0157380_10011853
626 Ga0157376_10011690
627 Ga0209050_1001521
628 Ga0207426_1026077
629 Ga0207697_10004256
630 Ga0207656_10002841
631 Ga0207653_10009792
632 Ga0207682_10007933
633 Ga0207710_10000453
634 Ga0207710_10021028
635 Ga0207645_10045066
636 Ga0207645_10061152
637 Ga0207643_10013468
638 Ga0207643_10039200
639 Ga0207643_10132473
640 Ga0207671_10022708
641 Ga0207663_10103868
642 Ga0207660_10064053
643 Ga0207657_10007332
644 Ga0207652_10244587
645 Ga0207681_10007124
646 Ga0207681_10007228
647 Ga0207694_10000994
648 Ga0207650_10000017
649 Ga0207650_10018715
650 Ga0207650_10092578
651 Ga0207650_10102157
652 Ga0207644_10018782
653 Ga0207706_10012387
654 Ga0207706_10031753
655 Ga0207706_10040072
656 Ga0207686_10001283
657 Ga0207686_10030143
658 Ga0207670_10000352
659 Ga0207670_10197636
660 Ga0207670_10300927
661 Ga0207669_10022715
662 Ga0207669_10036417
663 Ga0207691_10005918
664 Ga0207691_10009189
665 Ga0207711_10000805
666 Ga0207711_10003783
667 Ga0207711_10040972
668 Ga0207711_10077786
669 Ga0207711_10244624
670 Ga0207689_10056071
671 Ga0207689_10346127
672 Ga0207712_10000650
673 Ga0207712_10028443
674 Ga0207712_10186741
675 Ga0207668_10333323
676 Ga0207658_10156051
677 Ga0207658_10238987
678 Ga0207677_10097169
679 Ga0207703_10048137
680 Ga0207703_10107349
681 Ga0207639_10149738
682 Ga0207678_10022428
683 Ga0207678_10147914
684 Ga0207708_10000042
685 Ga0207708_10016726
686 Ga0207708_10041054
687 Ga0207708_10049892
688 Ga0207708_10050118
689 Ga0207708_10185172
690 Ga0207708_10266330
691 Ga0207702_10109130
692 Ga0207641_10068123
693 Ga0207641_10130137
694 Ga0207641_10369295
695 Ga0207648_10034325
696 Ga0207648_10059033
697 Ga0207648_10182659
698 Ga0207676_10009824
699 Ga0207676_10309398
700 Ga0207676_10343177
701 Ga0207674_10034913
702 Ga0207674_10143122
703 Ga0207674_10276324
704 Ga0207674_10293594
705 Ga0207675_100004854
706 Ga0207675_100062503
707 Ga0207675_100103130
708 Ga0207675_100215415
709 Ga0207683_10004566
710 Ga0207428_10015573
711 Ga0207428_10015946
712 Ga0207428_10070202
713 Ga0207428_10071519
714 Ga0268265_10101243
715 Ga0268264_10120364
716 Ga0307408_100027216
717 Ga0307405_10004666
718 Ga0307410_10027212
719 Ga0307410_10308532
720 Ga0307406_10018158
721 Ga0307416_100013012
722 Ga0307414_10008476
723 Ga0307411_10015400
724 Ga0307415_100002175
725 Ga0373942_0007069
726 Ga0373925_0008141
727 Ga0242420_002279
728 Ga0451577_0006340
729 Ga0451577_0009627
730 Ga0451577_0077386
731 Ga0451577_0346845
732 Ga0453683_0016139
733 Ga0453684_0002019
734 Ga0453684_0044801
735 Ga0453684_0087124
736 Ga0451576_0007346
737 Ga0451576_0037929
738 Ga0495638_0000008
739 Ga0495639_0068154
740 Ga0495628_0026046
741 Ga0495663_0000316
742 Ga0495666_0080914
743 Ga0495586_0042487
744 Ga0496106_0054694
745 Ga0496112_0013603
746 Ga0496112_0240245
747 Ga0496113_0115316
748 Ga0496113_0126482
749 Ga0496113_0152211
750 Ga0496113_0247812
751 Ga0501292_007936
752 Ga0501295_014593
753 Ga0501298_013627
754 Ga0501299_021821
755 Ga0501036_0109114
756 Ga0501038_0033265
757 Ga0501038_0119719
758 Ga0501039_0011433
759 Ga0501040_0000468
760 Ga0501041_0004372
761 Ga0501041_0055587
762 Ga0501042_0003735
763 Ga0501046_0003167
764 Ga0501046_0047502
765 Ga0501048_0049300
766 Ga0501048_0100002
767 Ga0501048_0124585
768 Ga0501068_0003395
769 Ga0501068_0023618
770 Ga0501071_0013387
771 Ga0501071_0028542
772 Ga0501071_0135076
773 Ga0501071_0186441
774 Ga0501072_0002309
775 Ga0501072_0117638
776 Ga0501072_0145486
777 Ga0501073_0008777
778 Ga0501074_0003281
779 Ga0501075_0001512
780 Ga0501075_0055655
781 Ga0501075_0066957
782 Ga0501075_0149686
783 Ga0501076_0002043
784 Ga0501077_0027017
785 Ga0501198_001583
786 Ga0501216_009179
787 Ga0501217_000059
788 Ga0501223_000996
789 Ga0501223_002792
790 Ga0501223_013526
791 Ga0501224_001525
792 Ga0501227_000127
793 Ga0501227_003455
794 Ga0501230_002057
795 Ga0501233_001675
796 Ga0501233_006220
797 Ga0501233_026165
798 Ga0501243_001180
799 Ga0501225_0001376
800 Ga0501225_0001434
801 Ga0501225_0003532
802 Ga0501234_001631
803 Ga0501245_010352
804 Ga0501079_0003303
805 Ga0501079_0003948
806 Ga0501079_0014978
807 Ga0501079_0150959
808 Ga0501080_0002326
809 Ga0501080_0091247
810 Ga0501081_0006521
811 Ga0501081_0024721
812 Ga0501083_0041924
813 Ga0501270_005540
814 Ga0501272_004127
815 Ga0501283_000338
816 Ga0501035_0022144
817 Ga0501045_0003445
818 Ga0501045_0168959
819 Ga0501226_000483
820 nmdc:mga05p37_110706_c1
821 nmdc:mga05p37_124953_c1
822 nmdc:mga05p37_237239_c1
823 nmdc:mga05p37_238757_c1
824 nmdc:mga05p37_7567_c1
825 nmdc:mga09592_35092_c1
826 nmdc:mga09592_41284_c1
827 nmdc:mga0qj67_7148_c1
828 nmdc:mga0qj67_99797_c1
829 nmdc:mga06r32_1451_c1
830 nmdc:mga06r32_221375_c1
831 nmdc:mga06r32_30259_c1
832 nmdc:mga06r32_352982_c1
833 nmdc:mga08y16_21613_c1
834 nmdc:mga08y16_28333_c1
835 nmdc:mga08y16_31261_c1
836 nmdc:mga08y16_4941_c1
837 nmdc:mga08y16_57829_c1
838 nmdc:mga08y16_77822_c1
839 nmdc:mga08y16_950_c1
840 nmdc:mga0n895_17883_c1
841 nmdc:mga0n895_45350_c1
842 nmdc:mga0n895_95923_c1
843 nmdc:mga0rr50_16926_c1
844 nmdc:mga0rr50_191808_c1
845 nmdc:mga0rr50_224581_c1
846 nmdc:mga0a205_11751_c1
847 nmdc:mga0a205_1637_c1
848 nmdc:mga0a205_25709_c1
849 nmdc:mga0a205_30789_c1
850 nmdc:mga0a205_41017_c1
851 nmdc:mga0a205_71143_c1
852 Ga0500616_0000003
853 Ga0501084_0005379
854 Ga0501084_0036453
855 Ga0501084_0057527
856 Ga0501082_0000463
857 Ga0501082_0091887
858 Ga0501082_0109683
859 Ga0501082_0323193
860 Ga0530510_0001827
861 Ga0530510_0008058
862 Ga0530510_0119557

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01699

Na_Ca_ex

Sodium/calcium exchanger protein

77

234

0.92

PF01699

Na_Ca_ex

Sodium/calcium exchanger protein

259

389

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k1c-assembly2.cif.gz_B vcx1 calcium/proton exchanger 0.8573 24 359
4kjs-assembly1.cif.gz_A structure of native yfke 0.8526 29 361
4k1c-assembly1.cif.gz_A vcx1 calcium/proton exchanger 0.8483 19 359
4kjs-assembly1.cif.gz_A structure of native yfke 0.8451 29 361
4kjs-assembly2.cif.gz_B structure of native yfke 0.8139 29 361
ID Description Score Start End Superfamily
af_C6KSN3_150_437_1.20.1420.30 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;NCX, central ion-binding region 0.8789 84 359 1.20.1420.30
af_O59768_113_408_3.30.360.10 Alpha Beta;2-Layer Sandwich;Dihydrodipicolinate Reductase; domain 2;Dihydrodipicolinate Reductase; domain 2 0.871 82 359 3.30.360.10
af_Q769E5_118_423_1.20.1420.30 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;NCX, central ion-binding region 0.8618 83 359 1.20.1420.30
af_C6KSN3_150_437_1.20.1420.30 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;NCX, central ion-binding region 0.8417 84 359 1.20.1420.30
af_A4HVW9_144_479_1.20.1420.30 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;NCX, central ion-binding region 0.837 83 359 1.20.1420.30
ID Description Score Start End GO Terms
AF-A0A7X9IJD0-F1-model_v4 Ca(2+)/H(+) antiporter 0.9176 21 360 GO:0006874
GO:0012505
GO:0015369
GO:0016020
AF-A0A7I8CXC7-F1-model_v4 Ca(2+)/H(+) antiporter 0.9138 71 359 GO:0006874
GO:0012505
GO:0015369
GO:0016020
AF-A0A0M8K748-F1-model_v4 Ca(2+)/H(+) antiporter 0.9087 22 359 GO:0006874
GO:0012505
GO:0015369
GO:0016020
AF-A0A3N5JL67-F1-model_v4 Ca(2+)/H(+) antiporter 0.9087 31 361 GO:0006874
GO:0012505
GO:0015369
GO:0016020
AF-A0A5M9JVQ3-F1-model_v4 Vacuolar calcium ion transporter 0.9087 23 359 GO:0000329
GO:0006874
GO:0012505
GO:0015369

Map