F442400

General Info

Members Datasets Scaffolds Average Seq Length
431 235 862 358

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100137535|Ga0307409_1001375352
Length 401
Sequence MLRPATQQYDVDDDAEQCAEIRKHNARRIVHVPWSSTALMIDSAEALTAFVAGAQDSPTLALDTEFMREKTYRAELCLLQIATGDSAVCIDPLAIAAAGGDLSALTPLLTGSPAIKVMHAARQDLEVLLPPIGLVQPVFDTQIAAALAGHPSQVGYAELTRRLLGVELSKAHTRADWSRRPLSPEQQEYALDDVRHLAALRASLLETLAAKGRVAWLDEELAALANADALRVDPDDAWRKIKGLPGLDPERQKLAQALGAWRERRAMERNRPRGWILDDAVLREIVVRLPRSPEALAALPEMQESVVRKCGEELLDLVRQSGIGDPPPPLPRREKPDPAQLAMVKRLADIAAEVAKELEISTEVLATRRELEKLAAGKREVSLLRGWRAQIVGEKLLAALR

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
129 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
130 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
131 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
132 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
133 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
134 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
135 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
136 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
137 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
138 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
141 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
142 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
143 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
154 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
156 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
164 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
165 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
166 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
167 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
168 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
169 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
172 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
173 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
174 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
175 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
176 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
177 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
182 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
183 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
188 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
189 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
193 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
197 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
198 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
199 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
200 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
203 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
204 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
209 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
213 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
214 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
215 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
216 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
217 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
218 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
219 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
222 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
223 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
224 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
225 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
226 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
227 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
228 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
229 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
230 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
231 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
232 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
233 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.48
Nodule 0
Rhizoplane 2.78
Rhizosphere 85.15
Stem 0
Stem Tuber 0
Unclassified 9.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_100137535 3300031995 Unclassified 2099
2 JGI25406J46586_10001949 3300003203 Bacteria 9755
3 rootH1_10102833 3300003316 Bacteria 5101
4 rootH2_10265245 3300003320 Bacteria 2618
5 rootL2_10251149 3300003322 Bacteria 2816
6 rootH1_10145978 3300003323 Bacteria 4665
7 Ga0058862_11991047 3300004803 Bacteria 1424
8 Ga0065707_10081916 3300005295 Bacteria 29636
9 Ga0070683_100008496 3300005329 Bacteria 8723
10 Ga0070683_100117152 3300005329 Bacteria 2515
11 Ga0070690_100002641 3300005330 Bacteria 9658
12 Ga0070690_100051173 3300005330 Bacteria 2636
13 Ga0070670_100071927 3300005331 Bacteria 2970
14 Ga0070670_100110123 3300005331 Bacteria 2373
15 Ga0068869_100085440 3300005334 Bacteria 2363
16 Ga0070666_10014842 3300005335 Bacteria 4963
17 Ga0070666_10033991 3300005335 Bacteria 3379
18 Ga0070680_100009183 3300005336 Bacteria 7583
19 Ga0070680_100046441 3300005336 Bacteria 3533
20 Ga0070680_100052586 3300005336 Bacteria 3324
21 Ga0070682_100005091 3300005337 Bacteria 7305
22 Ga0070682_100010247 3300005337 Bacteria 5317
23 Ga0070682_100166863 3300005337 Bacteria 1526
24 Ga0068868_100009676 3300005338 Bacteria 6956
25 Ga0068868_100156872 3300005338 Bacteria 1877
26 Ga0070661_100030650 3300005344 Bacteria 3886
27 Ga0070692_10147714 3300005345 Unclassified 1336
28 Ga0070669_100013301 3300005353 Bacteria 5848
29 Ga0070671_100001004 3300005355 Bacteria 20743
30 Ga0070671_100007680 3300005355 Bacteria 8621
31 Ga0070674_100045942 3300005356 Bacteria 2985
32 Ga0070673_100022688 3300005364 Bacteria 4572
33 Ga0070673_100038929 3300005364 Bacteria 3635
34 Ga0070688_100030079 3300005365 Bacteria 3257
35 Ga0070667_100000184 3300005367 Bacteria 75408
36 Ga0070667_100001335 3300005367 Bacteria 22151
37 Ga0070667_100009779 3300005367 Bacteria 7950
38 Ga0070667_100095009 3300005367 Bacteria 2569
39 Ga0070667_100127907 3300005367 Bacteria 2215
40 Ga0070709_10002040 3300005434 Bacteria 10958
41 Ga0070714_100083995 3300005435 Bacteria 2778
42 Ga0070713_100032484 3300005436 Bacteria 4169
43 Ga0070713_100125382 3300005436 Unclassified 2258
44 Ga0070710_10167701 3300005437 Unclassified 1366
45 Ga0070711_100004809 3300005439 Bacteria 8011
46 Ga0070700_100079859 3300005441 Bacteria 2109
47 Ga0070663_100039256 3300005455 Bacteria 3307
48 Ga0070678_100047049 3300005456 Bacteria 3097
49 Ga0070681_10002219 3300005458 Bacteria 17697
50 Ga0070681_10006730 3300005458 Bacteria 11184
51 Ga0070681_10038546 3300005458 Bacteria 4791
52 Ga0070681_10049161 3300005458 Bacteria 4213
53 Ga0070681_10064557 3300005458 Bacteria 3631
54 Ga0070681_10076887 3300005458 Bacteria 3296
55 Ga0070681_10145298 3300005458 Bacteria 2301
56 Ga0070681_10223905 3300005458 Bacteria 1796
57 Ga0070681_10324593 3300005458 Bacteria 1449
58 Ga0068867_100029679 3300005459 Bacteria 3941
59 Ga0068867_100070834 3300005459 Bacteria 2607
60 Ga0068867_100084395 3300005459 Bacteria 2399
61 Ga0068867_100150618 3300005459 Bacteria 1827
62 Ga0070685_10174714 3300005466 Unclassified 1379
63 Ga0070679_100007165 3300005530 Bacteria 10410
64 Ga0070679_100063123 3300005530 Bacteria 3693
65 Ga0070679_100079058 3300005530 Bacteria 3278
66 Ga0070679_100081467 3300005530 Bacteria 3226
67 Ga0070679_100170824 3300005530 Bacteria 2147
68 Ga0070684_100069488 3300005535 Unclassified 3097
69 Ga0070672_100019173 3300005543 Bacteria 4961
70 Ga0070686_100037044 3300005544 Bacteria 3023
71 Ga0070686_100077352 3300005544 Bacteria 2193
72 Ga0070695_100008584 3300005545 Bacteria 6069
73 Ga0070696_100088758 3300005546 Bacteria 2198
74 Ga0070696_100090067 3300005546 Bacteria 2182
75 Ga0070665_100001413 3300005548 Bacteria 28206
76 Ga0070665_100002995 3300005548 Bacteria 18235
77 Ga0070665_100006051 3300005548 Bacteria 12367
78 Ga0070665_100025812 3300005548 Bacteria 5917
79 Ga0070665_100090080 3300005548 Bacteria 3073
80 Ga0070665_100149478 3300005548 Bacteria 2339
81 Ga0068855_100000693 3300005563 Bacteria 41175
82 Ga0068855_100035665 3300005563 Bacteria 5923
83 Ga0068855_100056805 3300005563 Bacteria 4590
84 Ga0068855_100064209 3300005563 Bacteria 4282
85 Ga0068855_100086078 3300005563 Bacteria 3635
86 Ga0068855_100123216 3300005563 Bacteria 2966
87 Ga0068855_100266693 3300005563 Bacteria 1905
88 Ga0068856_100008905 3300005614 Bacteria 9764
89 Ga0068859_100004414 3300005617 Bacteria 14350
90 Ga0068859_100095132 3300005617 Bacteria 3031
91 Ga0068859_100224462 3300005617 Bacteria 1967
92 Ga0068864_100142570 3300005618 Bacteria 2163
93 Ga0068866_10061139 3300005718 Unclassified 1955
94 Ga0068861_100003578 3300005719 Bacteria 10344
95 Ga0068861_100008942 3300005719 Bacteria 6903
96 Ga0068861_100101570 3300005719 Bacteria 2288
97 Ga0068861_100166869 3300005719 Bacteria 1821
98 Ga0068870_10003823 3300005840 Bacteria 6415
99 Ga0068863_100000710 3300005841 Bacteria 33475
100 Ga0068863_100060773 3300005841 Bacteria 3573
101 Ga0068863_100161803 3300005841 Bacteria 2145
102 Ga0068858_100002611 3300005842 Bacteria 18160
103 Ga0068858_100010005 3300005842 Bacteria 9009
104 Ga0068858_100046167 3300005842 Bacteria 4039
105 Ga0068858_100203573 3300005842 Unclassified 1872
106 Ga0068858_100262656 3300005842 Unclassified 1641
107 Ga0068860_100003804 3300005843 Bacteria 15527
108 Ga0068860_100016766 3300005843 Bacteria 7142
109 Ga0068860_100073394 3300005843 Bacteria 3252
110 Ga0068860_100130483 3300005843 Bacteria 2411
111 Ga0068862_100235734 3300005844 Unclassified 1662
112 Ga0068862_100238698 3300005844 Unclassified 1652
113 Ga0081455_10000098 3300005937 Bacteria 95177
114 Ga0081455_10261421 3300005937 Unclassified 1260
115 Ga0081539_10000006 3300005985 Bacteria 534555
116 Ga0070715_10005162 3300006163 Bacteria 4337
117 Ga0070716_100014684 3300006173 Bacteria 4016
118 Ga0070712_100097885 3300006175 Bacteria 2163
119 Ga0097621_100130052 3300006237 Bacteria 2142
120 Ga0068871_100018048 3300006358 Bacteria 5354
121 Ga0068871_100180631 3300006358 Unclassified 1813
122 Ga0068871_100200618 3300006358 Bacteria 1722
123 Ga0068865_100007963 3300006881 Bacteria 6542
124 Ga0068865_100008201 3300006881 Bacteria 6449
125 Ga0068865_100047378 3300006881 Bacteria 2953
126 Ga0097620_100004414 3300006931 Bacteria 14350
127 Ga0097620_100095133 3300006931 Bacteria 3031
128 Ga0097620_100224472 3300006931 Bacteria 1967
129 Ga0105240_10002376 3300009093 Bacteria 30348
130 Ga0105240_10015665 3300009093 Bacteria 10295
131 Ga0105240_10019455 3300009093 Bacteria 9070
132 Ga0105240_10027325 3300009093 Bacteria 7471
133 Ga0105240_10030836 3300009093 Bacteria 6965
134 Ga0105240_10032977 3300009093 Bacteria 6697
135 Ga0105240_10042790 3300009093 Bacteria 5770
136 Ga0105240_10064989 3300009093 Bacteria 4530
137 Ga0111539_10050564 3300009094 Bacteria 4951
138 Ga0105245_10022455 3300009098 Bacteria 5538
139 Ga0105247_10001109 3300009101 Bacteria 20061
140 Ga0105247_10007928 3300009101 Bacteria 6493
141 Ga0105247_10012255 3300009101 Bacteria 5150
142 Ga0105242_10005943 3300009176 Bacteria 9413
143 Ga0105242_10025308 3300009176 Bacteria 4696
144 Ga0105248_10004600 3300009177 Bacteria 15274
145 Ga0105248_10034899 3300009177 Bacteria 5628
146 Ga0105248_10502771 3300009177 Bacteria 1366
147 Ga0105237_10010549 3300009545 Bacteria 9818
148 Ga0105237_10120657 3300009545 Bacteria 2616
149 Ga0105238_10003998 3300009551 Bacteria 14634
150 Ga0105238_10090344 3300009551 Bacteria 3050
151 Ga0105238_10117195 3300009551 Bacteria 2643
152 Ga0105238_10118684 3300009551 Bacteria 2625
153 Ga0105238_10179759 3300009551 Bacteria 2092
154 Ga0105238_10305195 3300009551 Unclassified 1576
155 Ga0105249_10051395 3300009553 Bacteria 3759
156 Ga0105249_10115602 3300009553 Bacteria 2542
157 Ga0105249_10146769 3300009553 Bacteria 2267
158 Ga0099796_10041773 3300010159 Bacteria 1554
159 Ga0105239_10012758 3300010375 Bacteria 9349
160 Ga0157369_10035905 3300013105 Bacteria 5433
161 Ga0157369_10472768 3300013105 Bacteria 1297
162 Ga0157374_10027660 3300013296 Bacteria 5119
163 Ga0157374_10067553 3300013296 Bacteria 3361
164 Ga0157374_10267980 3300013296 Bacteria 1684
165 Ga0157378_10009784 3300013297 Bacteria 8357
166 Ga0163162_10031073 3300013306 Bacteria 5295
167 Ga0163162_10067681 3300013306 Bacteria 3622
168 Ga0163162_10196573 3300013306 Bacteria 2146
169 Ga0163162_10228952 3300013306 Bacteria 1989
170 Ga0157372_10249880 3300013307 Bacteria 2059
171 Ga0157375_10051505 3300013308 Bacteria 4043
172 Ga0157375_10115225 3300013308 Bacteria 2790
173 Ga0157375_10212913 3300013308 Bacteria 2090
174 Ga0163163_10005861 3300014325 Bacteria 10689
175 Ga0163163_10021471 3300014325 Bacteria 6094
176 Ga0163163_10031205 3300014325 Bacteria 5142
177 Ga0163163_10108714 3300014325 Bacteria 2800
178 Ga0163163_10193747 3300014325 Bacteria 2080
179 Ga0157380_10004746 3300014326 Bacteria 9462
180 Ga0157380_10048521 3300014326 Bacteria 3345
181 Ga0157380_10152555 3300014326 Bacteria 1999
182 Ga0157380_10231423 3300014326 Unclassified 1660
183 Ga0157380_10352204 3300014326 Unclassified 1378
184 Ga0157379_10015428 3300014968 Bacteria 6703
185 Ga0157379_10016416 3300014968 Bacteria 6514
186 Ga0157379_10079387 3300014968 Unclassified 2938
187 Ga0157379_10226905 3300014968 Bacteria 1693
188 Ga0157376_10025119 3300014969 Bacteria 4689
189 Ga0213873_10023552 3300021358 Bacteria 1469
190 Ga0207682_10034580 3300025893 Bacteria 2037
191 Ga0207692_10084993 3300025898 Unclassified 1701
192 Ga0207642_10005849 3300025899 Bacteria 4047
193 Ga0207710_10006428 3300025900 Bacteria 5017
194 Ga0207710_10051897 3300025900 Unclassified 1843
195 Ga0207685_10040713 3300025905 Unclassified 1734
196 Ga0207699_10008887 3300025906 Bacteria 4979
197 Ga0207643_10006807 3300025908 Bacteria 6136
198 Ga0207654_10084417 3300025911 Bacteria 1920
199 Ga0207707_10000115 3300025912 Bacteria 81416
200 Ga0207707_10000140 3300025912 Bacteria 74787
201 Ga0207707_10000148 3300025912 Bacteria 73167
202 Ga0207707_10001748 3300025912 Bacteria 19961
203 Ga0207707_10010490 3300025912 Bacteria 8039
204 Ga0207707_10068052 3300025912 Bacteria 3102
205 Ga0207707_10086175 3300025912 Bacteria 2745
206 Ga0207707_10093276 3300025912 Bacteria 2630
207 Ga0207707_10109811 3300025912 Unclassified 2411
208 Ga0207695_10005076 3300025913 Bacteria 17645
209 Ga0207695_10005438 3300025913 Bacteria 16891
210 Ga0207695_10016051 3300025913 Bacteria 8785
211 Ga0207695_10023614 3300025913 Bacteria 6939
212 Ga0207695_10029496 3300025913 Bacteria 6058
213 Ga0207695_10115159 3300025913 Bacteria 2663
214 Ga0207695_10146275 3300025913 Bacteria 2307
215 Ga0207671_10123013 3300025914 Bacteria 1984
216 Ga0207693_10003384 3300025915 Bacteria 13621
217 Ga0207693_10180151 3300025915 Bacteria 1663
218 Ga0207693_10194125 3300025915 Bacteria 1597
219 Ga0207660_10021340 3300025917 Bacteria 4355
220 Ga0207660_10098411 3300025917 Bacteria 2182
221 Ga0207660_10099331 3300025917 Bacteria 2172
222 Ga0207652_10000671 3300025921 Bacteria 33464
223 Ga0207652_10020161 3300025921 Bacteria 5489
224 Ga0207652_10028011 3300025921 Bacteria 4697
225 Ga0207652_10078693 3300025921 Bacteria 2879
226 Ga0207652_10188457 3300025921 Bacteria 1855
227 Ga0207694_10055021 3300025924 Bacteria 3089
228 Ga0207694_10100916 3300025924 Bacteria 2287
229 Ga0207694_10134757 3300025924 Bacteria 1982
230 Ga0207650_10049662 3300025925 Bacteria 3099
231 Ga0207650_10158596 3300025925 Unclassified 1791
232 Ga0207659_10026147 3300025926 Bacteria 3935
233 Ga0207687_10022213 3300025927 Bacteria 4220
234 Ga0207700_10007062 3300025928 Bacteria 6831
235 Ga0207700_10099100 3300025928 Unclassified 2319
236 Ga0207700_10140047 3300025928 Bacteria 1987
237 Ga0207644_10065222 3300025931 Bacteria 2647
238 Ga0207706_10133297 3300025933 Bacteria 2185
239 Ga0207665_10011796 3300025939 Bacteria 5743
240 Ga0207691_10053404 3300025940 Bacteria 3689
241 Ga0207711_10080230 3300025941 Bacteria 2850
242 Ga0207711_10095007 3300025941 Bacteria 2628
243 Ga0207711_10187968 3300025941 Bacteria 1881
244 Ga0207689_10042381 3300025942 Bacteria 3765
245 Ga0207661_10090349 3300025944 Bacteria 2550
246 Ga0207679_10049963 3300025945 Bacteria 3053
247 Ga0207667_10003028 3300025949 Bacteria 20860
248 Ga0207667_10003124 3300025949 Bacteria 20501
249 Ga0207667_10058166 3300025949 Bacteria 4056
250 Ga0207667_10075852 3300025949 Bacteria 3490
251 Ga0207667_10222077 3300025949 Unclassified 1936
252 Ga0207651_10152937 3300025960 Unclassified 1799
253 Ga0207651_10157119 3300025960 Unclassified 1778
254 Ga0207651_10249465 3300025960 Unclassified 1451
255 Ga0207658_10000591 3300025986 Bacteria 32569
256 Ga0207677_10015495 3300026023 Bacteria 4487
257 Ga0207703_10000722 3300026035 Bacteria 32472
258 Ga0207703_10001413 3300026035 Bacteria 21871
259 Ga0207703_10022354 3300026035 Bacteria 4960
260 Ga0207703_10060925 3300026035 Bacteria 3088
261 Ga0207678_10016811 3300026067 Bacteria 6425
262 Ga0207708_10011426 3300026075 Bacteria 6613
263 Ga0207702_10034229 3300026078 Bacteria 4247
264 Ga0207641_10005051 3300026088 Bacteria 11305
265 Ga0207641_10107595 3300026088 Bacteria 2466
266 Ga0207648_10099302 3300026089 Bacteria 2549
267 Ga0207674_10278063 3300026116 Bacteria 1622
268 Ga0207675_100003109 3300026118 Bacteria 16277
269 Ga0207675_100031550 3300026118 Bacteria 4935
270 Ga0207675_100035870 3300026118 Bacteria 4626
271 Ga0207683_10013559 3300026121 Bacteria 6953
272 Ga0207683_10018011 3300026121 Bacteria 6023
273 Ga0268266_10000228 3300028379 Bacteria 97214
274 Ga0268266_10001374 3300028379 Bacteria 29323
275 Ga0268266_10054742 3300028379 Bacteria 3429
276 Ga0268266_10075379 3300028379 Bacteria 2930
277 Ga0268266_10126432 3300028379 Bacteria 2282
278 Ga0268266_10128487 3300028379 Bacteria 2264
279 Ga0268265_10213163 3300028380 Bacteria 1684
280 Ga0268264_10000415 3300028381 Bacteria 60291
281 Ga0268264_10012802 3300028381 Bacteria 6904
282 Ga0265319_1001721 3300028563 Bacteria 12608
283 Ga0265334_10000132 3300028573 Bacteria 46945
284 Ga0265318_10026368 3300028577 Bacteria 2288
285 Ga0307515_10024827 3300028794 Bacteria 10410
286 Ga0265338_10019369 3300028800 Bacteria 7222
287 Ga0307511_10000105 3300030521 Bacteria 75047
288 Ga0307511_10015359 3300030521 Bacteria 7419
289 Ga0265330_10001189 3300031235 Bacteria 15432
290 Ga0265332_10001741 3300031238 Bacteria 11817
291 Ga0265328_10001816 3300031239 Bacteria 9739
292 Ga0265329_10002547 3300031242 Bacteria 8225
293 Ga0265340_10035906 3300031247 Bacteria 2459
294 Ga0265339_10060552 3300031249 Bacteria 2040
295 Ga0265331_10009422 3300031250 Bacteria 5480
296 Ga0265331_10031116 3300031250 Bacteria 2654
297 Ga0307513_10010445 3300031456 Bacteria 11640
298 Ga0307513_10013172 3300031456 Bacteria 10161
299 Ga0307513_10027426 3300031456 Bacteria 6540
300 Ga0307513_10048486 3300031456 Bacteria 4610
301 Ga0307513_10155980 3300031456 Bacteria 2183
302 Ga0307513_10297603 3300031456 Unclassified 1382
303 Ga0307509_10000017 3300031507 Bacteria 265012
304 Ga0307509_10031552 3300031507 Bacteria 5851
305 Ga0307509_10174693 3300031507 Bacteria 2022
306 Ga0307408_100014721 3300031548 Bacteria 5199
307 Ga0265313_10014657 3300031595 Bacteria 4618
308 Ga0265314_10008771 3300031711 Bacteria 8644
309 Ga0307405_10096661 3300031731 Bacteria 1970
310 Ga0307413_10001382 3300031824 Bacteria 9127
311 Ga0307413_10045907 3300031824 Bacteria 2593
312 Ga0307413_10143542 3300031824 Bacteria 1653
313 Ga0307413_10188920 3300031824 Unclassified 1477
314 Ga0307410_10008974 3300031852 Bacteria 5579
315 Ga0307407_10001896 3300031903 Bacteria 7895
316 Ga0307407_10016170 3300031903 Bacteria 3708
317 Ga0307409_100046676 3300031995 Bacteria 3281
318 Ga0307416_100064934 3300032002 Bacteria 2997
319 Ga0307411_10001583 3300032005 Bacteria 9439
320 Ga0307415_100010958 3300032126 Bacteria 5162
321 Ga0307415_100096614 3300032126 Bacteria 2154
322 Ga0307510_10000002 3300033180 Bacteria 801565
323 Ga0307510_10017746 3300033180 Bacteria 8387
324 Ga0373936_0007231 3300035113 Bacteria 4179
325 Ga0373955_0005219 3300035172 Bacteria 5822
326 Ga0373955_0084084 3300035172 Bacteria 1804
327 Ga0373933_0143956 3300035724 Unclassified 1506
328 Ga0373937_0015171 3300036401 Bacteria 6808
329 Ga0373937_0034972 3300036401 Bacteria 4570
330 Ga0395900_0062624 3300037418 Bacteria 3824
331 Ga0395898_0004245 3300037466 Bacteria 15714
332 Ga0395898_0022100 3300037466 Bacteria 6444
333 Ga0395898_0225884 3300037466 Bacteria 1786
334 Ga0395901_0372874 3300038443 Bacteria 1470
335 Ga0436363_0623767 3300039450 Bacteria 2836
336 Ga0436363_1435919 3300039450 Bacteria 21399
337 Ga0436362_0262746 3300039453 Bacteria 2781
338 Ga0451791_0453779 3300041451 Bacteria 3508
339 Ga0451833_0902237 3300041491 Bacteria 2327
340 Ga0451837_1275265 3300041494 Bacteria 1399
341 Ga0466969_0001454 3300044656 Bacteria 12735
342 Ga0466972_0038247 3300044658 Bacteria 2344
343 Ga0466966_0010169 3300044684 Bacteria 6242
344 Ga0466961_0010684 3300044693 Bacteria 5862
345 Ga0466964_0009626 3300044706 Bacteria 3640
346 Ga0466971_0002114 3300044719 Bacteria 8416
347 Ga0466968_0004722 3300044735 Bacteria 5104
348 Ga0466960_0100449 3300044901 Unclassified 1489
349 Ga0466959_0066408 3300045049 Bacteria 2617
350 Ga0466959_0118177 3300045049 Bacteria 1887
351 Ga0466958_0030156 3300045836 Bacteria 3219
352 Ga0495617_052145 3300046452 Unclassified 1359
353 Ga0495590_0005292 3300046457 Bacteria 5121
354 Ga0495638_0014803 3300046460 Bacteria 5259
355 Ga0495638_0023785 3300046460 Bacteria 4002
356 Ga0495580_0005866 3300046472 Bacteria 10079
357 Ga0495580_0109094 3300046472 Bacteria 1922
358 Ga0495582_0106903 3300046473 Unclassified 1570
359 Ga0495583_0067534 3300046506 Bacteria 1579
360 Ga0495606_0024586 3300046507 Bacteria 4336
361 Ga0495606_0129420 3300046507 Unclassified 1502
362 Ga0495616_0016112 3300046513 Bacteria 4142
363 Ga0495630_0034481 3300046517 Bacteria 3779
364 Ga0495632_0018930 3300046519 Bacteria 3761
365 Ga0495632_0080228 3300046519 Unclassified 1557
366 Ga0495665_0036600 3300046531 Bacteria 2620
367 Ga0495587_0057636 3300046536 Bacteria 2283
368 Ga0495668_0167035 3300046616 Bacteria 1205
369 Ga0495625_0014623 3300046660 Bacteria 6254
370 Ga0495625_0015029 3300046660 Bacteria 6149
371 Ga0495599_0171660 3300046678 Unclassified 1338
372 Ga0495658_0023260 3300046683 Bacteria 3288
373 Ga0495649_0006326 3300046694 Bacteria 7371
374 Ga0495649_0083380 3300046694 Bacteria 1708
375 Ga0495649_0104044 3300046694 Bacteria 1507
376 Ga0495687_012971 3300047443 Bacteria 4372
377 Ga0495687_032825 3300047443 Bacteria 2364
378 Ga0496100_0015770 3300048903 Bacteria 4418
379 Ga0496102_0015514 3300048905 Bacteria 6636
380 Ga0496102_0028753 3300048905 Bacteria 4969
381 Ga0496110_0008282 3300048913 Bacteria 8360
382 Ga0496111_0004318 3300048914 Bacteria 8965
383 Ga0496112_0017663 3300048915 Bacteria 6710
384 Ga0496113_0026379 3300048916 Bacteria 4154
385 Ga0496113_0180008 3300048916 Bacteria 1676
386 Ga0496114_0185630 3300048917 Unclassified 1817
387 Ga0496115_0156988 3300048918 Bacteria 1879
388 Ga0496115_0167016 3300048918 Bacteria 1820
389 Ga0496117_0000135 3300048920 Bacteria 160708
390 Ga0496118_0000098 3300048921 Bacteria 160610
391 Ga0496118_0013900 3300048921 Bacteria 7572
392 Ga0496119_0011363 3300048922 Bacteria 7386
393 Ga0496119_0038718 3300048922 Bacteria 3076
394 Ga0496120_0005202 3300048923 Bacteria 10487
395 Ga0496120_0035339 3300048923 Bacteria 2985
396 Ga0496121_0001196 3300048924 Bacteria 45454
397 Ga0496121_0079865 3300048924 Bacteria 2595
398 Ga0496124_0010146 3300048927 Bacteria 9585
399 Ga0496125_0000653 3300048928 Bacteria 57890
400 Ga0496125_0019522 3300048928 Bacteria 6388
401 Ga0496125_0092171 3300048928 Bacteria 2266
402 Ga0496126_0003322 3300048929 Bacteria 20463
403 Ga0496126_0047406 3300048929 Bacteria 3934
404 Ga0501037_0183324 3300049573 Bacteria 1485
405 Ga0501070_0041807 3300049586 Bacteria 3817
406 Ga0501071_0005739 3300049587 Bacteria 8008
407 Ga0501073_0067308 3300049589 Unclassified 2497
408 Ga0501074_0011275 3300049590 Bacteria 6497
409 Ga0501076_0007251 3300049592 Bacteria 8065
410 Ga0501077_0007685 3300049593 Bacteria 6655
411 Ga0501079_0001688 3300049741 Bacteria 15706
412 Ga0501083_0009723 3300049744 Bacteria 6793
413 nmdc:mga08y16_51503_c1 3300050511 Bacteria 4307
414 Ga0495612_0026533 3300053078 Bacteria 2328
415 Ga0500583_0020475 3300053092 Unclassified 2732
416 Ga0500583_0052698 3300053092 Unclassified 1894
417 Ga0500641_0027411 3300053096 Unclassified 2218
418 Ga0500556_0000507 3300053104 Bacteria 26797
419 Ga0500572_014477 3300053111 Bacteria 1972
420 Ga0500595_050009 3300053119 Bacteria 1300
421 Ga0500642_0058854 3300053130 Bacteria 1719
422 Ga0500652_028641 3300053131 Unclassified 2166
423 Ga0500652_037008 3300053131 Bacteria 1946
424 Ga0500658_0014858 3300053134 Bacteria 2885
425 Ga0500588_0002873 3300053146 Bacteria 3575
426 Ga0500590_024630 3300053148 Bacteria 3124
427 Ga0500616_0000064 3300053153 Bacteria 243072
428 Ga0500622_0006740 3300053156 Bacteria 6616
429 Ga0500637_0015027 3300053178 Bacteria 4092
430 Ga0501084_0011163 3300054114 Bacteria 7441
431 Ga0466962_0012379 3300061719 Bacteria 4101
432 Ga0307409_100137535
433 JGI25406J46586_10001949
434 rootH1_10102833
435 rootH2_10265245
436 rootL2_10251149
437 rootH1_10145978
438 Ga0058862_11991047
439 Ga0065707_10081916
440 Ga0070683_100008496
441 Ga0070683_100117152
442 Ga0070690_100002641
443 Ga0070690_100051173
444 Ga0070670_100071927
445 Ga0070670_100110123
446 Ga0068869_100085440
447 Ga0070666_10014842
448 Ga0070666_10033991
449 Ga0070680_100009183
450 Ga0070680_100046441
451 Ga0070680_100052586
452 Ga0070682_100005091
453 Ga0070682_100010247
454 Ga0070682_100166863
455 Ga0068868_100009676
456 Ga0068868_100156872
457 Ga0070661_100030650
458 Ga0070692_10147714
459 Ga0070669_100013301
460 Ga0070671_100001004
461 Ga0070671_100007680
462 Ga0070674_100045942
463 Ga0070673_100022688
464 Ga0070673_100038929
465 Ga0070688_100030079
466 Ga0070667_100000184
467 Ga0070667_100001335
468 Ga0070667_100009779
469 Ga0070667_100095009
470 Ga0070667_100127907
471 Ga0070709_10002040
472 Ga0070714_100083995
473 Ga0070713_100032484
474 Ga0070713_100125382
475 Ga0070710_10167701
476 Ga0070711_100004809
477 Ga0070700_100079859
478 Ga0070663_100039256
479 Ga0070678_100047049
480 Ga0070681_10002219
481 Ga0070681_10006730
482 Ga0070681_10038546
483 Ga0070681_10049161
484 Ga0070681_10064557
485 Ga0070681_10076887
486 Ga0070681_10145298
487 Ga0070681_10223905
488 Ga0070681_10324593
489 Ga0068867_100029679
490 Ga0068867_100070834
491 Ga0068867_100084395
492 Ga0068867_100150618
493 Ga0070685_10174714
494 Ga0070679_100007165
495 Ga0070679_100063123
496 Ga0070679_100079058
497 Ga0070679_100081467
498 Ga0070679_100170824
499 Ga0070684_100069488
500 Ga0070672_100019173
501 Ga0070686_100037044
502 Ga0070686_100077352
503 Ga0070695_100008584
504 Ga0070696_100088758
505 Ga0070696_100090067
506 Ga0070665_100001413
507 Ga0070665_100002995
508 Ga0070665_100006051
509 Ga0070665_100025812
510 Ga0070665_100090080
511 Ga0070665_100149478
512 Ga0068855_100000693
513 Ga0068855_100035665
514 Ga0068855_100056805
515 Ga0068855_100064209
516 Ga0068855_100086078
517 Ga0068855_100123216
518 Ga0068855_100266693
519 Ga0068856_100008905
520 Ga0068859_100004414
521 Ga0068859_100095132
522 Ga0068859_100224462
523 Ga0068864_100142570
524 Ga0068866_10061139
525 Ga0068861_100003578
526 Ga0068861_100008942
527 Ga0068861_100101570
528 Ga0068861_100166869
529 Ga0068870_10003823
530 Ga0068863_100000710
531 Ga0068863_100060773
532 Ga0068863_100161803
533 Ga0068858_100002611
534 Ga0068858_100010005
535 Ga0068858_100046167
536 Ga0068858_100203573
537 Ga0068858_100262656
538 Ga0068860_100003804
539 Ga0068860_100016766
540 Ga0068860_100073394
541 Ga0068860_100130483
542 Ga0068862_100235734
543 Ga0068862_100238698
544 Ga0081455_10000098
545 Ga0081455_10261421
546 Ga0081539_10000006
547 Ga0070715_10005162
548 Ga0070716_100014684
549 Ga0070712_100097885
550 Ga0097621_100130052
551 Ga0068871_100018048
552 Ga0068871_100180631
553 Ga0068871_100200618
554 Ga0068865_100007963
555 Ga0068865_100008201
556 Ga0068865_100047378
557 Ga0097620_100004414
558 Ga0097620_100095133
559 Ga0097620_100224472
560 Ga0105240_10002376
561 Ga0105240_10015665
562 Ga0105240_10019455
563 Ga0105240_10027325
564 Ga0105240_10030836
565 Ga0105240_10032977
566 Ga0105240_10042790
567 Ga0105240_10064989
568 Ga0111539_10050564
569 Ga0105245_10022455
570 Ga0105247_10001109
571 Ga0105247_10007928
572 Ga0105247_10012255
573 Ga0105242_10005943
574 Ga0105242_10025308
575 Ga0105248_10004600
576 Ga0105248_10034899
577 Ga0105248_10502771
578 Ga0105237_10010549
579 Ga0105237_10120657
580 Ga0105238_10003998
581 Ga0105238_10090344
582 Ga0105238_10117195
583 Ga0105238_10118684
584 Ga0105238_10179759
585 Ga0105238_10305195
586 Ga0105249_10051395
587 Ga0105249_10115602
588 Ga0105249_10146769
589 Ga0099796_10041773
590 Ga0105239_10012758
591 Ga0157369_10035905
592 Ga0157369_10472768
593 Ga0157374_10027660
594 Ga0157374_10067553
595 Ga0157374_10267980
596 Ga0157378_10009784
597 Ga0163162_10031073
598 Ga0163162_10067681
599 Ga0163162_10196573
600 Ga0163162_10228952
601 Ga0157372_10249880
602 Ga0157375_10051505
603 Ga0157375_10115225
604 Ga0157375_10212913
605 Ga0163163_10005861
606 Ga0163163_10021471
607 Ga0163163_10031205
608 Ga0163163_10108714
609 Ga0163163_10193747
610 Ga0157380_10004746
611 Ga0157380_10048521
612 Ga0157380_10152555
613 Ga0157380_10231423
614 Ga0157380_10352204
615 Ga0157379_10015428
616 Ga0157379_10016416
617 Ga0157379_10079387
618 Ga0157379_10226905
619 Ga0157376_10025119
620 Ga0213873_10023552
621 Ga0207682_10034580
622 Ga0207692_10084993
623 Ga0207642_10005849
624 Ga0207710_10006428
625 Ga0207710_10051897
626 Ga0207685_10040713
627 Ga0207699_10008887
628 Ga0207643_10006807
629 Ga0207654_10084417
630 Ga0207707_10000115
631 Ga0207707_10000140
632 Ga0207707_10000148
633 Ga0207707_10001748
634 Ga0207707_10010490
635 Ga0207707_10068052
636 Ga0207707_10086175
637 Ga0207707_10093276
638 Ga0207707_10109811
639 Ga0207695_10005076
640 Ga0207695_10005438
641 Ga0207695_10016051
642 Ga0207695_10023614
643 Ga0207695_10029496
644 Ga0207695_10115159
645 Ga0207695_10146275
646 Ga0207671_10123013
647 Ga0207693_10003384
648 Ga0207693_10180151
649 Ga0207693_10194125
650 Ga0207660_10021340
651 Ga0207660_10098411
652 Ga0207660_10099331
653 Ga0207652_10000671
654 Ga0207652_10020161
655 Ga0207652_10028011
656 Ga0207652_10078693
657 Ga0207652_10188457
658 Ga0207694_10055021
659 Ga0207694_10100916
660 Ga0207694_10134757
661 Ga0207650_10049662
662 Ga0207650_10158596
663 Ga0207659_10026147
664 Ga0207687_10022213
665 Ga0207700_10007062
666 Ga0207700_10099100
667 Ga0207700_10140047
668 Ga0207644_10065222
669 Ga0207706_10133297
670 Ga0207665_10011796
671 Ga0207691_10053404
672 Ga0207711_10080230
673 Ga0207711_10095007
674 Ga0207711_10187968
675 Ga0207689_10042381
676 Ga0207661_10090349
677 Ga0207679_10049963
678 Ga0207667_10003028
679 Ga0207667_10003124
680 Ga0207667_10058166
681 Ga0207667_10075852
682 Ga0207667_10222077
683 Ga0207651_10152937
684 Ga0207651_10157119
685 Ga0207651_10249465
686 Ga0207658_10000591
687 Ga0207677_10015495
688 Ga0207703_10000722
689 Ga0207703_10001413
690 Ga0207703_10022354
691 Ga0207703_10060925
692 Ga0207678_10016811
693 Ga0207708_10011426
694 Ga0207702_10034229
695 Ga0207641_10005051
696 Ga0207641_10107595
697 Ga0207648_10099302
698 Ga0207674_10278063
699 Ga0207675_100003109
700 Ga0207675_100031550
701 Ga0207675_100035870
702 Ga0207683_10013559
703 Ga0207683_10018011
704 Ga0268266_10000228
705 Ga0268266_10001374
706 Ga0268266_10054742
707 Ga0268266_10075379
708 Ga0268266_10126432
709 Ga0268266_10128487
710 Ga0268265_10213163
711 Ga0268264_10000415
712 Ga0268264_10012802
713 Ga0265319_1001721
714 Ga0265334_10000132
715 Ga0265318_10026368
716 Ga0307515_10024827
717 Ga0265338_10019369
718 Ga0307511_10000105
719 Ga0307511_10015359
720 Ga0265330_10001189
721 Ga0265332_10001741
722 Ga0265328_10001816
723 Ga0265329_10002547
724 Ga0265340_10035906
725 Ga0265339_10060552
726 Ga0265331_10009422
727 Ga0265331_10031116
728 Ga0307513_10010445
729 Ga0307513_10013172
730 Ga0307513_10027426
731 Ga0307513_10048486
732 Ga0307513_10155980
733 Ga0307513_10297603
734 Ga0307509_10000017
735 Ga0307509_10031552
736 Ga0307509_10174693
737 Ga0307408_100014721
738 Ga0265313_10014657
739 Ga0265314_10008771
740 Ga0307405_10096661
741 Ga0307413_10001382
742 Ga0307413_10045907
743 Ga0307413_10143542
744 Ga0307413_10188920
745 Ga0307410_10008974
746 Ga0307407_10001896
747 Ga0307407_10016170
748 Ga0307409_100046676
749 Ga0307416_100064934
750 Ga0307411_10001583
751 Ga0307415_100010958
752 Ga0307415_100096614
753 Ga0307510_10000002
754 Ga0307510_10017746
755 Ga0373936_0007231
756 Ga0373955_0005219
757 Ga0373955_0084084
758 Ga0373933_0143956
759 Ga0373937_0015171
760 Ga0373937_0034972
761 Ga0395900_0062624
762 Ga0395898_0004245
763 Ga0395898_0022100
764 Ga0395898_0225884
765 Ga0395901_0372874
766 Ga0436363_0623767
767 Ga0436363_1435919
768 Ga0436362_0262746
769 Ga0451791_0453779
770 Ga0451833_0902237
771 Ga0451837_1275265
772 Ga0466969_0001454
773 Ga0466972_0038247
774 Ga0466966_0010169
775 Ga0466961_0010684
776 Ga0466964_0009626
777 Ga0466971_0002114
778 Ga0466968_0004722
779 Ga0466960_0100449
780 Ga0466959_0066408
781 Ga0466959_0118177
782 Ga0466958_0030156
783 Ga0495617_052145
784 Ga0495590_0005292
785 Ga0495638_0014803
786 Ga0495638_0023785
787 Ga0495580_0005866
788 Ga0495580_0109094
789 Ga0495582_0106903
790 Ga0495583_0067534
791 Ga0495606_0024586
792 Ga0495606_0129420
793 Ga0495616_0016112
794 Ga0495630_0034481
795 Ga0495632_0018930
796 Ga0495632_0080228
797 Ga0495665_0036600
798 Ga0495587_0057636
799 Ga0495668_0167035
800 Ga0495625_0014623
801 Ga0495625_0015029
802 Ga0495599_0171660
803 Ga0495658_0023260
804 Ga0495649_0006326
805 Ga0495649_0083380
806 Ga0495649_0104044
807 Ga0495687_012971
808 Ga0495687_032825
809 Ga0496100_0015770
810 Ga0496102_0015514
811 Ga0496102_0028753
812 Ga0496110_0008282
813 Ga0496111_0004318
814 Ga0496112_0017663
815 Ga0496113_0026379
816 Ga0496113_0180008
817 Ga0496114_0185630
818 Ga0496115_0156988
819 Ga0496115_0167016
820 Ga0496117_0000135
821 Ga0496118_0000098
822 Ga0496118_0013900
823 Ga0496119_0011363
824 Ga0496119_0038718
825 Ga0496120_0005202
826 Ga0496120_0035339
827 Ga0496121_0001196
828 Ga0496121_0079865
829 Ga0496124_0010146
830 Ga0496125_0000653
831 Ga0496125_0019522
832 Ga0496125_0092171
833 Ga0496126_0003322
834 Ga0496126_0047406
835 Ga0501037_0183324
836 Ga0501070_0041807
837 Ga0501071_0005739
838 Ga0501073_0067308
839 Ga0501074_0011275
840 Ga0501076_0007251
841 Ga0501077_0007685
842 Ga0501079_0001688
843 Ga0501083_0009723
844 nmdc:mga08y16_51503_c1
845 Ga0495612_0026533
846 Ga0500583_0020475
847 Ga0500583_0052698
848 Ga0500641_0027411
849 Ga0500556_0000507
850 Ga0500572_014477
851 Ga0500595_050009
852 Ga0500642_0058854
853 Ga0500652_028641
854 Ga0500652_037008
855 Ga0500658_0014858
856 Ga0500588_0002873
857 Ga0500590_024630
858 Ga0500616_0000064
859 Ga0500622_0006740
860 Ga0500637_0015027
861 Ga0501084_0011163
862 Ga0466962_0012379

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00570

HRDC

HRDC domain

251

318

0.97

PF01612

DNA_pol_A_exo1

3'-5' exonuclease

39

209

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wud-assembly1.cif.gz_A e. coli recq hrdc domain 0.9069 211 280
2rhf-assembly1.cif.gz_A d. radiodurans recq hrdc domain 3 0.9058 211 284
7mqe-assembly1.cif.gz_K bartonella henselae nrnc complexed with pagg. c1 reconstruction. 0.878 21 185
7c4c-assembly1.cif.gz_A the crystal structure of trypanosoma brucei rnase d : gmp complex 0.8738 4 164
2rhf-assembly1.cif.gz_A d. radiodurans recq hrdc domain 3 0.8729 211 284
ID Description Score Start End Superfamily
1yt3A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9327 1 193 3.30.420.10
1yt3A01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9236 1 193 3.30.420.10
af_Q9VFF3_178_475_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.92 4 185 3.30.420.10
af_A0A0N7KNI7_63_347_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.9156 1 170 3.30.420.10
1yt3A02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;HRDC domain 0.9142 193 286 1.10.150.80
ID Description Score Start End GO Terms
AF-T0ZF60-F1-model_v4 Ribonuclease D 0.9788 1 117 GO:0003676
GO:0006139
GO:0008408
AF-A0A534FI36-F1-model_v4 Ribonuclease D 0.9769 2 199 GO:0003676
GO:0006139
GO:0008408
AF-A0A2M7PUL2-F1-model_v4 Ribonuclease D 0.9664 5 144 GO:0003676
GO:0006139
GO:0008408
AF-A0A2N3G9Z5-F1-model_v4 Ribonuclease D 0.9643 2 255 GO:0000166
GO:0003676
GO:0005737
GO:0008033
GO:0008408
GO:0033890
AF-Q6SHB2-F1-model_v4 Ribonuclease D, putative 0.9618 4 165 GO:0003676
GO:0006139
GO:0008408

Map