F442398

General Info

Members Datasets Scaffolds Average Seq Length
431 264 413 292

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10000290|Ga0307516_1000029023
Length 279
Sequence MVSRFRHAALVGKYQSQGMRGVLEEIAQFLIRQGLEVSMETQTALNTGITDHGAMTPDELGRECDLAVVVGGDGTMLGIARQLARHGTPLVGINTGRLGFITDVASGNFAEVLAPMIAGDVRRDGDLIFEGFAMNDVVVSRGGAASMVELKVDIGDEFVANFRSDGLIVGSPTGSTAYALSAGGPILHPGIAAWVLVPIAPHDLSNRPIVLPDTGEISIGIVAGRDASVSFDMQSLASLLHGDRINVRRSAHQVRFLHPRGWNYYATLRRKLHWNSGVN

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2547132374 Acidovorax radicis N35 Isolate Unclassified
3 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
4 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
5 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
6 2643221570 Acidovorax sp. Root568 Isolate Unclassified
7 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
10 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
11 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
12 2643221652 Acidovorax sp. Root402 Isolate Unclassified
13 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
14 2643221717 Acidovorax sp. Root267 Isolate Unclassified
15 2721755523 Delftia sp. HK171 Isolate Unclassified
16 2831864461 Roseateles noduli HZ7 Isolate Nodule
17 2839138175 Delftia acidovorans B15 Isolate Rhizosphere
18 2881101125 Ramlibacter rhizophilus CCTCC AB2015357 Isolate Rhizosphere
19 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
20 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
21 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
22 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
23 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
24 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
25 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
29 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
30 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
31 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
32 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
33 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
34 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
35 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
36 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
37 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
38 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
39 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
43 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
44 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
45 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
46 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
47 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
73 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
74 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
85 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
93 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
104 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
107 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
108 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
109 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
113 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
115 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
116 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
117 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
120 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
156 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
164 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
165 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
166 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
169 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
172 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
173 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
184 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
185 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
188 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
189 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
190 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
191 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
194 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
205 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
206 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
207 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
208 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
209 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
210 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
213 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
214 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
215 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
216 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
217 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
218 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
219 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
226 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
231 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
234 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
245 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
246 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
247 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
248 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
249 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
250 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
251 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
255 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
256 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
257 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
258 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
259 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
260 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
261 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
262 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
263 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
264 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.59
Metatranscriptomes 0
Isolates 4.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.17
Nodule 0.7
Rhizoplane 2.78
Rhizosphere 68.21
Stem 0
Stem Tuber 0
Unclassified 11.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25155J39150_1000102 3300002704 Bacteria 45181
2 JGI25156J39149_1000010 3300002705 Bacteria 200080
3 JGI25154J39366_1000027 3300002738 Bacteria 200075
4 JGI25157J39369_1000146 3300002741 Bacteria 59929
5 JGI25159J45721_1000345 3300002987 Bacteria 21479
6 JGI25151J46595_10002678 3300003187 Bacteria 10424
7 JGI25151J46595_10005611 3300003187 Bacteria 6455
8 rootH1_10005450 3300003316 Bacteria 1837
9 rootH1_10005450 3300003323 Bacteria 3126
10 rootL2_10013127 3300003322 Bacteria 4307
11 rootL2_10044957 3300003322 Bacteria 2715
12 JGI25160J50197_1000129 3300003354 Bacteria 68068
13 JGI25161J50226_1000080 3300003374 Bacteria 79971
14 Ga0055524_1000247 3300003775 Bacteria 56379
15 Ga0055530_10005043 3300003791 Bacteria 6488
16 Ga0055540_1000260 3300003792 Bacteria 47714
17 Ga0055540_1021854 3300003792 Bacteria 1651
18 Ga0055531_10000647 3300003794 Bacteria 30060
19 Ga0055531_10015036 3300003794 Bacteria 3438
20 Ga0055543_1000202 3300004625 Bacteria 48648
21 Ga0055543_1005002 3300004625 Bacteria 3469
22 Ga0065165_1000170 3300005262 Bacteria 115389
23 Ga0065165_1019843 3300005262 Bacteria 2386
24 Ga0065707_10088120 3300005295 Bacteria 4732
25 Ga0070676_10002205 3300005328 Bacteria 9935
26 Ga0068869_100302884 3300005334 Bacteria 1291
27 Ga0070680_100023015 3300005336 Bacteria 4965
28 Ga0068868_100013610 3300005338 Bacteria 5973
29 Ga0068868_100267929 3300005338 Bacteria 1442
30 Ga0070660_100175788 3300005339 Bacteria 1731
31 Ga0070661_100000641 3300005344 Bacteria 25944
32 Ga0070668_100428023 3300005347 Bacteria 1134
33 Ga0070669_100152300 3300005353 Bacteria 1791
34 Ga0070671_100001289 3300005355 Bacteria 18800
35 Ga0070671_100009137 3300005355 Bacteria 7960
36 Ga0070671_100098250 3300005355 Bacteria 2456
37 Ga0070674_100021022 3300005356 Bacteria 4183
38 Ga0070673_100492804 3300005364 Bacteria 1107
39 Ga0070659_100006157 3300005366 Bacteria 8660
40 Ga0070667_100008669 3300005367 Bacteria 8426
41 Ga0070667_100433838 3300005367 Bacteria 1199
42 Ga0070663_100216819 3300005455 Bacteria 1501
43 Ga0070678_100135859 3300005456 Bacteria 1961
44 Ga0070662_100007102 3300005457 Bacteria 7248
45 Ga0068867_100000120 3300005459 Bacteria 49908
46 Ga0068867_100000361 3300005459 Bacteria 30295
47 Ga0068867_100007173 3300005459 Bacteria 7877
48 Ga0068867_100056554 3300005459 Bacteria 2903
49 Ga0070707_100398043 3300005468 Bacteria 1337
50 Ga0068853_100047098 3300005539 Bacteria 3700
51 Ga0070672_100048483 3300005543 Bacteria 3301
52 Ga0070686_100151774 3300005544 Bacteria 1623
53 Ga0070665_100007217 3300005548 Bacteria 11294
54 Ga0068855_100053375 3300005563 Bacteria 4755
55 Ga0068855_100260549 3300005563 Bacteria 1932
56 Ga0070664_100001233 3300005564 Bacteria 20476
57 Ga0070664_100360976 3300005564 Bacteria 1323
58 Ga0068857_100017805 3300005577 Bacteria 6229
59 Ga0068856_100230903 3300005614 Bacteria 1866
60 Ga0068852_100016674 3300005616 Bacteria 5739
61 Ga0068859_100095163 3300005617 Bacteria 3031
62 Ga0068864_100275163 3300005618 Bacteria 1570
63 Ga0068861_100000432 3300005719 Bacteria 24368
64 Ga0068863_100047356 3300005841 Bacteria 4078
65 Ga0068858_100177533 3300005842 Bacteria 2010
66 Ga0068860_100001815 3300005843 Bacteria 22723
67 Ga0068860_100130400 3300005843 Bacteria 2412
68 Ga0068862_100014563 3300005844 Bacteria 6530
69 Ga0068862_100057623 3300005844 Bacteria 3332
70 Ga0068862_100125165 3300005844 Bacteria 2269
71 Ga0081455_10101202 3300005937 Bacteria 2313
72 Ga0075365_10008257 3300006038 Bacteria 5894
73 Ga0075363_100046381 3300006048 Bacteria 2305
74 Ga0075363_100063539 3300006048 Bacteria 1993
75 Ga0075363_100066239 3300006048 Bacteria 1954
76 Ga0075364_10302840 3300006051 Bacteria 1088
77 Ga0075432_10015580 3300006058 Bacteria 2593
78 Ga0075362_10008529 3300006177 Bacteria 3924
79 Ga0075362_10021765 3300006177 Bacteria 2695
80 Ga0075362_10023021 3300006177 Bacteria 2630
81 Ga0075367_10007605 3300006178 Bacteria 5562
82 Ga0075367_10010796 3300006178 Bacteria 4811
83 Ga0075366_10007333 3300006195 Bacteria 6083
84 Ga0075366_10028210 3300006195 Bacteria 3294
85 Ga0075366_10039084 3300006195 Bacteria 2804
86 Ga0075366_10054448 3300006195 Bacteria 2376
87 Ga0075366_10104394 3300006195 Bacteria 1703
88 Ga0097621_100213391 3300006237 Bacteria 1680
89 Ga0075370_10052703 3300006353 Bacteria 2309
90 Ga0068871_100020062 3300006358 Bacteria 5115
91 Ga0068865_100003291 3300006881 Bacteria 9670
92 Ga0097620_100095163 3300006931 Bacteria 3031
93 Ga0079104_1000714 3300006946 Bacteria 30116
94 Ga0105250_10003026 3300009092 Bacteria 8126
95 Ga0105240_10031144 3300009093 Bacteria 6921
96 Ga0105240_10052797 3300009093 Bacteria 5107
97 Ga0111539_10435186 3300009094 Bacteria 1527
98 Ga0105245_10099189 3300009098 Bacteria 2692
99 Ga0105245_10133222 3300009098 Bacteria 2333
100 Ga0105245_10243737 3300009098 Bacteria 1743
101 Ga0114129_10087844 3300009147 Bacteria 4311
102 Ga0105243_10003409 3300009148 Bacteria 12894
103 Ga0105243_10012005 3300009148 Bacteria 6548
104 Ga0105243_10070577 3300009148 Bacteria 2821
105 Ga0105243_10107612 3300009148 Bacteria 2326
106 Ga0105248_10003014 3300009177 Bacteria 18682
107 Ga0105237_10001363 3300009545 Bacteria 32325
108 Ga0105238_10002436 3300009551 Bacteria 18670
109 Ga0105238_10019647 3300009551 Bacteria 6880
110 Ga0105239_10000954 3300010375 Bacteria 40769
111 Ga0157378_10035512 3300013297 Bacteria 4409
112 Ga0157378_10151253 3300013297 Bacteria 2163
113 Ga0163162_10016522 3300013306 Bacteria 7211
114 Ga0157375_10021108 3300013308 Bacteria 5965
115 Ga0157375_10120437 3300013308 Bacteria 2733
116 Ga0157375_10469251 3300013308 Bacteria 1424
117 Ga0157380_10028524 3300014326 Bacteria 4256
118 Ga0157377_10000132 3300014745 Bacteria 47931
119 Ga0157379_10018155 3300014968 Bacteria 6199
120 Ga0157379_10039645 3300014968 Bacteria 4203
121 Ga0157379_10211088 3300014968 Bacteria 1757
122 Ga0157376_10008300 3300014969 Bacteria 7486
123 Ga0213872_10008429 3300021361 Bacteria 4990
124 Ga0209435_100003 3300025206 Bacteria 669534
125 Ga0209436_116604 3300025208 Bacteria 1099
126 Ga0207425_1001975 3300025245 Bacteria 7678
127 Ga0209646_1000008 3300025246 Bacteria 669534
128 Ga0209026_1000007 3300025250 Bacteria 669534
129 Ga0209759_1000019 3300025256 Bacteria 357908
130 Ga0209565_1005568 3300025263 Bacteria 3641
131 Ga0209673_1007110 3300025273 Bacteria 5243
132 Ga0209673_1023479 3300025273 Bacteria 2098
133 Ga0209130_1000095 3300025284 Bacteria 145126
134 Ga0209675_1024806 3300025291 Bacteria 1524
135 Ga0209676_1002365 3300025292 Bacteria 13576
136 Ga0209025_1003200 3300025294 Bacteria 15884
137 Ga0209025_1005762 3300025294 Bacteria 9941
138 Ga0209564_1012749 3300025295 Bacteria 3636
139 Ga0209758_1004365 3300025297 Bacteria 11829
140 Ga0209758_1024145 3300025297 Bacteria 2719
141 Ga0209050_1001662 3300025298 Bacteria 22481
142 Ga0209050_1003646 3300025298 Bacteria 11128
143 Ga0209256_1000049 3300025299 Bacteria 310696
144 Ga0207426_1000397 3300025302 Bacteria 73966
145 Ga0209051_1000247 3300025303 Bacteria 91122
146 Ga0209051_1000591 3300025303 Bacteria 42820
147 Ga0209257_1000015 3300025304 Bacteria 908141
148 Ga0209257_1000141 3300025304 Bacteria 201130
149 Ga0207696_1003941 3300025711 Bacteria 6545
150 Ga0207645_10002245 3300025907 Bacteria 15384
151 Ga0207643_10035463 3300025908 Bacteria 2797
152 Ga0207695_10021712 3300025913 Bacteria 7317
153 Ga0207695_10046250 3300025913 Bacteria 4614
154 Ga0207657_10289187 3300025919 Bacteria 1300
155 Ga0207649_10001339 3300025920 Bacteria 14649
156 Ga0207652_10007020 3300025921 Bacteria 9076
157 Ga0207652_10170295 3300025921 Bacteria 1954
158 Ga0207646_10127303 3300025922 Bacteria 2290
159 Ga0207694_10082227 3300025924 Bacteria 2531
160 Ga0207694_10212942 3300025924 Bacteria 1574
161 Ga0207687_10069586 3300025927 Bacteria 2510
162 Ga0207644_10000423 3300025931 Bacteria 27440
163 Ga0207644_10147372 3300025931 Bacteria 1818
164 Ga0207644_10252865 3300025931 Bacteria 1406
165 Ga0207644_10305225 3300025931 Bacteria 1284
166 Ga0207644_10417920 3300025931 Bacteria 1098
167 Ga0207690_10000176 3300025932 Bacteria 49560
168 Ga0207706_10006846 3300025933 Bacteria 10535
169 Ga0207709_10000273 3300025935 Bacteria 60743
170 Ga0207709_10002858 3300025935 Bacteria 10579
171 Ga0207709_10010147 3300025935 Bacteria 5187
172 Ga0207709_10058922 3300025935 Bacteria 2388
173 Ga0207704_10002881 3300025938 Bacteria 7774
174 Ga0207704_10110893 3300025938 Bacteria 1854
175 Ga0207691_10012019 3300025940 Bacteria 8304
176 Ga0207711_10030822 3300025941 Bacteria 4524
177 Ga0207711_10039493 3300025941 Bacteria 4015
178 Ga0207689_10208698 3300025942 Bacteria 1613
179 Ga0207679_10000168 3300025945 Bacteria 54187
180 Ga0207679_10286427 3300025945 Bacteria 1415
181 Ga0207667_10430873 3300025949 Bacteria 1341
182 Ga0207668_10164394 3300025972 Bacteria 1733
183 Ga0207658_10008596 3300025986 Bacteria 6947
184 Ga0207658_10073074 3300025986 Bacteria 2602
185 Ga0207677_10003135 3300026023 Bacteria 8721
186 Ga0207677_10009966 3300026023 Bacteria 5361
187 Ga0207703_10057101 3300026035 Bacteria 3181
188 Ga0207639_10012324 3300026041 Bacteria 5954
189 Ga0207639_10279915 3300026041 Bacteria 1466
190 Ga0207678_10256116 3300026067 Bacteria 1499
191 Ga0207678_10354123 3300026067 Bacteria 1266
192 Ga0207641_10018479 3300026088 Bacteria 5716
193 Ga0207641_10060394 3300026088 Bacteria 3231
194 Ga0207641_10172926 3300026088 Bacteria 1973
195 Ga0207648_10000393 3300026089 Bacteria 48485
196 Ga0207648_10001573 3300026089 Bacteria 25016
197 Ga0207648_10009736 3300026089 Bacteria 9188
198 Ga0207676_10165617 3300026095 Bacteria 1920
199 Ga0207676_10346478 3300026095 Bacteria 1372
200 Ga0207674_10008702 3300026116 Bacteria 11684
201 Ga0207674_10098303 3300026116 Bacteria 2910
202 Ga0207675_100001788 3300026118 Bacteria 21504
203 Ga0207683_10014305 3300026121 Bacteria 6760
204 Ga0207683_10063979 3300026121 Bacteria 3241
205 Ga0207698_10007953 3300026142 Bacteria 6679
206 Ga0209281_1000007 3300027111 Bacteria 938265
207 Ga0209813_10019528 3300027866 Bacteria 1885
208 Ga0268266_10007197 3300028379 Bacteria 10074
209 Ga0268266_10081098 3300028379 Bacteria 2828
210 Ga0268265_10009213 3300028380 Bacteria 6671
211 Ga0268265_10015570 3300028380 Bacteria 5206
212 Ga0268265_10034794 3300028380 Bacteria 3675
213 Ga0268264_10013028 3300028381 Bacteria 6836
214 Ga0268264_10045299 3300028381 Bacteria 3651
215 Ga0307517_10000131 3300028786 Bacteria 113233
216 Ga0307517_10147051 3300028786 Bacteria 1631
217 Ga0307515_10000011 3300028794 Bacteria 633903
218 Ga0307515_10000257 3300028794 Bacteria 131732
219 Ga0307515_10000382 3300028794 Bacteria 107907
220 Ga0307515_10059214 3300028794 Bacteria 5494
221 Ga0307515_10122055 3300028794 Bacteria 2942
222 Ga0307515_10310646 3300028794 Bacteria 1252
223 Ga0265332_10000005 3300031238 Bacteria 377525
224 Ga0265332_10009775 3300031238 Bacteria 4281
225 Ga0307513_10000113 3300031456 Bacteria 114576
226 Ga0307513_10005571 3300031456 Bacteria 16606
227 Ga0307513_10008679 3300031456 Bacteria 12948
228 Ga0307513_10014140 3300031456 Bacteria 9765
229 Ga0307513_10020309 3300031456 Bacteria 7881
230 Ga0307513_10046532 3300031456 Bacteria 4728
231 Ga0307513_10378768 3300031456 Bacteria 1155
232 Ga0307408_100000029 3300031548 Bacteria 227806
233 Ga0307408_100000101 3300031548 Bacteria 94089
234 Ga0307408_100037880 3300031548 Bacteria 3399
235 Ga0307408_100291732 3300031548 Bacteria 1362
236 Ga0307408_100313502 3300031548 Bacteria 1319
237 Ga0307508_10010382 3300031616 Bacteria 8521
238 Ga0307514_10000560 3300031649 Bacteria 71030
239 Ga0307514_10000928 3300031649 Bacteria 44600
240 Ga0307514_10061396 3300031649 Bacteria 2863
241 Ga0265314_10001337 3300031711 Bacteria 27913
242 Ga0265314_10063092 3300031711 Bacteria 2515
243 Ga0307516_10000290 3300031730 Bacteria 65231
244 Ga0307516_10006023 3300031730 Bacteria 14334
245 Ga0307516_10110995 3300031730 Bacteria 2545
246 Ga0307406_10000497 3300031901 Bacteria 22565
247 Ga0307406_10011441 3300031901 Bacteria 5037
248 Ga0307406_10071316 3300031901 Bacteria 2277
249 Ga0307412_10040019 3300031911 Bacteria 3031
250 Ga0307412_10056588 3300031911 Bacteria 2614
251 Ga0307412_10138364 3300031911 Bacteria 1780
252 Ga0307412_10252217 3300031911 Bacteria 1371
253 Ga0307412_10507961 3300031911 Bacteria 1005
254 Ga0307416_100338887 3300032002 Bacteria 1515
255 Ga0307510_10157109 3300033180 Bacteria 1879
256 Ga0373944_0075350 3300035089 Bacteria 1106
257 Ga0373939_0020773 3300035114 Bacteria 1789
258 Ga0373931_0020263 3300035691 Bacteria 3325
259 Ga0373927_0013482 3300035695 Bacteria 5432
260 Ga0373925_0003102 3300037068 Bacteria 13039
261 Ga0373925_0095085 3300037068 Bacteria 2282
262 Ga0395899_0032508 3300037312 Bacteria 3919
263 Ga0395900_0000879 3300037418 Bacteria 39414
264 Ga0395900_0010159 3300037418 Bacteria 9627
265 Ga0395900_0044417 3300037418 Bacteria 4578
266 Ga0395900_0045890 3300037418 Bacteria 4500
267 Ga0395900_0058816 3300037418 Bacteria 3957
268 Ga0395900_0122702 3300037418 Bacteria 2665
269 Ga0395900_0326560 3300037418 Bacteria 1513
270 Ga0395898_0002107 3300037466 Bacteria 24665
271 Ga0395898_0014448 3300037466 Bacteria 8109
272 Ga0395898_0029039 3300037466 Bacteria 5541
273 Ga0395905_0000212 3300037471 Bacteria 89838
274 Ga0395905_0000600 3300037471 Bacteria 48145
275 Ga0395905_0006209 3300037471 Bacteria 12059
276 Ga0395905_0010494 3300037471 Bacteria 9009
277 Ga0395905_0013798 3300037471 Bacteria 7732
278 Ga0395905_0024633 3300037471 Bacteria 5677
279 Ga0395905_0032298 3300037471 Bacteria 4923
280 Ga0395905_0044088 3300037471 Bacteria 4185
281 Ga0395905_0062735 3300037471 Bacteria 3476
282 Ga0395905_0073699 3300037471 Bacteria 3200
283 Ga0395905_0115226 3300037471 Bacteria 2525
284 Ga0395905_0123028 3300037471 Bacteria 2439
285 Ga0395905_0148668 3300037471 Bacteria 2204
286 Ga0395905_0163151 3300037471 Bacteria 2094
287 Ga0395905_0214109 3300037471 Bacteria 1804
288 Ga0395905_0221445 3300037471 Bacteria 1771
289 Ga0395901_0038457 3300038443 Bacteria 4949
290 Ga0395901_0043377 3300038443 Bacteria 4666
291 Ga0395901_0055608 3300038443 Bacteria 4116
292 Ga0395901_0182512 3300038443 Bacteria 2201
293 Ga0395901_0355701 3300038443 Bacteria 1511
294 Ga0395901_0559958 3300038443 Bacteria 1157
295 Ga0395901_0635597 3300038443 Bacteria 1072
296 Ga0436361_0247854 3300039447 Bacteria 31958
297 Ga0451797_1247492 3300041453 Bacteria 1106
298 Ga0451798_0808305 3300041458 Bacteria 1168
299 Ga0451807_0825458 3300041486 Bacteria 1762
300 Ga0439431_0004146 3300041997 Bacteria 3180
301 Ga0439449_0000138 3300042007 Bacteria 24667
302 Ga0439449_0068723 3300042007 Bacteria 1306
303 Ga0439449_0116594 3300042007 Bacteria 991
304 Ga0450898_005406 3300042134 Bacteria 1929
305 Ga0450898_006713 3300042134 Bacteria 1775
306 Ga0439446_0009612 3300042156 Bacteria 2591
307 Ga0439446_0080707 3300042156 Bacteria 1007
308 Ga0439458_0021434 3300042157 Bacteria 1496
309 Ga0439434_0013651 3300042435 Bacteria 2412
310 Ga0439464_0015081 3300042439 Bacteria 2083
311 Ga0450918_000560 3300042531 Bacteria 7930
312 Ga0451577_0010826 3300042876 Bacteria 8669
313 Ga0451577_0032633 3300042876 Bacteria 4691
314 Ga0451577_0065875 3300042876 Bacteria 3230
315 Ga0466969_0000020 3300044656 Bacteria 101861
316 Ga0466969_0117746 3300044656 Bacteria 1238
317 Ga0466972_0003678 3300044658 Bacteria 7627
318 Ga0466972_0005826 3300044658 Bacteria 6178
319 Ga0453683_0010232 3300044673 Bacteria 6223
320 Ga0466965_0002140 3300044683 Bacteria 8295
321 Ga0466965_0026555 3300044683 Bacteria 2807
322 Ga0466965_0054226 3300044683 Bacteria 1993
323 Ga0466966_0006054 3300044684 Bacteria 7988
324 Ga0466966_0127126 3300044684 Bacteria 1562
325 Ga0466961_0003365 3300044693 Bacteria 9982
326 Ga0466963_0004799 3300044694 Bacteria 7884
327 Ga0466964_0003590 3300044706 Bacteria 5666
328 Ga0466964_0025959 3300044706 Bacteria 2290
329 Ga0466964_0166464 3300044706 Bacteria 1034
330 Ga0453684_0037469 3300044712 Bacteria 6655
331 Ga0453684_0097202 3300044712 Bacteria 3614
332 Ga0453684_0334623 3300044712 Bacteria 1711
333 Ga0466971_0001757 3300044719 Bacteria 9193
334 Ga0466971_0031671 3300044719 Bacteria 2368
335 Ga0466968_0063669 3300044735 Bacteria 1594
336 Ga0466970_0053483 3300044765 Bacteria 2156
337 Ga0466957_0008223 3300044842 Bacteria 5926
338 Ga0466957_0072024 3300044842 Bacteria 2139
339 Ga0466960_0059499 3300044901 Bacteria 1869
340 Ga0466959_0000424 3300045049 Bacteria 24579
341 Ga0466959_0057781 3300045049 Bacteria 2827
342 Ga0466959_0064218 3300045049 Bacteria 2665
343 Ga0451576_0004840 3300045051 Bacteria 17241
344 Ga0451576_0045812 3300045051 Bacteria 4604
345 Ga0451576_0353838 3300045051 Bacteria 1538
346 Ga0466958_0040566 3300045836 Bacteria 2797
347 Ga0466958_0122207 3300045836 Bacteria 1631
348 Ga0466967_0051270 3300045976 Bacteria 3615
349 Ga0466967_0462917 3300045976 Bacteria 1241
350 Ga0495650_0001952 3300046471 Bacteria 18228
351 Ga0495606_0090573 3300046507 Bacteria 1882
352 Ga0495642_0051460 3300046528 Bacteria 1694
353 Ga0495654_0001046 3300046530 Bacteria 20265
354 Ga0495597_0000084 3300046542 Bacteria 83344
355 Ga0495656_0004218 3300046615 Bacteria 4908
356 Ga0495656_0102024 3300046615 Bacteria 1328
357 Ga0495636_0042385 3300047318 Bacteria 1891
358 Ga0495686_0119471 3300047472 Bacteria 1573
359 Ga0495602_0086550 3300048088 Bacteria 2616
360 Ga0495615_0001487 3300048090 Bacteria 3510
361 Ga0496101_0334357 3300048904 Bacteria 1189
362 Ga0496104_0122005 3300048907 Bacteria 2502
363 Ga0496105_0061257 3300048908 Bacteria 3105
364 Ga0496106_0078156 3300048909 Bacteria 2538
365 Ga0496108_0096498 3300048911 Bacteria 2518
366 Ga0496110_0257607 3300048913 Bacteria 1588
367 Ga0496112_0085963 3300048915 Bacteria 3111
368 Ga0496113_0020738 3300048916 Bacteria 4626
369 Ga0496114_0010797 3300048917 Bacteria 7270
370 Ga0496121_0006219 3300048924 Bacteria 14965
371 Ga0496124_0000108 3300048927 Bacteria 167473
372 Ga0496124_0009516 3300048927 Bacteria 9996
373 Ga0501034_0248785 3300049571 Bacteria 1722
374 Ga0501043_0000002 3300049579 Bacteria 351081
375 Ga0501043_0152390 3300049579 Bacteria 1809
376 Ga0501043_0226436 3300049579 Bacteria 1445
377 Ga0501046_0000008 3300049580 Bacteria 351167
378 Ga0501046_0084254 3300049580 Bacteria 2452
379 Ga0501047_0000003 3300049581 Bacteria 508375
380 Ga0501047_0165491 3300049581 Bacteria 2082
381 Ga0501048_0000983 3300049582 Bacteria 21145
382 Ga0501249_036465 3300049679 Bacteria 1108
383 Ga0501080_0191258 3300049742 Bacteria 1880
384 Ga0501035_0051450 3300049822 Bacteria 3689
385 Ga0501035_0194910 3300049822 Bacteria 1740
386 Ga0501044_0008847 3300049823 Bacteria 11011
387 Ga0501045_0001581 3300049824 Bacteria 15187
388 nmdc:mga03683_11699_c1 3300050489 Bacteria 3186
389 nmdc:mga03683_91537_c1 3300050489 Bacteria 1326
390 nmdc:mga03n38_36844_c1 3300050490 Bacteria 2105
391 nmdc:mga00v17_23402_c1 3300050491 Bacteria 3573
392 nmdc:mga0yw44_48509_c1 3300050492 Bacteria 2561
393 nmdc:mga0k408_1565_c1 3300050493 Bacteria 12364
394 nmdc:mga0k408_29494_c1 3300050493 Bacteria 3123
395 nmdc:mga06z11_166583_c1 3300050494 Bacteria 1263
396 nmdc:mga04h51_112946_c1 3300050495 Bacteria 1004
397 nmdc:mga05p37_591912_c1 3300050507 Bacteria 1254
398 nmdc:mga08y16_542051_c1 3300050511 Bacteria 1178
399 Ga0500578_0000025 3300053086 Bacteria 151485
400 Ga0500578_0050608 3300053086 Bacteria 2664
401 Ga0500644_0009031 3300053088 Bacteria 2652
402 Ga0500583_0128756 3300053092 Bacteria 1255
403 Ga0500651_0000704 3300053093 Bacteria 16477
404 Ga0500593_000065 3300053117 Bacteria 38993
405 Ga0500622_0002141 3300053156 Bacteria 14669
406 Ga0500645_003337 3300053730 Bacteria 6580
407 Ga0500645_003450 3300053730 Bacteria 6408
408 Ga0500645_011945 3300053730 Bacteria 2818
409 Ga0500645_068647 3300053730 Bacteria 1019
410 Ga0500587_008824 3300053739 Bacteria 1294
411 Ga0590075_016394 3300059424 Bacteria 1822
412 Ga0501082_0318981 3300060353 Bacteria 1354
413 Ga0466962_0011341 3300061719 Bacteria 4292

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005344 Ga0070661_100000641 Ga0070661_10000064110 265
2 3300005366 Ga0070659_100006157 Ga0070659_1000061577 265
3 3300005564 Ga0070664_100001233 Ga0070664_10000123310 265
4 3300009147 Ga0114129_10087844 Ga0114129_100878444 265
5 3300025920 Ga0207649_10001339 Ga0207649_1000133910 265
6 3300025932 Ga0207690_10000176 Ga0207690_1000017652 265
7 3300025945 Ga0207679_10000168 Ga0207679_1000016838 265
8 3300026067 Ga0207678_10354123 Ga0207678_103541232 265
9 3300042157 Ga0439458_0021434 Ga0439458_0021434_248_1120 265
10 3300050507 nmdc:mga05p37_591912_c1 nmdc:mga05p37_591912_c1_190_1065 265
11 iso_pu_bacteria 2585428057 2587725555 268
12 iso_pu_bacteria 2585428058 2587735023 268
13 iso_pu_bacteria 2588253510 2588290555 268
14 3300031649 Ga0307514_10000560 Ga0307514_1000056037 270
15 3300028786 Ga0307517_10147051 Ga0307517_101470512 272
16 3300045976 Ga0466967_0462917 Ga0466967_0462917_26_844 272
17 3300026041 Ga0207639_10279915 Ga0207639_102799152 273
18 3300044683 Ga0466965_0026555 Ga0466965_0026555_1472_2293 273
19 3300005456 Ga0070678_100135859 Ga0070678_1001358592 277
20 3300005548 Ga0070665_100007217 Ga0070665_1000072178 277
21 3300026121 Ga0207683_10014305 Ga0207683_100143059 277
22 3300028379 Ga0268266_10007197 Ga0268266_100071972 277
23 3300031730 Ga0307516_10000290 Ga0307516_1000029023 279
24 iso_pu_bacteria 2831864461 2831865133 280
25 3300005457 Ga0070662_100007102 Ga0070662_1000071024 281
26 3300044656 Ga0466969_0117746 Ga0466969_0117746_30_875 281
27 3300048904 Ga0496101_0334357 Ga0496101_0334357_163_1008 281
28 3300048916 Ga0496113_0020738 Ga0496113_0020738_14_862 281
29 3300042876 Ga0451577_0010826 Ga0451577_0010826_6234_7136 282
30 3300044673 Ga0453683_0010232 Ga0453683_0010232_3994_4896 282
31 3300044712 Ga0453684_0097202 Ga0453684_0097202_504_1406 282
32 3300045051 Ga0451576_0004840 Ga0451576_0004840_10599_11501 282
33 3300050495 nmdc:mga04h51_112946_c1 nmdc:mga04h51_112946_c1_112_987 284
34 iso_pu_bacteria 2643221592 2643970070 286
35 iso_pu_bacteria 2643221625 2644142956 286
36 iso_pu_bacteria 2643221644 2644244864 286
37 iso_pu_bacteria 2643221648 2644271984 286
38 iso_pu_bacteria 2511231002 2511242736 287
39 iso_pu_bacteria 2547132374 2548498957 287
40 iso_pu_bacteria 2643221570 2643867825 287
41 iso_pu_bacteria 2643221596 2643991689 287
42 iso_pu_bacteria 2643221652 2644293436 287
43 iso_pu_bacteria 2643221654 2644303277 287
44 iso_pu_bacteria 2643221717 2644648416 287
45 iso_pu_bacteria 2721755523 2722882045 287
46 iso_pu_bacteria 2839138175 2839142555 287
47 iso_pu_bacteria 2881101125 2881102661 287
48 iso_pu_bacteria 2990710928 2990713865 287
49 3300003316 rootH1_10005450 rootH1_100054501 288
50 3300003322 rootL2_10044957 rootL2_100449572 288
51 3300009148 Ga0105243_10107612 Ga0105243_101076122 288
52 3300025935 Ga0207709_10010147 Ga0207709_100101472 288
53 3300031548 Ga0307408_100000029 Ga0307408_10000002993 288
54 3300045051 Ga0451576_0353838 Ga0451576_0353838_402_1289 288
55 3300044712 Ga0453684_0037469 Ga0453684_0037469_5057_5926 289
56 3300003775 Ga0055524_1000247 Ga0055524_100024745 290
57 3300003791 Ga0055530_10005043 Ga0055530_100050432 290
58 3300003792 Ga0055540_1000260 Ga0055540_10002609 290
59 3300003794 Ga0055531_10015036 Ga0055531_100150362 290
60 3300005334 Ga0068869_100302884 Ga0068869_1003028842 290
61 3300005338 Ga0068868_100267929 Ga0068868_1002679291 290
62 3300005339 Ga0070660_100175788 Ga0070660_1001757882 290
63 3300005355 Ga0070671_100001289 Ga0070671_10000128912 290
64 3300005364 Ga0070673_100492804 Ga0070673_1004928042 290
65 3300005563 Ga0068855_100053375 Ga0068855_1000533754 290
66 3300005563 Ga0068855_100260549 Ga0068855_1002605492 290
67 3300005564 Ga0070664_100360976 Ga0070664_1003609762 290
68 3300005614 Ga0068856_100230903 Ga0068856_1002309032 290
69 3300005618 Ga0068864_100275163 Ga0068864_1002751632 290
70 3300005841 Ga0068863_100047356 Ga0068863_1000473564 290
71 3300006048 Ga0075363_100063539 Ga0075363_1000635392 290
72 3300006237 Ga0097621_100213391 Ga0097621_1002133912 290
73 3300006358 Ga0068871_100020062 Ga0068871_1000200622 290
74 3300006946 Ga0079104_1000714 Ga0079104_100071419 290
75 3300009093 Ga0105240_10052797 Ga0105240_100527972 290
76 3300009098 Ga0105245_10099189 Ga0105245_100991892 290
77 3300009551 Ga0105238_10019647 Ga0105238_100196472 290
78 3300014969 Ga0157376_10008300 Ga0157376_100083002 290
79 3300025263 Ga0209565_1005568 Ga0209565_10055682 290
80 3300025291 Ga0209675_1024806 Ga0209675_10248062 290
81 3300025298 Ga0209050_1001662 Ga0209050_100166213 290
82 3300025299 Ga0209256_1000049 Ga0209256_100004929 290
83 3300025303 Ga0209051_1000247 Ga0209051_10002479 290
84 3300025304 Ga0209257_1000141 Ga0209257_10001419 290
85 3300025913 Ga0207695_10021712 Ga0207695_100217122 290
86 3300025921 Ga0207652_10170295 Ga0207652_101702952 290
87 3300025924 Ga0207694_10212942 Ga0207694_102129421 290
88 3300025927 Ga0207687_10069586 Ga0207687_100695862 290
89 3300025931 Ga0207644_10000423 Ga0207644_1000042315 290
90 3300025941 Ga0207711_10030822 Ga0207711_100308223 290
91 3300025942 Ga0207689_10208698 Ga0207689_102086982 290
92 3300025945 Ga0207679_10286427 Ga0207679_102864272 290
93 3300026023 Ga0207677_10009966 Ga0207677_100099663 290
94 3300026088 Ga0207641_10018479 Ga0207641_100184794 290
95 3300026088 Ga0207641_10060394 Ga0207641_100603942 290
96 3300026095 Ga0207676_10165617 Ga0207676_101656172 290
97 3300026095 Ga0207676_10346478 Ga0207676_103464781 290
98 3300026116 Ga0207674_10098303 Ga0207674_100983032 290
99 3300028794 Ga0307515_10000011 Ga0307515_10000011188 290
100 3300031548 Ga0307408_100037880 Ga0307408_1000378802 290
101 3300031548 Ga0307408_100291732 Ga0307408_1002917322 290
102 3300031548 Ga0307408_100313502 Ga0307408_1003135022 290
103 3300031711 Ga0265314_10063092 Ga0265314_100630922 290
104 3300031911 Ga0307412_10056588 Ga0307412_100565881 290
105 3300031911 Ga0307412_10252217 Ga0307412_102522172 290
106 3300037312 Ga0395899_0032508 Ga0395899_0032508_1343_2236 290
107 3300037418 Ga0395900_0044417 Ga0395900_0044417_2002_2895 290
108 3300037418 Ga0395900_0058816 Ga0395900_0058816_1251_2144 290
109 3300037466 Ga0395898_0029039 Ga0395898_0029039_80_973 290
110 3300037471 Ga0395905_0123028 Ga0395905_0123028_1274_2167 290
111 3300037471 Ga0395905_0214109 Ga0395905_0214109_682_1575 290
112 3300037471 Ga0395905_0221445 Ga0395905_0221445_389_1282 290
113 3300038443 Ga0395901_0043377 Ga0395901_0043377_2859_3752 290
114 3300038443 Ga0395901_0355701 Ga0395901_0355701_24_917 290
115 3300042007 Ga0439449_0000138 Ga0439449_0000138_18593_19486 290
116 3300042531 Ga0450918_000560 Ga0450918_000560_588_1460 290
117 3300046471 Ga0495650_0001952 Ga0495650_0001952_10615_11502 290
118 3300048917 Ga0496114_0010797 Ga0496114_0010797_2926_3798 290
119 3300049579 Ga0501043_0152390 Ga0501043_0152390_537_1430 290
120 3300049581 Ga0501047_0165491 Ga0501047_0165491_224_1117 290
121 3300049822 Ga0501035_0194910 Ga0501035_0194910_67_960 290
122 3300050489 nmdc:mga03683_91537_c1 nmdc:mga03683_91537_c1_406_1299 290
123 3300050490 nmdc:mga03n38_36844_c1 nmdc:mga03n38_36844_c1_167_1060 290
124 3300053086 Ga0500578_0000025 Ga0500578_0000025_65976_66848 290
125 3300059424 Ga0590075_016394 Ga0590075_016394_616_1509 290
126 3300002704 JGI25155J39150_1000102 JGI25155J39150_100010215 291
127 3300002705 JGI25156J39149_1000010 JGI25156J39149_1000010159 291
128 3300002738 JGI25154J39366_1000027 JGI25154J39366_1000027159 291
129 3300002741 JGI25157J39369_1000146 JGI25157J39369_100014653 291
130 3300002987 JGI25159J45721_1000345 JGI25159J45721_10003453 291
131 3300003187 JGI25151J46595_10002678 JGI25151J46595_100026787 291
132 3300003187 JGI25151J46595_10005611 JGI25151J46595_100056115 291
133 3300003322 rootL2_10013127 rootL2_100131273 291
134 3300003354 JGI25160J50197_1000129 JGI25160J50197_100012929 291
135 3300003374 JGI25161J50226_1000080 JGI25161J50226_100008048 291
136 3300003792 Ga0055540_1021854 Ga0055540_10218542 291
137 3300003794 Ga0055531_10000647 Ga0055531_100006477 291
138 3300004625 Ga0055543_1000202 Ga0055543_100020248 291
139 3300004625 Ga0055543_1005002 Ga0055543_10050022 291
140 3300005262 Ga0065165_1000170 Ga0065165_100017088 291
141 3300005262 Ga0065165_1019843 Ga0065165_10198433 291
142 3300005295 Ga0065707_10088120 Ga0065707_100881205 291
143 3300005328 Ga0070676_10002205 Ga0070676_100022058 291
144 3300005336 Ga0070680_100023015 Ga0070680_1000230152 291
145 3300005338 Ga0068868_100013610 Ga0068868_1000136104 291
146 3300005347 Ga0070668_100428023 Ga0070668_1004280231 291
147 3300005353 Ga0070669_100152300 Ga0070669_1001523001 291
148 3300005355 Ga0070671_100009137 Ga0070671_1000091372 291
149 3300005355 Ga0070671_100098250 Ga0070671_1000982502 291
150 3300005356 Ga0070674_100021022 Ga0070674_1000210225 291
151 3300005367 Ga0070667_100008669 Ga0070667_1000086697 291
152 3300005367 Ga0070667_100433838 Ga0070667_1004338382 291
153 3300005455 Ga0070663_100216819 Ga0070663_1002168192 291
154 3300005459 Ga0068867_100000120 Ga0068867_1000001204 291
155 3300005459 Ga0068867_100000361 Ga0068867_10000036112 291
156 3300005459 Ga0068867_100007173 Ga0068867_1000071735 291
157 3300005459 Ga0068867_100056554 Ga0068867_1000565544 291
158 3300005468 Ga0070707_100398043 Ga0070707_1003980432 291
159 3300005539 Ga0068853_100047098 Ga0068853_1000470983 291
160 3300005543 Ga0070672_100048483 Ga0070672_1000484833 291
161 3300005544 Ga0070686_100151774 Ga0070686_1001517742 291
162 3300005577 Ga0068857_100017805 Ga0068857_1000178052 291
163 3300005616 Ga0068852_100016674 Ga0068852_1000166742 291
164 3300005617 Ga0068859_100095163 Ga0068859_1000951632 291
165 3300005719 Ga0068861_100000432 Ga0068861_10000043211 291
166 3300005842 Ga0068858_100177533 Ga0068858_1001775332 291
167 3300005843 Ga0068860_100001815 Ga0068860_10000181512 291
168 3300005843 Ga0068860_100130400 Ga0068860_1001304002 291
169 3300005844 Ga0068862_100014563 Ga0068862_1000145638 291
170 3300005844 Ga0068862_100057623 Ga0068862_1000576233 291
171 3300005844 Ga0068862_100125165 Ga0068862_1001251652 291
172 3300005937 Ga0081455_10101202 Ga0081455_101012022 291
173 3300006038 Ga0075365_10008257 Ga0075365_100082572 291
174 3300006048 Ga0075363_100046381 Ga0075363_1000463812 291
175 3300006048 Ga0075363_100066239 Ga0075363_1000662392 291
176 3300006051 Ga0075364_10302840 Ga0075364_103028401 291
177 3300006058 Ga0075432_10015580 Ga0075432_100155802 291
178 3300006177 Ga0075362_10008529 Ga0075362_100085292 291
179 3300006177 Ga0075362_10021765 Ga0075362_100217652 291
180 3300006177 Ga0075362_10023021 Ga0075362_100230215 291
181 3300006178 Ga0075367_10007605 Ga0075367_100076055 291
182 3300006178 Ga0075367_10010796 Ga0075367_100107962 291
183 3300006195 Ga0075366_10007333 Ga0075366_100073333 291
184 3300006195 Ga0075366_10028210 Ga0075366_100282102 291
185 3300006195 Ga0075366_10039084 Ga0075366_100390842 291
186 3300006195 Ga0075366_10054448 Ga0075366_100544482 291
187 3300006195 Ga0075366_10104394 Ga0075366_101043942 291
188 3300006353 Ga0075370_10052703 Ga0075370_100527032 291
189 3300006881 Ga0068865_100003291 Ga0068865_1000032916 291
190 3300006931 Ga0097620_100095163 Ga0097620_1000951632 291
191 3300009092 Ga0105250_10003026 Ga0105250_100030266 291
192 3300009093 Ga0105240_10031144 Ga0105240_100311443 291
193 3300009094 Ga0111539_10435186 Ga0111539_104351862 291
194 3300009098 Ga0105245_10133222 Ga0105245_101332222 291
195 3300009098 Ga0105245_10243737 Ga0105245_102437372 291
196 3300009148 Ga0105243_10003409 Ga0105243_100034098 291
197 3300009148 Ga0105243_10012005 Ga0105243_100120054 291
198 3300009148 Ga0105243_10070577 Ga0105243_100705773 291
199 3300009177 Ga0105248_10003014 Ga0105248_1000301415 291
200 3300009545 Ga0105237_10001363 Ga0105237_1000136336 291
201 3300009551 Ga0105238_10002436 Ga0105238_100024369 291
202 3300010375 Ga0105239_10000954 Ga0105239_1000095444 291
203 3300013297 Ga0157378_10035512 Ga0157378_100355122 291
204 3300013297 Ga0157378_10151253 Ga0157378_101512532 291
205 3300013306 Ga0163162_10016522 Ga0163162_100165222 291
206 3300013308 Ga0157375_10021108 Ga0157375_100211087 291
207 3300013308 Ga0157375_10120437 Ga0157375_101204372 291
208 3300013308 Ga0157375_10469251 Ga0157375_104692512 291
209 3300014326 Ga0157380_10028524 Ga0157380_100285242 291
210 3300014745 Ga0157377_10000132 Ga0157377_1000013232 291
211 3300014968 Ga0157379_10018155 Ga0157379_100181555 291
212 3300014968 Ga0157379_10039645 Ga0157379_100396452 291
213 3300014968 Ga0157379_10211088 Ga0157379_102110882 291
214 3300021361 Ga0213872_10008429 Ga0213872_100084295 291
215 3300025206 Ga0209435_100003 Ga0209435_100003437 291
216 3300025208 Ga0209436_116604 Ga0209436_1166041 291
217 3300025245 Ga0207425_1001975 Ga0207425_10019755 291
218 3300025246 Ga0209646_1000008 Ga0209646_1000008437 291
219 3300025250 Ga0209026_1000007 Ga0209026_1000007437 291
220 3300025256 Ga0209759_1000019 Ga0209759_1000019158 291
221 3300025273 Ga0209673_1007110 Ga0209673_10071103 291
222 3300025273 Ga0209673_1023479 Ga0209673_10234792 291
223 3300025284 Ga0209130_1000095 Ga0209130_1000095108 291
224 3300025292 Ga0209676_1002365 Ga0209676_10023652 291
225 3300025294 Ga0209025_1003200 Ga0209025_10032007 291
226 3300025294 Ga0209025_1005762 Ga0209025_10057623 291
227 3300025295 Ga0209564_1012749 Ga0209564_10127492 291
228 3300025297 Ga0209758_1004365 Ga0209758_10043657 291
229 3300025297 Ga0209758_1024145 Ga0209758_10241452 291
230 3300025298 Ga0209050_1003646 Ga0209050_100364610 291
231 3300025302 Ga0207426_1000397 Ga0207426_100039750 291
232 3300025303 Ga0209051_1000591 Ga0209051_100059111 291
233 3300025304 Ga0209257_1000015 Ga0209257_1000015849 291
234 3300025711 Ga0207696_1003941 Ga0207696_10039412 291
235 3300025907 Ga0207645_10002245 Ga0207645_100022458 291
236 3300025908 Ga0207643_10035463 Ga0207643_100354633 291
237 3300025913 Ga0207695_10046250 Ga0207695_100462506 291
238 3300025919 Ga0207657_10289187 Ga0207657_102891871 291
239 3300025921 Ga0207652_10007020 Ga0207652_100070202 291
240 3300025922 Ga0207646_10127303 Ga0207646_101273032 291
241 3300025924 Ga0207694_10082227 Ga0207694_100822273 291
242 3300025931 Ga0207644_10147372 Ga0207644_101473722 291
243 3300025931 Ga0207644_10252865 Ga0207644_102528652 291
244 3300025931 Ga0207644_10305225 Ga0207644_103052252 291
245 3300025931 Ga0207644_10417920 Ga0207644_104179201 291
246 3300025933 Ga0207706_10006846 Ga0207706_100068466 291
247 3300025935 Ga0207709_10000273 Ga0207709_100002735 291
248 3300025935 Ga0207709_10002858 Ga0207709_100028585 291
249 3300025935 Ga0207709_10058922 Ga0207709_100589222 291
250 3300025938 Ga0207704_10002881 Ga0207704_100028814 291
251 3300025938 Ga0207704_10110893 Ga0207704_101108932 291
252 3300025940 Ga0207691_10012019 Ga0207691_100120192 291
253 3300025941 Ga0207711_10039493 Ga0207711_100394933 291
254 3300025949 Ga0207667_10430873 Ga0207667_104308732 291
255 3300025972 Ga0207668_10164394 Ga0207668_101643942 291
256 3300025986 Ga0207658_10008596 Ga0207658_100085962 291
257 3300025986 Ga0207658_10073074 Ga0207658_100730742 291
258 3300026023 Ga0207677_10003135 Ga0207677_100031356 291
259 3300026035 Ga0207703_10057101 Ga0207703_100571013 291
260 3300026041 Ga0207639_10012324 Ga0207639_100123242 291
261 3300026067 Ga0207678_10256116 Ga0207678_102561162 291
262 3300026088 Ga0207641_10172926 Ga0207641_101729262 291
263 3300026089 Ga0207648_10000393 Ga0207648_1000039337 291
264 3300026089 Ga0207648_10001573 Ga0207648_1000157326 291
265 3300026089 Ga0207648_10009736 Ga0207648_100097366 291
266 3300026116 Ga0207674_10008702 Ga0207674_100087022 291
267 3300026118 Ga0207675_100001788 Ga0207675_10000178813 291
268 3300026121 Ga0207683_10063979 Ga0207683_100639794 291
269 3300026142 Ga0207698_10007953 Ga0207698_100079537 291
270 3300027111 Ga0209281_1000007 Ga0209281_1000007728 291
271 3300027866 Ga0209813_10019528 Ga0209813_100195282 291
272 3300028379 Ga0268266_10081098 Ga0268266_100810983 291
273 3300028380 Ga0268265_10009213 Ga0268265_100092138 291
274 3300028380 Ga0268265_10015570 Ga0268265_100155702 291
275 3300028380 Ga0268265_10034794 Ga0268265_100347942 291
276 3300028381 Ga0268264_10013028 Ga0268264_100130289 291
277 3300028381 Ga0268264_10045299 Ga0268264_100452993 291
278 3300028786 Ga0307517_10000131 Ga0307517_10000131105 291
279 3300028794 Ga0307515_10000257 Ga0307515_1000025731 291
280 3300028794 Ga0307515_10000382 Ga0307515_1000038241 291
281 3300028794 Ga0307515_10059214 Ga0307515_100592143 291
282 3300028794 Ga0307515_10122055 Ga0307515_101220552 291
283 3300028794 Ga0307515_10310646 Ga0307515_103106461 291
284 3300031238 Ga0265332_10000005 Ga0265332_10000005223 291
285 3300031238 Ga0265332_10009775 Ga0265332_100097753 291
286 3300031456 Ga0307513_10000113 Ga0307513_1000011340 291
287 3300031456 Ga0307513_10005571 Ga0307513_100055714 291
288 3300031456 Ga0307513_10008679 Ga0307513_1000867921 291
289 3300031456 Ga0307513_10014140 Ga0307513_100141409 291
290 3300031456 Ga0307513_10020309 Ga0307513_100203094 291
291 3300031456 Ga0307513_10046532 Ga0307513_100465323 291
292 3300031456 Ga0307513_10378768 Ga0307513_103787682 291
293 3300031548 Ga0307408_100000101 Ga0307408_10000010158 291
294 3300031616 Ga0307508_10010382 Ga0307508_100103826 291
295 3300031649 Ga0307514_10000928 Ga0307514_1000092823 291
296 3300031649 Ga0307514_10061396 Ga0307514_100613962 291
297 3300031711 Ga0265314_10001337 Ga0265314_1000133727 291
298 3300031730 Ga0307516_10006023 Ga0307516_100060235 291
299 3300031730 Ga0307516_10110995 Ga0307516_101109952 291
300 3300031901 Ga0307406_10000497 Ga0307406_100004979 291
301 3300031901 Ga0307406_10011441 Ga0307406_100114413 291
302 3300031901 Ga0307406_10071316 Ga0307406_100713162 291
303 3300031911 Ga0307412_10040019 Ga0307412_100400192 291
304 3300031911 Ga0307412_10138364 Ga0307412_101383642 291
305 3300031911 Ga0307412_10507961 Ga0307412_105079611 291
306 3300032002 Ga0307416_100338887 Ga0307416_1003388872 291
307 3300033180 Ga0307510_10157109 Ga0307510_101571092 291
308 3300035089 Ga0373944_0075350 Ga0373944_0075350_210_1085 291
309 3300035114 Ga0373939_0020773 Ga0373939_0020773_416_1291 291
310 3300035691 Ga0373931_0020263 Ga0373931_0020263_1866_2741 291
311 3300035695 Ga0373927_0013482 Ga0373927_0013482_1181_2056 291
312 3300037068 Ga0373925_0003102 Ga0373925_0003102_1733_2608 291
313 3300037068 Ga0373925_0095085 Ga0373925_0095085_269_1144 291
314 3300037418 Ga0395900_0000879 Ga0395900_0000879_156_1034 291
315 3300037418 Ga0395900_0010159 Ga0395900_0010159_8681_9580 291
316 3300037418 Ga0395900_0045890 Ga0395900_0045890_2649_3545 291
317 3300037418 Ga0395900_0122702 Ga0395900_0122702_667_1563 291
318 3300037418 Ga0395900_0326560 Ga0395900_0326560_235_1134 291
319 3300037466 Ga0395898_0002107 Ga0395898_0002107_13603_14481 291
320 3300037466 Ga0395898_0014448 Ga0395898_0014448_5903_6799 291
321 3300037471 Ga0395905_0000212 Ga0395905_0000212_43235_44131 291
322 3300037471 Ga0395905_0000600 Ga0395905_0000600_2549_3445 291
323 3300037471 Ga0395905_0006209 Ga0395905_0006209_7853_8749 291
324 3300037471 Ga0395905_0010494 Ga0395905_0010494_3260_4135 291
325 3300037471 Ga0395905_0013798 Ga0395905_0013798_4998_5894 291
326 3300037471 Ga0395905_0024633 Ga0395905_0024633_891_1787 291
327 3300037471 Ga0395905_0032298 Ga0395905_0032298_2472_3368 291
328 3300037471 Ga0395905_0044088 Ga0395905_0044088_920_1795 291
329 3300037471 Ga0395905_0062735 Ga0395905_0062735_2160_3035 291
330 3300037471 Ga0395905_0073699 Ga0395905_0073699_1383_2258 291
331 3300037471 Ga0395905_0115226 Ga0395905_0115226_395_1291 291
332 3300037471 Ga0395905_0148668 Ga0395905_0148668_760_1635 291
333 3300037471 Ga0395905_0163151 Ga0395905_0163151_59_955 291
334 3300038443 Ga0395901_0038457 Ga0395901_0038457_3730_4626 291
335 3300038443 Ga0395901_0055608 Ga0395901_0055608_2645_3541 291
336 3300038443 Ga0395901_0182512 Ga0395901_0182512_316_1215 291
337 3300038443 Ga0395901_0559958 Ga0395901_0559958_174_1070 291
338 3300038443 Ga0395901_0635597 Ga0395901_0635597_112_1011 291
339 3300039447 Ga0436361_0247854 Ga0436361_0247854_5586_6482 291
340 3300041453 Ga0451797_1247492 Ga0451797_1247492_44_919 291
341 3300041458 Ga0451798_0808305 Ga0451798_0808305_277_1152 291
342 3300041486 Ga0451807_0825458 Ga0451807_0825458_635_1510 291
343 3300041997 Ga0439431_0004146 Ga0439431_0004146_932_1807 291
344 3300042007 Ga0439449_0068723 Ga0439449_0068723_339_1217 291
345 3300042007 Ga0439449_0116594 Ga0439449_0116594_44_919 291
346 3300042134 Ga0450898_005406 Ga0450898_005406_220_1095 291
347 3300042134 Ga0450898_006713 Ga0450898_006713_820_1716 291
348 3300042156 Ga0439446_0009612 Ga0439446_0009612_787_1683 291
349 3300042156 Ga0439446_0080707 Ga0439446_0080707_49_930 291
350 3300042435 Ga0439434_0013651 Ga0439434_0013651_646_1521 291
351 3300042439 Ga0439464_0015081 Ga0439464_0015081_899_1795 291
352 3300042876 Ga0451577_0032633 Ga0451577_0032633_300_1175 291
353 3300042876 Ga0451577_0065875 Ga0451577_0065875_244_1122 291
354 3300044656 Ga0466969_0000020 Ga0466969_0000020_69085_69966 291
355 3300044658 Ga0466972_0003678 Ga0466972_0003678_5094_5969 291
356 3300044658 Ga0466972_0005826 Ga0466972_0005826_1582_2457 291
357 3300044683 Ga0466965_0002140 Ga0466965_0002140_1796_2671 291
358 3300044683 Ga0466965_0054226 Ga0466965_0054226_197_1072 291
359 3300044684 Ga0466966_0006054 Ga0466966_0006054_3660_4535 291
360 3300044684 Ga0466966_0127126 Ga0466966_0127126_154_1050 291
361 3300044693 Ga0466961_0003365 Ga0466961_0003365_7760_8635 291
362 3300044694 Ga0466963_0004799 Ga0466963_0004799_3967_4842 291
363 3300044706 Ga0466964_0003590 Ga0466964_0003590_1079_1954 291
364 3300044706 Ga0466964_0025959 Ga0466964_0025959_177_1055 291
365 3300044706 Ga0466964_0166464 Ga0466964_0166464_97_972 291
366 3300044712 Ga0453684_0334623 Ga0453684_0334623_150_1028 291
367 3300044719 Ga0466971_0001757 Ga0466971_0001757_3128_4003 291
368 3300044719 Ga0466971_0031671 Ga0466971_0031671_703_1581 291
369 3300044735 Ga0466968_0063669 Ga0466968_0063669_443_1339 291
370 3300044765 Ga0466970_0053483 Ga0466970_0053483_398_1273 291
371 3300044842 Ga0466957_0008223 Ga0466957_0008223_4617_5492 291
372 3300044842 Ga0466957_0072024 Ga0466957_0072024_754_1632 291
373 3300044901 Ga0466960_0059499 Ga0466960_0059499_804_1700 291
374 3300045049 Ga0466959_0000424 Ga0466959_0000424_2293_3168 291
375 3300045049 Ga0466959_0057781 Ga0466959_0057781_635_1516 291
376 3300045049 Ga0466959_0064218 Ga0466959_0064218_1552_2430 291
377 3300045051 Ga0451576_0045812 Ga0451576_0045812_1090_1977 291
378 3300045836 Ga0466958_0040566 Ga0466958_0040566_254_1129 291
379 3300045836 Ga0466958_0122207 Ga0466958_0122207_569_1447 291
380 3300045976 Ga0466967_0051270 Ga0466967_0051270_1072_1947 291
381 3300046507 Ga0495606_0090573 Ga0495606_0090573_522_1397 291
382 3300046528 Ga0495642_0051460 Ga0495642_0051460_586_1482 291
383 3300046530 Ga0495654_0001046 Ga0495654_0001046_10492_11388 291
384 3300046542 Ga0495597_0000084 Ga0495597_0000084_22561_23460 291
385 3300046615 Ga0495656_0004218 Ga0495656_0004218_2821_3720 291
386 3300046615 Ga0495656_0102024 Ga0495656_0102024_221_1117 291
387 3300047318 Ga0495636_0042385 Ga0495636_0042385_646_1542 291
388 3300047472 Ga0495686_0119471 Ga0495686_0119471_195_1070 291
389 3300048088 Ga0495602_0086550 Ga0495602_0086550_1526_2401 291
390 3300048090 Ga0495615_0001487 Ga0495615_0001487_444_1343 291
391 3300048907 Ga0496104_0122005 Ga0496104_0122005_1073_1951 291
392 3300048908 Ga0496105_0061257 Ga0496105_0061257_1206_2084 291
393 3300048909 Ga0496106_0078156 Ga0496106_0078156_1165_2040 291
394 3300048911 Ga0496108_0096498 Ga0496108_0096498_1414_2292 291
395 3300048913 Ga0496110_0257607 Ga0496110_0257607_190_1068 291
396 3300048915 Ga0496112_0085963 Ga0496112_0085963_457_1335 291
397 3300048924 Ga0496121_0006219 Ga0496121_0006219_12128_13003 291
398 3300048927 Ga0496124_0000108 Ga0496124_0000108_155967_156842 291
399 3300048927 Ga0496124_0009516 Ga0496124_0009516_6971_7846 291
400 3300049571 Ga0501034_0248785 Ga0501034_0248785_688_1584 291
401 3300049579 Ga0501043_0000002 Ga0501043_0000002_185404_186279 291
402 3300049579 Ga0501043_0226436 Ga0501043_0226436_292_1188 291
403 3300049580 Ga0501046_0000008 Ga0501046_0000008_185487_186362 291
404 3300049580 Ga0501046_0084254 Ga0501046_0084254_1062_1958 291
405 3300049581 Ga0501047_0000003 Ga0501047_0000003_208669_209544 291
406 3300049582 Ga0501048_0000983 Ga0501048_0000983_9061_9936 291
407 3300049679 Ga0501249_036465 Ga0501249_036465_155_1051 291
408 3300049742 Ga0501080_0191258 Ga0501080_0191258_164_1060 291
409 3300049822 Ga0501035_0051450 Ga0501035_0051450_1024_1899 291
410 3300049823 Ga0501044_0008847 Ga0501044_0008847_9705_10601 291
411 3300049824 Ga0501045_0001581 Ga0501045_0001581_5358_6233 291
412 3300050489 nmdc:mga03683_11699_c1 nmdc:mga03683_11699_c1_403_1278 291
413 3300050491 nmdc:mga00v17_23402_c1 nmdc:mga00v17_23402_c1_1222_2097 291
414 3300050492 nmdc:mga0yw44_48509_c1 nmdc:mga0yw44_48509_c1_487_1383 291
415 3300050493 nmdc:mga0k408_1565_c1 nmdc:mga0k408_1565_c1_6459_7343 291
416 3300050493 nmdc:mga0k408_29494_c1 nmdc:mga0k408_29494_c1_251_1126 291
417 3300050494 nmdc:mga06z11_166583_c1 nmdc:mga06z11_166583_c1_124_1020 291
418 3300050511 nmdc:mga08y16_542051_c1 nmdc:mga08y16_542051_c1_69_965 291
419 3300053086 Ga0500578_0050608 Ga0500578_0050608_849_1724 291
420 3300053088 Ga0500644_0009031 Ga0500644_0009031_250_1125 291
421 3300053092 Ga0500583_0128756 Ga0500583_0128756_356_1231 291
422 3300053093 Ga0500651_0000704 Ga0500651_0000704_10544_11419 291
423 3300053117 Ga0500593_000065 Ga0500593_000065_12261_13136 291
424 3300053156 Ga0500622_0002141 Ga0500622_0002141_13380_14255 291
425 3300053730 Ga0500645_003337 Ga0500645_003337_5658_6533 291
426 3300053730 Ga0500645_003450 Ga0500645_003450_5486_6361 291
427 3300053730 Ga0500645_011945 Ga0500645_011945_1883_2758 291
428 3300053730 Ga0500645_068647 Ga0500645_068647_106_981 291
429 3300053739 Ga0500587_008824 Ga0500587_008824_266_1141 291
430 3300060353 Ga0501082_0318981 Ga0501082_0318981_44_919 291
431 3300061719 Ga0466962_0011341 Ga0466962_0011341_1797_2672 291

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF20143

NAD_kinase_C

ATP-NAD kinase C-terminal domain

134

259

0.99

PF01513

NAD_kinase

ATP-NAD kinase N-terminal domain

9

121

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
2an1-assembly3.cif.gz_C structural genomics, the crystal structure of a putative kinase from salmonella typhimurim lt2 0.9416 5 289
7mh7-assembly1.cif.gz_A crystal structure of nad kinase from pseudomonas aeruginosa pao1 0.9405 5 290
2an1-assembly3.cif.gz_C structural genomics, the crystal structure of a putative kinase from salmonella typhimurim lt2 0.9382 5 289
2an1-assembly3.cif.gz_B structural genomics, the crystal structure of a putative kinase from salmonella typhimurim lt2 0.934 4 291
2an1-assembly3.cif.gz_A structural genomics, the crystal structure of a putative kinase from salmonella typhimurim lt2 0.9325 4 291
ID Description Score Start End Superfamily
2an1B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.9075 4 291 3.40.50.10330
2an1B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Probable inorganic polyphosphate/atp-NAD kinase; domain 1 0.9016 4 291 3.40.50.10330
af_O13863_343_486_2.60.200.30 Mainly Beta;Sandwich;Tumour Suppressor Smad4;Probable inorganic polyphosphate/atp-NAD kinase; domain 2 0.9013 129 263 2.60.200.30
1u0rA02 Mainly Beta;Sandwich;Tumour Suppressor Smad4;Probable inorganic polyphosphate/atp-NAD kinase; domain 2 0.8997 129 262 2.60.200.30
3afoB02 Mainly Beta;Sandwich;Tumour Suppressor Smad4;Probable inorganic polyphosphate/atp-NAD kinase; domain 2 0.894 129 262 2.60.200.30
ID Description Score Start End GO Terms
AF-A1VKP7-F1-model_v4 NAD kinase (EC 2.7.1.23) (ATP-dependent NAD kinase) 0.9754 1 291 GO:0003951
GO:0005524
GO:0005737
GO:0006741
GO:0019674
GO:0046872
GO:0051287
AF-A0A2W5DJL5-F1-model_v4 NAD kinase (EC 2.7.1.23) (ATP-dependent NAD kinase) 0.9664 1 289 GO:0003951
GO:0005524
GO:0005737
GO:0006741
GO:0019674
GO:0046872
GO:0051287
AF-A0A2W5DJL5-F1-model_v4 NAD kinase (EC 2.7.1.23) (ATP-dependent NAD kinase) 0.9631 1 289 GO:0003951
GO:0005524
GO:0005737
GO:0006741
GO:0019674
GO:0046872
GO:0051287
AF-A0A191UIK5-F1-model_v4 NAD kinase (EC 2.7.1.23) (ATP-dependent NAD kinase) 0.9613 2 291 GO:0003951
GO:0005524
GO:0005737
GO:0006741
GO:0019674
GO:0046872
GO:0051287
AF-A0A8B3VQJ0-F1-model_v4 NAD kinase (EC 2.7.1.23) (ATP-dependent NAD kinase) 0.961 5 291 GO:0003951
GO:0005524
GO:0005737
GO:0006741
GO:0019674
GO:0046872
GO:0051287

Feature Viewer

pLDDT pTM Quality
89.91 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map