metagRoot

F442322

General Info

Members	Datasets	Scaffolds	Average Seq Length
431	312	424	206

Family's Representative Sequence

Representative Sequence	3300005548\|Ga0070665_100108976\|Ga0070665_1001089763
Length	250
Sequence	MEPDAVDRTVNRVRRPAQGPHHGSVNQSRQTGRLNLTTGFVGVTMTNTRDPILTPIPILSLRPTQMTVGMREVKEKRKRWREHKSERKRAELLGKHMIPVVLGPDGHHYVVDHHHLARALHDEGVKNVLVTVIGDLTMVARDAFWTVMDHKRWAYPYDAKGERRHYRDLPKSVSGLKDDPFRSLAGELRRVGGFAKDITPFSEFLWADFLRRKMPRKSVEENFDKAMEKALGLARSPDAVYLPGWCGPVD

Samples

	Sample ID	Description	Type	Environment
1	2513237098	Bradyrhizobium elkanii WSM2783	Isolate	Nodule
2	2524023210	Bradyrhizobium sp. Ai1a-2	Isolate	Nodule
3	2876808645	Bradyrhizobium algeriense RST89	Isolate	Unclassified
4	2879110137	Bradyrhizobium algeriense RST91	Isolate	Nodule
5	2885383462	Bradyrhizobium sp. Leo170	Isolate	Unclassified
6	2903768456	Bradyrhizobium sp. Leo121	Isolate	Unclassified
7	3300002774	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA	Metagenome	Endosphere
8	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
9	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
10	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
11	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
12	3300003791	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2	Metagenome	Endosphere
13	3300003792	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2	Metagenome	Endosphere
14	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
15	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
16	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
17	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
18	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
19	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
20	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
21	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
22	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
23	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
24	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
25	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
26	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
27	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
28	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
29	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
30	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
31	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
32	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
33	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
34	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
35	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
36	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
37	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
38	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
39	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
40	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
41	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
42	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
43	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
44	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
45	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
46	3300006051	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4	Metagenome	Endosphere
47	3300006058	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1	Metagenome	Rhizosphere
48	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
49	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
50	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
51	3300006177	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2	Metagenome	Endosphere
52	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
53	3300006186	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4	Metagenome	Endosphere
54	3300006194	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1	Metagenome	Rhizosphere
55	3300006195	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1	Metagenome	Endosphere
56	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
57	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
58	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
59	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
60	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
61	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
62	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
63	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
64	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
65	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
66	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
67	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
68	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
69	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
70	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
71	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
72	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
73	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
74	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
75	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
76	3300010159	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3	Metagenome	Rhizosphere
77	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
78	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
79	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
80	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
81	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
82	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
83	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
84	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
85	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
86	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
87	3300021358	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3	Metagenome	Rhizosphere
88	3300021377	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7	Metagenome	Unclassified
89	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
90	3300021388	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8	Metagenome	Unclassified
91	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
92	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
93	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
94	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
95	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
96	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
97	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
98	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
100	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
101	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
102	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
103	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
104	3300025304	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
105	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300027512	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300027866	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2)	Metagenome	Endosphere
142	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
143	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
145	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
146	3300031249	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG	Metagenome	Rhizosphere
147	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
148	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
149	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
150	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
151	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
152	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
153	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
154	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
155	3300035116	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3	Metagenome	Rhizosphere
156	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
157	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
158	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
159	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
160	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
161	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
162	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
163	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
164	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
165	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
166	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
167	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
168	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
169	3300037853	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2	Metagenome	Unclassified
170	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
171	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
172	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
173	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
174	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
175	3300041453	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG	Metagenome	Rhizoplane
176	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
177	3300041509	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG	Metagenome	Unclassified
178	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
179	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
180	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
181	3300046460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere	Metagenome	Rhizosphere
182	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
183	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
184	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
185	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
186	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
187	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
188	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
189	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
190	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
191	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
192	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
193	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
194	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
195	3300046518	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere	Metagenome	Rhizosphere
196	3300046519	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere	Metagenome	Rhizosphere
197	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
198	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
199	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
200	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
201	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
202	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
203	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
204	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
205	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
206	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
207	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
208	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
209	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
210	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
211	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
212	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
213	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
214	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
215	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
216	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
217	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
218	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
219	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
220	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
221	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
222	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
223	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
224	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
225	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
226	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
227	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
228	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
229	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
230	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
231	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
232	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
233	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
234	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
235	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
236	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
237	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
238	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
239	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
240	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
241	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
242	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
243	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
244	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
245	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
246	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
247	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
248	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
249	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
250	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
251	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
252	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
253	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
254	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
255	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
256	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
257	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
258	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
259	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
260	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
261	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
262	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
263	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
264	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
265	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
266	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
267	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
268	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
269	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
270	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
271	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
272	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
273	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
274	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
275	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
276	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
277	3300050489	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation	Metagenome	Endosphere
278	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
279	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
280	3300050492	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation	Metagenome	Endosphere
281	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
282	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
283	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
284	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
285	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
286	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
287	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
288	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
289	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
290	3300050516	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation	Metagenome	Endosphere
291	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
292	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
293	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
294	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
295	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
296	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
297	3300053088	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere	Metagenome	Endosphere
298	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
299	3300053096	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere	Metagenome	Endosphere
300	3300053102	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere	Metagenome	Endosphere
301	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
302	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
303	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
304	3300053147	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere	Metagenome	Endosphere
305	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
306	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
307	3300053161	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere	Metagenome	Endosphere
308	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
309	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
310	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
311	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
312	8006984368	Bradyrhizobium sp. SRL28	Isolate	Unclassified

Type Distribution

Type	Percentage (%)
Metagenomes	98.38
Metatranscriptomes	0
Isolates	1.62

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	14.62
Nodule	0.7
Rhizoplane	6.96
Rhizosphere	69.61
Stem	0
Stem Tuber	0
Unclassified	8.12

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25150J39212_1000218	3300002774	Bacteria	31294
2	JGI25153J46596_10000093	3300003215	Bacteria	103442
3	JGI25153J46596_10018076	3300003215	Bacteria	2751
4	rootH2_10030164	3300003320	Bacteria	2708
5	Ga0055526_1002775	3300003771	Bacteria	11605
6	Ga0055537_1014208	3300003773	Bacteria	1456
7	Ga0055530_10017687	3300003791	Bacteria	2224
8	Ga0055540_1003916	3300003792	Bacteria	6975
9	Ga0065707_10120969	3300005295	Bacteria	2121
10	Ga0070670_100051042	3300005331	Bacteria	3553
11	Ga0070666_10223725	3300005335	Bacteria	1328
12	Ga0068868_100086295	3300005338	Bacteria	2523
13	Ga0070689_100668531	3300005340	Bacteria	905
14	Ga0070671_100001331	3300005355	Bacteria	18540
15	Ga0070671_100049969	3300005355	Bacteria	3478
16	Ga0070671_100491440	3300005355	Bacteria	1055
17	Ga0070673_100008464	3300005364	Bacteria	6841
18	Ga0070688_100035771	3300005365	Bacteria	3018
19	Ga0070659_100023050	3300005366	Bacteria	4760
20	Ga0070709_10000751	3300005434	Bacteria	18320
21	Ga0070709_10062260	3300005434	Bacteria	2378
22	Ga0070709_10160964	3300005434	Bacteria	1561
23	Ga0070709_10487786	3300005434	Bacteria	934
24	Ga0070714_100001123	3300005435	Bacteria	19235
25	Ga0070714_100012709	3300005435	Bacteria	6725
26	Ga0070714_100333070	3300005435	Bacteria	1422
27	Ga0070713_100000647	3300005436	Bacteria	22255
28	Ga0070713_100006657	3300005436	Bacteria	8039
29	Ga0070713_100031059	3300005436	Bacteria	4250
30	Ga0070713_100074135	3300005436	Bacteria	2883
31	Ga0070713_100444074	3300005436	Bacteria	1217
32	Ga0070710_10001287	3300005437	Bacteria	11902
33	Ga0070710_10054560	3300005437	Bacteria	2255
34	Ga0070711_100045601	3300005439	Bacteria	2983
35	Ga0070711_100129075	3300005439	Bacteria	1880
36	Ga0070711_100170466	3300005439	Bacteria	1658
37	Ga0070711_100372173	3300005439	Bacteria	1153
38	Ga0070700_100333721	3300005441	Bacteria	1118
39	Ga0070708_100297469	3300005445	Bacteria	1520
40	Ga0070663_100039596	3300005455	Bacteria	3294
41	Ga0070678_100729531	3300005456	Bacteria	895
42	Ga0070697_100058137	3300005536	Bacteria	3146
43	Ga0068853_100096401	3300005539	Bacteria	2610
44	Ga0070665_100033726	3300005548	Bacteria	5150
45	Ga0070665_100108976	3300005548	Bacteria	2771
46	Ga0070704_100475512	3300005549	Bacteria	1080
47	Ga0068854_100070374	3300005578	Bacteria	2557
48	Ga0068852_100311430	3300005616	Bacteria	1526
49	Ga0068852_100988645	3300005616	Bacteria	860
50	Ga0068864_100606225	3300005618	Bacteria	1063
51	Ga0068860_100634862	3300005843	Bacteria	1075
52	Ga0068860_101287514	3300005843	Bacteria	752
53	Ga0081455_10033401	3300005937	Bacteria	4624
54	Ga0081540_1029997	3300005983	Bacteria	3019
55	Ga0070717_10000905	3300006028	Bacteria	19709
56	Ga0070717_10338823	3300006028	Bacteria	1342
57	Ga0075365_10032195	3300006038	Bacteria	3369
58	Ga0075365_10087659	3300006038	Bacteria	2116
59	Ga0075368_10114896	3300006042	Bacteria	1112
60	Ga0075363_100020674	3300006048	Bacteria	3304
61	Ga0075363_100212885	3300006048	Bacteria	1106
62	Ga0075364_10181144	3300006051	Bacteria	1426
63	Ga0075432_10132662	3300006058	Bacteria	944
64	Ga0070715_10013591	3300006163	Bacteria	2994
65	Ga0070716_100008083	3300006173	Bacteria	5209
66	Ga0070712_100021012	3300006175	Bacteria	4280
67	Ga0070712_100024139	3300006175	Bacteria	4025
68	Ga0070712_100030701	3300006175	Bacteria	3615
69	Ga0070712_100126413	3300006175	Bacteria	1932
70	Ga0070712_100152940	3300006175	Bacteria	1773
71	Ga0070712_100816430	3300006175	Bacteria	801
72	Ga0075362_10242531	3300006177	Bacteria	885
73	Ga0075367_10002297	3300006178	Bacteria	8676
74	Ga0075369_10020263	3300006186	Bacteria	2722
75	Ga0075427_10002281	3300006194	Bacteria	2559
76	Ga0075366_10314962	3300006195	Bacteria	958
77	Ga0075366_10325639	3300006195	Bacteria	942
78	Ga0075366_10344020	3300006195	Bacteria	915
79	Ga0097621_100116282	3300006237	Bacteria	2265
80	Ga0068871_100515747	3300006358	Bacteria	1079
81	Ga0075428_100071694	3300006844	Bacteria	3786
82	Ga0075428_100384144	3300006844	Bacteria	1505
83	Ga0075431_100100193	3300006847	Bacteria	2989
84	Ga0075434_100079790	3300006871	Bacteria	3269
85	Ga0075429_100046455	3300006880	Bacteria	3778
86	Ga0097620_100348756	3300006931	Bacteria	1575
87	Ga0075435_100014898	3300007076	Bacteria	5831
88	Ga0099794_10047430	3300007265	Bacteria	2060
89	Ga0105240_10042752	3300009093	Bacteria	5772
90	Ga0105245_10214003	3300009098	Bacteria	1856
91	Ga0105245_10910321	3300009098	Bacteria	921
92	Ga0105245_11293437	3300009098	Bacteria	778
93	Ga0105247_10299521	3300009101	Bacteria	1115
94	Ga0114129_10132324	3300009147	Bacteria	3425
95	Ga0114129_10497556	3300009147	Bacteria	1592
96	Ga0105243_10186140	3300009148	Bacteria	1810
97	Ga0105241_10227532	3300009174	Bacteria	1571
98	Ga0105242_10252321	3300009176	Bacteria	1590
99	Ga0105248_10342837	3300009177	Bacteria	1682
100	Ga0105237_10095893	3300009545	Bacteria	2956
101	Ga0105237_10216449	3300009545	Bacteria	1915
102	Ga0105238_11031562	3300009551	Bacteria	844
103	Ga0105249_10433166	3300009553	Bacteria	1351
104	Ga0099796_10018767	3300010159	Bacteria	2084
105	Ga0099796_10048490	3300010159	Bacteria	1465
106	Ga0099796_10160080	3300010159	Bacteria	892
107	Ga0105239_10013525	3300010375	Bacteria	9059
108	Ga0105239_10151195	3300010375	Bacteria	2591
109	Ga0105246_10077219	3300011119	Bacteria	2362
110	Ga0105246_10551074	3300011119	Bacteria	988
111	Ga0157373_10040070	3300013100	Bacteria	3352
112	Ga0157370_10064022	3300013104	Bacteria	3482
113	Ga0157374_10104698	3300013296	Bacteria	2717
114	Ga0157378_10824516	3300013297	Bacteria	955
115	Ga0157375_10363362	3300013308	Bacteria	1614
116	Ga0163163_10031500	3300014325	Bacteria	5119
117	Ga0157379_10160408	3300014968	Bacteria	2030
118	Ga0157379_10554553	3300014968	Bacteria	1069
119	Ga0163161_10102619	3300017792	Bacteria	2130
120	Ga0213873_10004538	3300021358	Bacteria	2601
121	Ga0213874_10001485	3300021377	Bacteria	4864
122	Ga0213874_10013861	3300021377	Unclassified	2098
123	Ga0213876_10001406	3300021384	Bacteria	14999
124	Ga0213875_10001366	3300021388	Bacteria	16018
125	Ga0213875_10157339	3300021388	Bacteria	1066
126	Ga0224572_1004906	3300024225	Bacteria	2360
127	Ga0207425_1000072	3300025245	Bacteria	115017
128	Ga0209129_1001358	3300025258	Bacteria	13795
129	Ga0209565_1000132	3300025263	Bacteria	104716
130	Ga0209455_1006821	3300025272	Bacteria	3321
131	Ga0209673_1030987	3300025273	Bacteria	1673
132	Ga0209676_1006053	3300025292	Bacteria	6092
133	Ga0209025_1002058	3300025294	Bacteria	22887
134	Ga0209564_1001535	3300025295	Bacteria	22900
135	Ga0209564_1008797	3300025295	Bacteria	4920
136	Ga0209758_1000009	3300025297	Bacteria	1123483
137	Ga0209758_1053439	3300025297	Bacteria	1388
138	Ga0209758_1059539	3300025297	Bacteria	1270
139	Ga0209050_1000005	3300025298	Bacteria	1557793
140	Ga0209050_1000195	3300025298	Bacteria	136316
141	Ga0209050_1029721	3300025298	Bacteria	1740
142	Ga0207426_1016510	3300025302	Bacteria	2649
143	Ga0209051_1000414	3300025303	Bacteria	58981
144	Ga0209257_1004675	3300025304	Bacteria	10299
145	Ga0209257_1004696	3300025304	Bacteria	10258
146	Ga0207697_10108017	3300025315	Bacteria	1190
147	Ga0207692_10000175	3300025898	Bacteria	20519
148	Ga0207692_10009115	3300025898	Bacteria	4131
149	Ga0207680_10241454	3300025903	Bacteria	1245
150	Ga0207647_10102391	3300025904	Bacteria	1698
151	Ga0207685_10114391	3300025905	Bacteria	1175
152	Ga0207685_10194380	3300025905	Bacteria	949
153	Ga0207699_10002794	3300025906	Bacteria	8247
154	Ga0207699_10007395	3300025906	Bacteria	5373
155	Ga0207699_10080111	3300025906	Bacteria	2022
156	Ga0207705_10170264	3300025909	Bacteria	1640
157	Ga0207705_10197981	3300025909	Bacteria	1522
158	Ga0207684_10220815	3300025910	Bacteria	1635
159	Ga0207654_10279313	3300025911	Bacteria	1129
160	Ga0207695_10081492	3300025913	Bacteria	3274
161	Ga0207671_10073577	3300025914	Bacteria	2553
162	Ga0207671_10494690	3300025914	Bacteria	975
163	Ga0207693_10004043	3300025915	Bacteria	12466
164	Ga0207693_10040956	3300025915	Bacteria	3648
165	Ga0207693_10096048	3300025915	Bacteria	2323
166	Ga0207693_10433203	3300025915	Bacteria	1028
167	Ga0207663_10000098	3300025916	Bacteria	41171
168	Ga0207663_10048843	3300025916	Bacteria	2621
169	Ga0207663_10114288	3300025916	Bacteria	1837
170	Ga0207663_10921252	3300025916	Bacteria	699
171	Ga0207660_10076514	3300025917	Bacteria	2447
172	Ga0207657_10001491	3300025919	Bacteria	25043
173	Ga0207646_10101454	3300025922	Bacteria	2580
174	Ga0207650_10119370	3300025925	Bacteria	2051
175	Ga0207687_10141674	3300025927	Bacteria	1824
176	Ga0207687_10704584	3300025927	Bacteria	857
177	Ga0207700_10001663	3300025928	Bacteria	12623
178	Ga0207700_10040327	3300025928	Bacteria	3407
179	Ga0207700_10055314	3300025928	Bacteria	2983
180	Ga0207664_10017228	3300025929	Bacteria	5291
181	Ga0207664_11020429	3300025929	Bacteria	741
182	Ga0207644_10000779	3300025931	Bacteria	20223
183	Ga0207644_10315547	3300025931	Bacteria	1263
184	Ga0207686_10238931	3300025934	Bacteria	1321
185	Ga0207670_10828894	3300025936	Bacteria	772
186	Ga0207665_10000355	3300025939	Bacteria	31763
187	Ga0207665_10003937	3300025939	Bacteria	9942
188	Ga0207665_10812598	3300025939	Bacteria	739
189	Ga0207711_10533018	3300025941	Bacteria	1095
190	Ga0207679_10582706	3300025945	Bacteria	1006
191	Ga0207651_10009674	3300025960	Bacteria	5296
192	Ga0207712_10215677	3300025961	Bacteria	1531
193	Ga0207640_10010742	3300025981	Bacteria	5164
194	Ga0207639_10829310	3300026041	Bacteria	862
195	Ga0207678_10147112	3300026067	Bacteria	2011
196	Ga0207708_10574159	3300026075	Bacteria	953
197	Ga0207702_10703708	3300026078	Bacteria	996
198	Ga0207676_10215181	3300026095	Bacteria	1708
199	Ga0207676_10298028	3300026095	Bacteria	1471
200	Ga0207676_10302577	3300026095	Bacteria	1461
201	Ga0207698_11227497	3300026142	Bacteria	764
202	Ga0209179_1052373	3300027512	Bacteria	877
203	Ga0209813_10115266	3300027866	Bacteria	930
204	Ga0207428_10006751	3300027907	Bacteria	10529
205	Ga0268266_10008395	3300028379	Bacteria	9183
206	Ga0268266_10035469	3300028379	Bacteria	4243
207	Ga0307515_10202330	3300028794	Bacteria	1857
208	Ga0265340_10026792	3300031247	Bacteria	2911
209	Ga0265339_10009619	3300031249	Bacteria	6055
210	Ga0307509_10135329	3300031507	Bacteria	2411
211	Ga0307509_10536339	3300031507	Bacteria	850
212	Ga0307509_10659950	3300031507	Bacteria	714
213	Ga0265314_10145059	3300031711	Bacteria	1463
214	Ga0307510_10016959	3300033180	Bacteria	8590
215	Ga0307510_10200324	3300033180	Bacteria	1532
216	Ga0307510_10278849	3300033180	Bacteria	1143
217	Ga0373926_0039251	3300035083	Bacteria	1687
218	Ga0373940_0069732	3300035088	Bacteria	1021
219	Ga0373952_0033428	3300035092	Bacteria	1154
220	Ga0373932_0020610	3300035112	Bacteria	1731
221	Ga0373936_0020912	3300035113	Bacteria	2544
222	Ga0373945_0014070	3300035116	Bacteria	2677
223	Ga0373945_0020037	3300035116	Bacteria	2286
224	Ga0373954_0054461	3300035118	Bacteria	1881
225	Ga0373954_0057889	3300035118	Bacteria	1826
226	Ga0373943_0000487	3300035170	Bacteria	16900
227	Ga0373946_0006495	3300035171	Bacteria	4240
228	Ga0373955_0119865	3300035172	Bacteria	1529
229	Ga0373931_0038508	3300035691	Bacteria	2501
230	Ga0373931_0083351	3300035691	Bacteria	1769
231	Ga0373935_0001143	3300035692	Bacteria	14514
232	Ga0373927_0001077	3300035695	Bacteria	20855
233	Ga0373927_0046989	3300035695	Bacteria	2792
234	Ga0373927_0048067	3300035695	Bacteria	2759
235	Ga0373933_0000199	3300035724	Bacteria	39593
236	Ga0373933_0030075	3300035724	Bacteria	3144
237	Ga0373947_0000063	3300035725	Bacteria	53746
238	Ga0373947_0037248	3300035725	Bacteria	2886
239	Ga0373937_0039144	3300036401	Bacteria	4321
240	Ga0373937_0218767	3300036401	Bacteria	1793
241	Ga0373925_0000456	3300037068	Bacteria	41315
242	Ga0373925_0010015	3300037068	Bacteria	6884
243	Ga0373925_0191290	3300037068	Bacteria	1624
244	Ga0395898_0039019	3300037466	Bacteria	4703
245	Ga0395905_0601669	3300037471	Bacteria	1001
246	Ga0436364_0709942	3300037853	Bacteria	1967
247	Ga0395901_0065310	3300038443	Bacteria	3789
248	Ga0436365_0411983	3300039437	Bacteria	914
249	Ga0436360_0269055	3300039438	Bacteria	1163
250	Ga0436361_0781282	3300039447	Bacteria	1077
251	Ga0436363_1043988	3300039450	Bacteria	4317
252	Ga0436363_1572654	3300039450	Bacteria	24478
253	Ga0451797_0318276	3300041453	Bacteria	1173
254	Ga0451800_0782120	3300041459	Bacteria	821
255	Ga0451843_1182551	3300041509	Bacteria	784
256	Ga0439458_0009294	3300042157	Bacteria	2189
257	Ga0466967_1225391	3300045976	Bacteria	748
258	Ga0495603_0014382	3300046455	Bacteria	4786
259	Ga0495603_0036781	3300046455	Bacteria	2939
260	Ga0495638_0222371	3300046460	Bacteria	1054
261	Ga0495651_0166204	3300046462	Bacteria	1575
262	Ga0495651_0381114	3300046462	Bacteria	925
263	Ga0495662_0008241	3300046476	Bacteria	5133
264	Ga0495664_0001215	3300046477	Bacteria	13473
265	Ga0495664_0040842	3300046477	Bacteria	2744
266	Ga0495664_0083731	3300046477	Bacteria	1914
267	Ga0495585_0034472	3300046492	Bacteria	2861
268	Ga0495594_0148723	3300046499	Bacteria	1329
269	Ga0495596_0046674	3300046500	Bacteria	1701
270	Ga0495583_0157401	3300046506	Bacteria	939
271	Ga0495606_0150487	3300046507	Bacteria	1366
272	Ga0495608_0070962	3300046511	Bacteria	2273
273	Ga0495616_0009944	3300046513	Bacteria	5528
274	Ga0495616_0269701	3300046513	Bacteria	726
275	Ga0495620_0087709	3300046515	Bacteria	1251
276	Ga0495628_0078355	3300046516	Bacteria	2570
277	Ga0495630_0000811	3300046517	Bacteria	21952
278	Ga0495631_0053813	3300046518	Bacteria	1756
279	Ga0495632_0165982	3300046519	Bacteria	1015
280	Ga0495643_0075929	3300046522	Bacteria	1758
281	Ga0495666_0033511	3300046526	Bacteria	2508
282	Ga0495666_0039059	3300046526	Bacteria	2306
283	Ga0495652_0023276	3300046529	Bacteria	5492
284	Ga0495665_0299493	3300046531	Bacteria	823
285	Ga0495586_0045538	3300046535	Bacteria	2364
286	Ga0495609_0095876	3300046538	Bacteria	1287
287	Ga0495645_0345684	3300046543	Bacteria	960
288	Ga0495622_0038103	3300046557	Bacteria	2238
289	Ga0495667_0340022	3300046559	Bacteria	949
290	Ga0495668_0022682	3300046616	Bacteria	3586
291	Ga0495668_0288775	3300046616	Bacteria	899
292	Ga0495634_0001678	3300046642	Bacteria	19291
293	Ga0495611_0131478	3300046648	Bacteria	1167
294	Ga0495625_0523924	3300046660	Bacteria	721
295	Ga0495635_0119176	3300046663	Bacteria	1801
296	Ga0495659_0265799	3300046664	Bacteria	718
297	Ga0495657_0209573	3300046675	Bacteria	1185
298	Ga0495599_0040510	3300046678	Bacteria	2925
299	Ga0495623_0044837	3300046679	Bacteria	2810
300	Ga0495646_0069589	3300046680	Bacteria	2076
301	Ga0495647_0076843	3300046681	Bacteria	1347
302	Ga0495658_0214235	3300046683	Bacteria	1204
303	Ga0495669_0044062	3300046684	Bacteria	1987
304	Ga0495669_0134661	3300046684	Bacteria	1164
305	Ga0495613_0061631	3300046689	Bacteria	2746
306	Ga0495624_0003868	3300046690	Bacteria	11056
307	Ga0495670_0062275	3300046691	Bacteria	1877
308	Ga0495670_0183070	3300046691	Bacteria	1107
309	Ga0495649_0256736	3300046694	Bacteria	897
310	Ga0495660_0101258	3300046810	Bacteria	1483
311	Ga0495604_0080973	3300047317	Bacteria	2432
312	Ga0495674_0002228	3300047319	Bacteria	19072
313	Ga0495674_0368159	3300047319	Bacteria	1164
314	Ga0495676_0066150	3300047321	Bacteria	2803
315	Ga0495683_0105577	3300047323	Bacteria	1350
316	Ga0495684_0011111	3300047471	Bacteria	6960
317	Ga0495684_0041825	3300047471	Bacteria	3511
318	Ga0495626_0166675	3300048091	Bacteria	920
319	Ga0496101_0489814	3300048904	Bacteria	971
320	Ga0496102_0006768	3300048905	Bacteria	9781
321	Ga0496102_0027968	3300048905	Bacteria	5038
322	Ga0496102_0028322	3300048905	Bacteria	5003
323	Ga0496102_0313625	3300048905	Bacteria	1478
324	Ga0496104_0293457	3300048907	Bacteria	1538
325	Ga0496105_0025056	3300048908	Bacteria	4851
326	Ga0496105_0060696	3300048908	Bacteria	3120
327	Ga0496106_0027981	3300048909	Bacteria	4197
328	Ga0496106_0113894	3300048909	Bacteria	2109
329	Ga0496106_0166477	3300048909	Bacteria	1745
330	Ga0496107_0120961	3300048910	Bacteria	1929
331	Ga0496107_0256850	3300048910	Bacteria	1300
332	Ga0496108_0018136	3300048911	Bacteria	5759
333	Ga0496109_0108394	3300048912	Bacteria	2581
334	Ga0496109_0421945	3300048912	Bacteria	1260
335	Ga0496110_0024513	3300048913	Bacteria	5141
336	Ga0496110_0433156	3300048913	Bacteria	1198
337	Ga0496111_0039965	3300048914	Bacteria	3365
338	Ga0496111_0069982	3300048914	Bacteria	2552
339	Ga0496111_0207806	3300048914	Bacteria	1455
340	Ga0496112_0006413	3300048915	Bacteria	10325
341	Ga0496112_0099066	3300048915	Bacteria	2884
342	Ga0496113_0134823	3300048916	Bacteria	1939
343	Ga0496113_0400312	3300048916	Bacteria	1102
344	Ga0496114_0053872	3300048917	Bacteria	3353
345	Ga0496115_0011990	3300048918	Bacteria	6514
346	Ga0496115_0049093	3300048918	Bacteria	3377
347	Ga0496117_0141779	3300048920	Bacteria	1438
348	Ga0496118_0163020	3300048921	Bacteria	1375
349	Ga0496119_0009210	3300048922	Bacteria	8520
350	Ga0496120_0015271	3300048923	Bacteria	5076
351	Ga0496121_0082251	3300048924	Bacteria	2546
352	Ga0496121_0119501	3300048924	Bacteria	1993
353	Ga0496121_0140324	3300048924	Bacteria	1794
354	Ga0496121_0216262	3300048924	Bacteria	1353
355	Ga0496122_0349966	3300048925	Bacteria	772
356	Ga0496126_0005323	3300048929	Bacteria	14749
357	Ga0496126_0057652	3300048929	Bacteria	3504
358	Ga0496126_0093780	3300048929	Bacteria	2635
359	Ga0496126_0218839	3300048929	Bacteria	1601
360	Ga0501031_0054725	3300049568	Bacteria	2599
361	Ga0501032_0009254	3300049569	Bacteria	7141
362	Ga0501033_0010545	3300049570	Bacteria	7084
363	Ga0501034_0092271	3300049571	Bacteria	3025
364	Ga0501036_0092383	3300049572	Bacteria	2556
365	Ga0501037_0086600	3300049573	Bacteria	2267
366	Ga0501038_0245047	3300049574	Bacteria	1421
367	Ga0501039_0014991	3300049575	Bacteria	5928
368	Ga0501040_0075754	3300049576	Bacteria	2325
369	Ga0501042_0014981	3300049578	Bacteria	5301
370	Ga0501043_0263194	3300049579	Bacteria	1325
371	Ga0501046_0056450	3300049580	Bacteria	3082
372	Ga0501047_0029703	3300049581	Bacteria	5269
373	Ga0501048_0486644	3300049582	Bacteria	884
374	Ga0501067_0011993	3300049583	Bacteria	4802
375	Ga0501068_0004035	3300049584	Bacteria	7987
376	Ga0501069_0024247	3300049585	Bacteria	3308
377	Ga0501070_0026106	3300049586	Bacteria	4901
378	Ga0501071_0280407	3300049587	Bacteria	1261
379	Ga0501072_0074135	3300049588	Bacteria	2691
380	Ga0501073_0006215	3300049589	Bacteria	8912
381	Ga0501074_0002758	3300049590	Bacteria	12300
382	Ga0501079_0006063	3300049741	Bacteria	9060
383	Ga0501083_0090531	3300049744	Bacteria	2020
384	Ga0501035_0031175	3300049822	Bacteria	4855
385	Ga0501044_0025407	3300049823	Bacteria	6277
386	nmdc:mga03683_65033_c1	3300050489	Bacteria	1549
387	nmdc:mga03n38_22431_c1	3300050490	Bacteria	2555
388	nmdc:mga00v17_222943_c1	3300050491	Bacteria	1221
389	nmdc:mga0yw44_31057_c1	3300050492	Bacteria	3103
390	nmdc:mga06z11_31296_c1	3300050494	Bacteria	2584
391	nmdc:mga04h51_135397_c1	3300050495	Bacteria	930
392	nmdc:mga07m45_18952_c1	3300050496	Bacteria	3724
393	nmdc:mga05p37_427790_c1	3300050507	Bacteria	1539
394	nmdc:mga0qj67_18788_c1	3300050509	Bacteria	5271
395	nmdc:mga06r32_90098_c1	3300050510	Bacteria	2996
396	nmdc:mga0n895_3422_c1	3300050512	Bacteria	12798
397	nmdc:mga0n895_48212_c1	3300050512	Bacteria	4169
398	nmdc:mga0rr50_32890_c1	3300050513	Bacteria	3700
399	nmdc:mga0a205_4930_c1	3300050515	Bacteria	12009
400	nmdc:mga0sz30_65849_c1	3300050516	Bacteria	1554
401	Ga0495601_0002493	3300053077	Bacteria	10469
402	Ga0495612_0000270	3300053078	Bacteria	21369
403	Ga0495612_0183238	3300053078	Bacteria	920
404	Ga0500635_0001336	3300053080	Bacteria	5898
405	Ga0495595_0104108	3300053084	Bacteria	1371
406	Ga0495619_0013300	3300053085	Bacteria	5184
407	Ga0495619_0089161	3300053085	Bacteria	2086
408	Ga0500578_0233010	3300053086	Bacteria	1115
409	Ga0500644_0085171	3300053088	Bacteria	1171
410	Ga0500583_0274219	3300053092	Bacteria	829
411	Ga0500641_0083193	3300053096	Bacteria	1360
412	Ga0500554_035531	3300053102	Bacteria	1499
413	Ga0500595_007598	3300053119	Bacteria	4488
414	Ga0500658_0022785	3300053134	Bacteria	2385
415	Ga0500559_0265841	3300053136	Bacteria	807
416	Ga0500589_022305	3300053147	Bacteria	2911
417	Ga0500603_005970	3300053150	Bacteria	2637
418	Ga0500627_0204239	3300053158	Bacteria	885
419	Ga0500634_0187447	3300053161	Bacteria	923
420	Ga0500634_0239606	3300053161	Bacteria	763
421	Ga0500638_173121	3300053162	Bacteria	938
422	Ga0500637_0010848	3300053178	Bacteria	4686
423	Ga0501084_0019810	3300054114	Bacteria	5607
424	Ga0501082_0008046	3300060353	Bacteria	9096

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300003791	Ga0055530_10017687	Ga0055530_100176872	177
2	3300003792	Ga0055540_1003916	Ga0055540_10039165	177
3	3300025292	Ga0209676_1006053	Ga0209676_10060533	177
4	3300025298	Ga0209050_1000005	Ga0209050_1000005475	177
5	3300025298	Ga0209050_1000195	Ga0209050_10001959	177
6	3300025303	Ga0209051_1000414	Ga0209051_10004148	177
7	3300025304	Ga0209257_1004675	Ga0209257_10046756	177
8	3300035118	Ga0373954_0057889	Ga0373954_0057889_1214_1816	180
9	3300005435	Ga0070714_100333070	Ga0070714_1003330702	185
10	3300035083	Ga0373926_0039251	Ga0373926_0039251_414_1031	185
11	3300035725	Ga0373947_0037248	Ga0373947_0037248_1885_2502	185
12	3300046462	Ga0495651_0381114	Ga0495651_0381114_214_831	185
13	3300046476	Ga0495662_0008241	Ga0495662_0008241_360_977	185
14	3300046477	Ga0495664_0001215	Ga0495664_0001215_12129_12746	185
15	3300046529	Ga0495652_0023276	Ga0495652_0023276_2614_3231	185
16	3300046531	Ga0495665_0299493	Ga0495665_0299493_74_691	185
17	3300046535	Ga0495586_0045538	Ga0495586_0045538_1388_2005	185
18	3300046543	Ga0495645_0345684	Ga0495645_0345684_266_883	185
19	3300046642	Ga0495634_0001678	Ga0495634_0001678_15196_15813	185
20	3300046680	Ga0495646_0069589	Ga0495646_0069589_971_1588	185
21	3300046681	Ga0495647_0076843	Ga0495647_0076843_490_1107	185
22	3300047317	Ga0495604_0080973	Ga0495604_0080973_158_775	185
23	3300047319	Ga0495674_0002228	Ga0495674_0002228_11069_11686	185
24	3300047471	Ga0495684_0011111	Ga0495684_0011111_705_1322	185
25	3300053077	Ga0495601_0002493	Ga0495601_0002493_5639_6256	185
26	3300053078	Ga0495612_0000270	Ga0495612_0000270_5639_6256	185
27	3300035113	Ga0373936_0020912	Ga0373936_0020912_1438_2139	186
28	3300035116	Ga0373945_0020037	Ga0373945_0020037_1564_2265	186
29	3300035170	Ga0373943_0000487	Ga0373943_0000487_13451_14152	186
30	3300035171	Ga0373946_0006495	Ga0373946_0006495_1638_2339	186
31	3300035692	Ga0373935_0001143	Ga0373935_0001143_11492_12193	186
32	3300035695	Ga0373927_0001077	Ga0373927_0001077_7385_8086	186
33	3300035725	Ga0373947_0000063	Ga0373947_0000063_22335_23036	186
34	3300036401	Ga0373937_0218767	Ga0373937_0218767_1014_1715	186
35	3300037068	Ga0373925_0000456	Ga0373925_0000456_26562_27263	186
36	3300046517	Ga0495630_0000811	Ga0495630_0000811_1889_2590	186
37	3300046526	Ga0495666_0033511	Ga0495666_0033511_681_1382	186
38	3300046689	Ga0495613_0061631	Ga0495613_0061631_1990_2691	186
39	3300046690	Ga0495624_0003868	Ga0495624_0003868_2631_3332	186
40	3300047321	Ga0495676_0066150	Ga0495676_0066150_854_1555	186
41	3300047471	Ga0495684_0041825	Ga0495684_0041825_755_1456	186
42	3300048909	Ga0496106_0113894	Ga0496106_0113894_541_1167	197
43	3300048915	Ga0496112_0006413	Ga0496112_0006413_9367_9993	197
44	iso_pu_bacteria	2513237098	2513676597	201
45	iso_pu_bacteria	2524023210	2524470375	201
46	iso_pu_bacteria	2876808645	2876813015	201
47	iso_pu_bacteria	2879110137	2879115866	201
48	iso_pu_bacteria	2885383462	2885387866	201
49	iso_pu_bacteria	2903768456	2903771872	201
50	iso_pu_bacteria	8006984368	8006987888	201
51	3300003215	JGI25153J46596_10018076	JGI25153J46596_100180762	202
52	3300005937	Ga0081455_10033401	Ga0081455_100334013	202
53	3300042157	Ga0439458_0009294	Ga0439458_0009294_16_633	202
54	3300046683	Ga0495658_0214235	Ga0495658_0214235_325_939	202
55	3300005331	Ga0070670_100051042	Ga0070670_1000510423	203
56	3300005335	Ga0070666_10223725	Ga0070666_102237252	203
57	3300005340	Ga0070689_100668531	Ga0070689_1006685311	203
58	3300005355	Ga0070671_100001331	Ga0070671_1000013313	203
59	3300005364	Ga0070673_100008464	Ga0070673_1000084645	203
60	3300005365	Ga0070688_100035771	Ga0070688_1000357713	203
61	3300005434	Ga0070709_10160964	Ga0070709_101609643	203
62	3300005436	Ga0070713_100074135	Ga0070713_1000741351	203
63	3300005436	Ga0070713_100444074	Ga0070713_1004440742	203
64	3300005439	Ga0070711_100170466	Ga0070711_1001704662	203
65	3300005456	Ga0070678_100729531	Ga0070678_1007295311	203
66	3300006028	Ga0070717_10338823	Ga0070717_103388232	203
67	3300006175	Ga0070712_100030701	Ga0070712_1000307012	203
68	3300006175	Ga0070712_100126413	Ga0070712_1001264132	203
69	3300009101	Ga0105247_10299521	Ga0105247_102995212	203
70	3300009148	Ga0105243_10186140	Ga0105243_101861402	203
71	3300014968	Ga0157379_10554553	Ga0157379_105545532	203
72	3300024225	Ga0224572_1004906	Ga0224572_10049062	203
73	3300025903	Ga0207680_10241454	Ga0207680_102414541	203
74	3300025905	Ga0207685_10194380	Ga0207685_101943802	203
75	3300025906	Ga0207699_10080111	Ga0207699_100801113	203
76	3300025915	Ga0207693_10040956	Ga0207693_100409562	203
77	3300025916	Ga0207663_10921252	Ga0207663_109212521	203
78	3300025925	Ga0207650_10119370	Ga0207650_101193702	203
79	3300025927	Ga0207687_10141674	Ga0207687_101416742	203
80	3300025928	Ga0207700_10055314	Ga0207700_100553142	203
81	3300025929	Ga0207664_11020429	Ga0207664_110204291	203
82	3300025931	Ga0207644_10000779	Ga0207644_100007798	203
83	3300025936	Ga0207670_10828894	Ga0207670_108288941	203
84	3300025960	Ga0207651_10009674	Ga0207651_100096745	203
85	3300035118	Ga0373954_0054461	Ga0373954_0054461_567_1184	203
86	3300035691	Ga0373931_0083351	Ga0373931_0083351_1093_1728	203
87	3300035724	Ga0373933_0030075	Ga0373933_0030075_204_821	203
88	3300036401	Ga0373937_0039144	Ga0373937_0039144_1533_2150	203
89	3300041453	Ga0451797_0318276	Ga0451797_0318276_194_814	203
90	3300045976	Ga0466967_1225391	Ga0466967_1225391_74_691	203
91	3300046462	Ga0495651_0166204	Ga0495651_0166204_660_1277	203
92	3300046477	Ga0495664_0040842	Ga0495664_0040842_73_690	203
93	3300046511	Ga0495608_0070962	Ga0495608_0070962_1646_2263	203
94	3300046516	Ga0495628_0078355	Ga0495628_0078355_1313_1930	203
95	3300046522	Ga0495643_0075929	Ga0495643_0075929_967_1587	203
96	3300046559	Ga0495667_0340022	Ga0495667_0340022_317_934	203
97	3300046663	Ga0495635_0119176	Ga0495635_0119176_854_1471	203
98	3300046678	Ga0495599_0040510	Ga0495599_0040510_341_958	203
99	3300046679	Ga0495623_0044837	Ga0495623_0044837_2178_2795	203
100	3300047319	Ga0495674_0368159	Ga0495674_0368159_379_996	203
101	3300048913	Ga0496110_0433156	Ga0496110_0433156_19_636	203
102	3300048914	Ga0496111_0069982	Ga0496111_0069982_860_1558	203
103	3300048925	Ga0496122_0349966	Ga0496122_0349966_74_688	203
104	3300053078	Ga0495612_0183238	Ga0495612_0183238_284_901	203
105	3300053084	Ga0495595_0104108	Ga0495595_0104108_431_1048	203
106	3300053085	Ga0495619_0089161	Ga0495619_0089161_1156_1773	203
107	3300002774	JGI25150J39212_1000218	JGI25150J39212_100021826	204
108	3300003215	JGI25153J46596_10000093	JGI25153J46596_1000009354	204
109	3300003320	rootH2_10030164	rootH2_100301643	204
110	3300003771	Ga0055526_1002775	Ga0055526_100277510	204
111	3300003773	Ga0055537_1014208	Ga0055537_10142081	204
112	3300005295	Ga0065707_10120969	Ga0065707_101209692	204
113	3300005338	Ga0068868_100086295	Ga0068868_1000862952	204
114	3300005355	Ga0070671_100049969	Ga0070671_1000499693	204
115	3300005355	Ga0070671_100491440	Ga0070671_1004914402	204
116	3300005366	Ga0070659_100023050	Ga0070659_1000230506	204
117	3300005434	Ga0070709_10000751	Ga0070709_1000075110	204
118	3300005434	Ga0070709_10062260	Ga0070709_100622602	204
119	3300005434	Ga0070709_10487786	Ga0070709_104877861	204
120	3300005435	Ga0070714_100001123	Ga0070714_1000011238	204
121	3300005435	Ga0070714_100012709	Ga0070714_1000127096	204
122	3300005436	Ga0070713_100000647	Ga0070713_10000064714	204
123	3300005436	Ga0070713_100006657	Ga0070713_1000066577	204
124	3300005436	Ga0070713_100031059	Ga0070713_1000310594	204
125	3300005437	Ga0070710_10001287	Ga0070710_100012874	204
126	3300005437	Ga0070710_10054560	Ga0070710_100545602	204
127	3300005439	Ga0070711_100045601	Ga0070711_1000456012	204
128	3300005439	Ga0070711_100129075	Ga0070711_1001290752	204
129	3300005439	Ga0070711_100372173	Ga0070711_1003721732	204
130	3300005441	Ga0070700_100333721	Ga0070700_1003337212	204
131	3300005445	Ga0070708_100297469	Ga0070708_1002974691	204
132	3300005455	Ga0070663_100039596	Ga0070663_1000395964	204
133	3300005536	Ga0070697_100058137	Ga0070697_1000581372	204
134	3300005539	Ga0068853_100096401	Ga0068853_1000964011	204
135	3300005548	Ga0070665_100033726	Ga0070665_1000337269	204
136	3300005548	Ga0070665_100108976	Ga0070665_1001089763	204
137	3300005549	Ga0070704_100475512	Ga0070704_1004755121	204
138	3300005578	Ga0068854_100070374	Ga0068854_1000703742	204
139	3300005616	Ga0068852_100311430	Ga0068852_1003114302	204
140	3300005616	Ga0068852_100988645	Ga0068852_1009886452	204
141	3300005618	Ga0068864_100606225	Ga0068864_1006062252	204
142	3300005843	Ga0068860_100634862	Ga0068860_1006348622	204
143	3300005843	Ga0068860_101287514	Ga0068860_1012875141	204
144	3300005983	Ga0081540_1029997	Ga0081540_10299974	204
145	3300006028	Ga0070717_10000905	Ga0070717_100009059	204
146	3300006038	Ga0075365_10032195	Ga0075365_100321953	204
147	3300006038	Ga0075365_10087659	Ga0075365_100876591	204
148	3300006042	Ga0075368_10114896	Ga0075368_101148961	204
149	3300006048	Ga0075363_100020674	Ga0075363_1000206742	204
150	3300006048	Ga0075363_100212885	Ga0075363_1002128852	204
151	3300006051	Ga0075364_10181144	Ga0075364_101811442	204
152	3300006058	Ga0075432_10132662	Ga0075432_101326622	204
153	3300006163	Ga0070715_10013591	Ga0070715_100135912	204
154	3300006173	Ga0070716_100008083	Ga0070716_1000080833	204
155	3300006175	Ga0070712_100021012	Ga0070712_1000210123	204
156	3300006175	Ga0070712_100024139	Ga0070712_1000241392	204
157	3300006175	Ga0070712_100152940	Ga0070712_1001529402	204
158	3300006175	Ga0070712_100816430	Ga0070712_1008164301	204
159	3300006177	Ga0075362_10242531	Ga0075362_102425311	204
160	3300006178	Ga0075367_10002297	Ga0075367_100022974	204
161	3300006186	Ga0075369_10020263	Ga0075369_100202634	204
162	3300006194	Ga0075427_10002281	Ga0075427_100022812	204
163	3300006195	Ga0075366_10314962	Ga0075366_103149622	204
164	3300006195	Ga0075366_10325639	Ga0075366_103256391	204
165	3300006195	Ga0075366_10344020	Ga0075366_103440202	204
166	3300006237	Ga0097621_100116282	Ga0097621_1001162822	204
167	3300006358	Ga0068871_100515747	Ga0068871_1005157472	204
168	3300006844	Ga0075428_100071694	Ga0075428_1000716944	204
169	3300006844	Ga0075428_100384144	Ga0075428_1003841442	204
170	3300006847	Ga0075431_100100193	Ga0075431_1001001932	204
171	3300006871	Ga0075434_100079790	Ga0075434_1000797902	204
172	3300006880	Ga0075429_100046455	Ga0075429_1000464552	204
173	3300006931	Ga0097620_100348756	Ga0097620_1003487562	204
174	3300007076	Ga0075435_100014898	Ga0075435_1000148982	204
175	3300007265	Ga0099794_10047430	Ga0099794_100474303	204
176	3300009093	Ga0105240_10042752	Ga0105240_100427529	204
177	3300009098	Ga0105245_10214003	Ga0105245_102140031	204
178	3300009098	Ga0105245_10910321	Ga0105245_109103212	204
179	3300009098	Ga0105245_11293437	Ga0105245_112934371	204
180	3300009147	Ga0114129_10132324	Ga0114129_101323242	204
181	3300009147	Ga0114129_10497556	Ga0114129_104975563	204
182	3300009174	Ga0105241_10227532	Ga0105241_102275322	204
183	3300009176	Ga0105242_10252321	Ga0105242_102523211	204
184	3300009177	Ga0105248_10342837	Ga0105248_103428371	204
185	3300009545	Ga0105237_10095893	Ga0105237_100958933	204
186	3300009545	Ga0105237_10216449	Ga0105237_102164493	204
187	3300009551	Ga0105238_11031562	Ga0105238_110315621	204
188	3300009553	Ga0105249_10433166	Ga0105249_104331662	204
189	3300010159	Ga0099796_10018767	Ga0099796_100187671	204
190	3300010159	Ga0099796_10048490	Ga0099796_100484902	204
191	3300010159	Ga0099796_10160080	Ga0099796_101600801	204
192	3300010375	Ga0105239_10013525	Ga0105239_100135258	204
193	3300010375	Ga0105239_10151195	Ga0105239_101511952	204
194	3300011119	Ga0105246_10077219	Ga0105246_100772192	204
195	3300011119	Ga0105246_10551074	Ga0105246_105510741	204
196	3300013100	Ga0157373_10040070	Ga0157373_100400702	204
197	3300013104	Ga0157370_10064022	Ga0157370_100640222	204
198	3300013296	Ga0157374_10104698	Ga0157374_101046983	204
199	3300013297	Ga0157378_10824516	Ga0157378_108245161	204
200	3300013308	Ga0157375_10363362	Ga0157375_103633622	204
201	3300014325	Ga0163163_10031500	Ga0163163_100315003	204
202	3300014968	Ga0157379_10160408	Ga0157379_101604082	204
203	3300017792	Ga0163161_10102619	Ga0163161_101026193	204
204	3300021358	Ga0213873_10004538	Ga0213873_100045383	204
205	3300021377	Ga0213874_10001485	Ga0213874_100014854	204
206	3300021377	Ga0213874_10013861	Ga0213874_100138611	204
207	3300021384	Ga0213876_10001406	Ga0213876_100014064	204
208	3300021388	Ga0213875_10001366	Ga0213875_100013666	204
209	3300021388	Ga0213875_10157339	Ga0213875_101573391	204
210	3300025245	Ga0207425_1000072	Ga0207425_100007258	204
211	3300025258	Ga0209129_1001358	Ga0209129_10013582	204
212	3300025263	Ga0209565_1000132	Ga0209565_10001328	204
213	3300025272	Ga0209455_1006821	Ga0209455_10068213	204
214	3300025273	Ga0209673_1030987	Ga0209673_10309872	204
215	3300025294	Ga0209025_1002058	Ga0209025_10020588	204
216	3300025295	Ga0209564_1001535	Ga0209564_100153513	204
217	3300025295	Ga0209564_1008797	Ga0209564_10087972	204
218	3300025297	Ga0209758_1000009	Ga0209758_1000009694	204
219	3300025297	Ga0209758_1053439	Ga0209758_10534392	204
220	3300025297	Ga0209758_1059539	Ga0209758_10595392	204
221	3300025298	Ga0209050_1029721	Ga0209050_10297212	204
222	3300025302	Ga0207426_1016510	Ga0207426_10165103	204
223	3300025304	Ga0209257_1004696	Ga0209257_10046966	204
224	3300025315	Ga0207697_10108017	Ga0207697_101080171	204
225	3300025898	Ga0207692_10000175	Ga0207692_100001752	204
226	3300025898	Ga0207692_10009115	Ga0207692_100091151	204
227	3300025904	Ga0207647_10102391	Ga0207647_101023912	204
228	3300025905	Ga0207685_10114391	Ga0207685_101143911	204
229	3300025906	Ga0207699_10002794	Ga0207699_100027943	204
230	3300025906	Ga0207699_10007395	Ga0207699_100073957	204
231	3300025909	Ga0207705_10170264	Ga0207705_101702642	204
232	3300025909	Ga0207705_10197981	Ga0207705_101979811	204
233	3300025910	Ga0207684_10220815	Ga0207684_102208153	204
234	3300025911	Ga0207654_10279313	Ga0207654_102793132	204
235	3300025913	Ga0207695_10081492	Ga0207695_100814922	204
236	3300025914	Ga0207671_10073577	Ga0207671_100735773	204
237	3300025914	Ga0207671_10494690	Ga0207671_104946902	204
238	3300025915	Ga0207693_10004043	Ga0207693_1000404311	204
239	3300025915	Ga0207693_10096048	Ga0207693_100960482	204
240	3300025915	Ga0207693_10433203	Ga0207693_104332031	204
241	3300025916	Ga0207663_10000098	Ga0207663_1000009811	204
242	3300025916	Ga0207663_10048843	Ga0207663_100488433	204
243	3300025916	Ga0207663_10114288	Ga0207663_101142882	204
244	3300025917	Ga0207660_10076514	Ga0207660_100765142	204
245	3300025919	Ga0207657_10001491	Ga0207657_100014918	204
246	3300025922	Ga0207646_10101454	Ga0207646_101014542	204
247	3300025927	Ga0207687_10704584	Ga0207687_107045841	204
248	3300025928	Ga0207700_10001663	Ga0207700_100016637	204
249	3300025928	Ga0207700_10040327	Ga0207700_100403272	204
250	3300025929	Ga0207664_10017228	Ga0207664_100172284	204
251	3300025931	Ga0207644_10315547	Ga0207644_103155472	204
252	3300025934	Ga0207686_10238931	Ga0207686_102389312	204
253	3300025939	Ga0207665_10000355	Ga0207665_1000035513	204
254	3300025939	Ga0207665_10003937	Ga0207665_100039375	204
255	3300025939	Ga0207665_10812598	Ga0207665_108125981	204
256	3300025941	Ga0207711_10533018	Ga0207711_105330182	204
257	3300025945	Ga0207679_10582706	Ga0207679_105827061	204
258	3300025961	Ga0207712_10215677	Ga0207712_102156772	204
259	3300025981	Ga0207640_10010742	Ga0207640_100107423	204
260	3300026041	Ga0207639_10829310	Ga0207639_108293102	204
261	3300026067	Ga0207678_10147112	Ga0207678_101471122	204
262	3300026075	Ga0207708_10574159	Ga0207708_105741591	204
263	3300026078	Ga0207702_10703708	Ga0207702_107037081	204
264	3300026095	Ga0207676_10215181	Ga0207676_102151812	204
265	3300026095	Ga0207676_10298028	Ga0207676_102980282	204
266	3300026095	Ga0207676_10302577	Ga0207676_103025772	204
267	3300026142	Ga0207698_11227497	Ga0207698_112274971	204
268	3300027512	Ga0209179_1052373	Ga0209179_10523732	204
269	3300027866	Ga0209813_10115266	Ga0209813_101152661	204
270	3300027907	Ga0207428_10006751	Ga0207428_100067515	204
271	3300028379	Ga0268266_10008395	Ga0268266_100083955	204
272	3300028379	Ga0268266_10035469	Ga0268266_100354691	204
273	3300028794	Ga0307515_10202330	Ga0307515_102023301	204
274	3300031247	Ga0265340_10026792	Ga0265340_100267923	204
275	3300031249	Ga0265339_10009619	Ga0265339_100096192	204
276	3300031507	Ga0307509_10135329	Ga0307509_101353292	204
277	3300031507	Ga0307509_10536339	Ga0307509_105363391	204
278	3300031507	Ga0307509_10659950	Ga0307509_106599501	204
279	3300031711	Ga0265314_10145059	Ga0265314_101450591	204
280	3300033180	Ga0307510_10016959	Ga0307510_100169597	204
281	3300033180	Ga0307510_10200324	Ga0307510_102003242	204
282	3300033180	Ga0307510_10278849	Ga0307510_102788491	204
283	3300035088	Ga0373940_0069732	Ga0373940_0069732_138_764	204
284	3300035092	Ga0373952_0033428	Ga0373952_0033428_210_836	204
285	3300035112	Ga0373932_0020610	Ga0373932_0020610_562_1188	204
286	3300035116	Ga0373945_0014070	Ga0373945_0014070_975_1598	204
287	3300035172	Ga0373955_0119865	Ga0373955_0119865_392_1018	204
288	3300035691	Ga0373931_0038508	Ga0373931_0038508_983_1609	204
289	3300035695	Ga0373927_0046989	Ga0373927_0046989_1925_2551	204
290	3300035695	Ga0373927_0048067	Ga0373927_0048067_2021_2644	204
291	3300035724	Ga0373933_0000199	Ga0373933_0000199_20844_21470	204
292	3300037068	Ga0373925_0010015	Ga0373925_0010015_3973_4596	204
293	3300037068	Ga0373925_0191290	Ga0373925_0191290_499_1125	204
294	3300037466	Ga0395898_0039019	Ga0395898_0039019_2216_2845	204
295	3300037471	Ga0395905_0601669	Ga0395905_0601669_77_706	204
296	3300037853	Ga0436364_0709942	Ga0436364_0709942_68_691	204
297	3300038443	Ga0395901_0065310	Ga0395901_0065310_258_887	204
298	3300039437	Ga0436365_0411983	Ga0436365_0411983_138_761	204
299	3300039438	Ga0436360_0269055	Ga0436360_0269055_355_981	204
300	3300039447	Ga0436361_0781282	Ga0436361_0781282_51_677	204
301	3300039450	Ga0436363_1043988	Ga0436363_1043988_1585_2211	204
302	3300039450	Ga0436363_1572654	Ga0436363_1572654_9255_9878	204
303	3300041459	Ga0451800_0782120	Ga0451800_0782120_104_724	204
304	3300041509	Ga0451843_1182551	Ga0451843_1182551_69_689	204
305	3300046455	Ga0495603_0014382	Ga0495603_0014382_1276_1896	204
306	3300046455	Ga0495603_0036781	Ga0495603_0036781_188_811	204
307	3300046460	Ga0495638_0222371	Ga0495638_0222371_379_999	204
308	3300046477	Ga0495664_0083731	Ga0495664_0083731_1081_1707	204
309	3300046492	Ga0495585_0034472	Ga0495585_0034472_561_1181	204
310	3300046499	Ga0495594_0148723	Ga0495594_0148723_90_710	204
311	3300046500	Ga0495596_0046674	Ga0495596_0046674_1010_1630	204
312	3300046506	Ga0495583_0157401	Ga0495583_0157401_131_751	204
313	3300046507	Ga0495606_0150487	Ga0495606_0150487_258_878	204
314	3300046513	Ga0495616_0009944	Ga0495616_0009944_2586_3206	204
315	3300046513	Ga0495616_0269701	Ga0495616_0269701_23_649	204
316	3300046515	Ga0495620_0087709	Ga0495620_0087709_77_697	204
317	3300046518	Ga0495631_0053813	Ga0495631_0053813_992_1612	204
318	3300046519	Ga0495632_0165982	Ga0495632_0165982_201_821	204
319	3300046526	Ga0495666_0039059	Ga0495666_0039059_141_764	204
320	3300046538	Ga0495609_0095876	Ga0495609_0095876_346_966	204
321	3300046557	Ga0495622_0038103	Ga0495622_0038103_813_1433	204
322	3300046616	Ga0495668_0022682	Ga0495668_0022682_986_1606	204
323	3300046616	Ga0495668_0288775	Ga0495668_0288775_168_794	204
324	3300046648	Ga0495611_0131478	Ga0495611_0131478_28_648	204
325	3300046660	Ga0495625_0523924	Ga0495625_0523924_23_643	204
326	3300046664	Ga0495659_0265799	Ga0495659_0265799_30_656	204
327	3300046675	Ga0495657_0209573	Ga0495657_0209573_42_668	204
328	3300046684	Ga0495669_0044062	Ga0495669_0044062_1160_1783	204
329	3300046684	Ga0495669_0134661	Ga0495669_0134661_519_1139	204
330	3300046691	Ga0495670_0062275	Ga0495670_0062275_1226_1852	204
331	3300046691	Ga0495670_0183070	Ga0495670_0183070_433_1053	204
332	3300046694	Ga0495649_0256736	Ga0495649_0256736_84_710	204
333	3300046810	Ga0495660_0101258	Ga0495660_0101258_853_1473	204
334	3300047323	Ga0495683_0105577	Ga0495683_0105577_600_1220	204
335	3300048091	Ga0495626_0166675	Ga0495626_0166675_268_888	204
336	3300048904	Ga0496101_0489814	Ga0496101_0489814_141_764	204
337	3300048905	Ga0496102_0006768	Ga0496102_0006768_309_932	204
338	3300048905	Ga0496102_0027968	Ga0496102_0027968_886_1512	204
339	3300048905	Ga0496102_0028322	Ga0496102_0028322_801_1421	204
340	3300048905	Ga0496102_0313625	Ga0496102_0313625_845_1468	204
341	3300048907	Ga0496104_0293457	Ga0496104_0293457_882_1508	204
342	3300048908	Ga0496105_0025056	Ga0496105_0025056_2594_3217	204
343	3300048908	Ga0496105_0060696	Ga0496105_0060696_28_654	204
344	3300048909	Ga0496106_0027981	Ga0496106_0027981_723_1346	204
345	3300048909	Ga0496106_0166477	Ga0496106_0166477_970_1593	204
346	3300048910	Ga0496107_0120961	Ga0496107_0120961_335_955	204
347	3300048910	Ga0496107_0256850	Ga0496107_0256850_287_907	204
348	3300048911	Ga0496108_0018136	Ga0496108_0018136_5003_5626	204
349	3300048912	Ga0496109_0108394	Ga0496109_0108394_1835_2461	204
350	3300048912	Ga0496109_0421945	Ga0496109_0421945_155_778	204
351	3300048913	Ga0496110_0024513	Ga0496110_0024513_3920_4546	204
352	3300048914	Ga0496111_0039965	Ga0496111_0039965_1430_2053	204
353	3300048914	Ga0496111_0207806	Ga0496111_0207806_476_1102	204
354	3300048915	Ga0496112_0099066	Ga0496112_0099066_543_1169	204
355	3300048916	Ga0496113_0134823	Ga0496113_0134823_1168_1794	204
356	3300048916	Ga0496113_0400312	Ga0496113_0400312_281_901	204
357	3300048917	Ga0496114_0053872	Ga0496114_0053872_1274_1900	204
358	3300048918	Ga0496115_0011990	Ga0496115_0011990_4957_5580	204
359	3300048918	Ga0496115_0049093	Ga0496115_0049093_2058_2678	204
360	3300048920	Ga0496117_0141779	Ga0496117_0141779_483_1097	204
361	3300048921	Ga0496118_0163020	Ga0496118_0163020_713_1327	204
362	3300048922	Ga0496119_0009210	Ga0496119_0009210_2852_3472	204
363	3300048923	Ga0496120_0015271	Ga0496120_0015271_2344_2964	204
364	3300048924	Ga0496121_0082251	Ga0496121_0082251_440_1060	204
365	3300048924	Ga0496121_0119501	Ga0496121_0119501_778_1401	204
366	3300048924	Ga0496121_0140324	Ga0496121_0140324_775_1566	204
367	3300048924	Ga0496121_0216262	Ga0496121_0216262_317_937	204
368	3300048929	Ga0496126_0005323	Ga0496126_0005323_7879_8499	204
369	3300048929	Ga0496126_0057652	Ga0496126_0057652_2534_3160	204
370	3300048929	Ga0496126_0093780	Ga0496126_0093780_775_1395	204
371	3300048929	Ga0496126_0218839	Ga0496126_0218839_934_1554	204
372	3300049568	Ga0501031_0054725	Ga0501031_0054725_132_758	204
373	3300049569	Ga0501032_0009254	Ga0501032_0009254_4920_5546	204
374	3300049570	Ga0501033_0010545	Ga0501033_0010545_2547_3173	204
375	3300049571	Ga0501034_0092271	Ga0501034_0092271_1842_2468	204
376	3300049572	Ga0501036_0092383	Ga0501036_0092383_1440_2066	204
377	3300049573	Ga0501037_0086600	Ga0501037_0086600_1151_1777	204
378	3300049574	Ga0501038_0245047	Ga0501038_0245047_305_931	204
379	3300049575	Ga0501039_0014991	Ga0501039_0014991_1734_2360	204
380	3300049576	Ga0501040_0075754	Ga0501040_0075754_1151_1777	204
381	3300049578	Ga0501042_0014981	Ga0501042_0014981_4045_4671	204
382	3300049579	Ga0501043_0263194	Ga0501043_0263194_491_1117	204
383	3300049580	Ga0501046_0056450	Ga0501046_0056450_558_1184	204
384	3300049581	Ga0501047_0029703	Ga0501047_0029703_4086_4712	204
385	3300049582	Ga0501048_0486644	Ga0501048_0486644_127_753	204
386	3300049583	Ga0501067_0011993	Ga0501067_0011993_4045_4671	204
387	3300049584	Ga0501068_0004035	Ga0501068_0004035_1765_2391	204
388	3300049585	Ga0501069_0024247	Ga0501069_0024247_2655_3281	204
389	3300049586	Ga0501070_0026106	Ga0501070_0026106_132_758	204
390	3300049587	Ga0501071_0280407	Ga0501071_0280407_151_777	204
391	3300049588	Ga0501072_0074135	Ga0501072_0074135_880_1506	204
392	3300049589	Ga0501073_0006215	Ga0501073_0006215_7136_7762	204
393	3300049590	Ga0501074_0002758	Ga0501074_0002758_771_1397	204
394	3300049741	Ga0501079_0006063	Ga0501079_0006063_1954_2580	204
395	3300049744	Ga0501083_0090531	Ga0501083_0090531_817_1443	204
396	3300049822	Ga0501035_0031175	Ga0501035_0031175_618_1244	204
397	3300049823	Ga0501044_0025407	Ga0501044_0025407_3918_4544	204
398	3300050489	nmdc:mga03683_65033_c1	nmdc:mga03683_65033_c1_504_1124	204
399	3300050490	nmdc:mga03n38_22431_c1	nmdc:mga03n38_22431_c1_698_1318	204
400	3300050491	nmdc:mga00v17_222943_c1	nmdc:mga00v17_222943_c1_398_1018	204
401	3300050492	nmdc:mga0yw44_31057_c1	nmdc:mga0yw44_31057_c1_1686_2306	204
402	3300050494	nmdc:mga06z11_31296_c1	nmdc:mga06z11_31296_c1_736_1356	204
403	3300050495	nmdc:mga04h51_135397_c1	nmdc:mga04h51_135397_c1_14_634	204
404	3300050496	nmdc:mga07m45_18952_c1	nmdc:mga07m45_18952_c1_920_1540	204
405	3300050507	nmdc:mga05p37_427790_c1	nmdc:mga05p37_427790_c1_88_708	204
406	3300050509	nmdc:mga0qj67_18788_c1	nmdc:mga0qj67_18788_c1_3749_4384	204
407	3300050510	nmdc:mga06r32_90098_c1	nmdc:mga06r32_90098_c1_504_1139	204
408	3300050512	nmdc:mga0n895_3422_c1	nmdc:mga0n895_3422_c1_1739_2362	204
409	3300050512	nmdc:mga0n895_48212_c1	nmdc:mga0n895_48212_c1_1287_1922	204
410	3300050513	nmdc:mga0rr50_32890_c1	nmdc:mga0rr50_32890_c1_1657_2280	204
411	3300050515	nmdc:mga0a205_4930_c1	nmdc:mga0a205_4930_c1_9900_10535	204
412	3300050516	nmdc:mga0sz30_65849_c1	nmdc:mga0sz30_65849_c1_130_750	204
413	3300053080	Ga0500635_0001336	Ga0500635_0001336_5139_5765	204
414	3300053085	Ga0495619_0013300	Ga0495619_0013300_1890_2516	204
415	3300053086	Ga0500578_0233010	Ga0500578_0233010_406_1026	204
416	3300053088	Ga0500644_0085171	Ga0500644_0085171_407_1027	204
417	3300053092	Ga0500583_0274219	Ga0500583_0274219_176_796	204
418	3300053096	Ga0500641_0083193	Ga0500641_0083193_53_673	204
419	3300053102	Ga0500554_035531	Ga0500554_035531_732_1358	204
420	3300053119	Ga0500595_007598	Ga0500595_007598_1097_1717	204
421	3300053134	Ga0500658_0022785	Ga0500658_0022785_866_1486	204
422	3300053136	Ga0500559_0265841	Ga0500559_0265841_25_651	204
423	3300053147	Ga0500589_022305	Ga0500589_022305_608_1228	204
424	3300053150	Ga0500603_005970	Ga0500603_005970_1258_1884	204
425	3300053158	Ga0500627_0204239	Ga0500627_0204239_25_648	204
426	3300053161	Ga0500634_0187447	Ga0500634_0187447_283_903	204
427	3300053161	Ga0500634_0239606	Ga0500634_0239606_24_644	204
428	3300053162	Ga0500638_173121	Ga0500638_173121_42_668	204
429	3300053178	Ga0500637_0010848	Ga0500637_0010848_2494_3120	204
430	3300054114	Ga0501084_0019810	Ga0501084_0019810_1055_1681	204
431	3300060353	Ga0501082_0008046	Ga0501082_0008046_5711_6337	204

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08857

ParBc_2

Putative ParB-like nuclease

54

212

0.96 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2hwj-assembly1.cif.gz_B	crystal structure of protein atu1540 from agrobacterium tumefaciens	0.9441	6	203
2hwj-assembly2.cif.gz_E	crystal structure of protein atu1540 from agrobacterium tumefaciens	0.9396	6	203
2hwj-assembly1.cif.gz_B	crystal structure of protein atu1540 from agrobacterium tumefaciens	0.9393	6	203
2hwj-assembly1.cif.gz_D	crystal structure of protein atu1540 from agrobacterium tumefaciens	0.9363	5	203
2hwj-assembly2.cif.gz_E	crystal structure of protein atu1540 from agrobacterium tumefaciens	0.9348	6	203

ID	Description	Score	Start	End	Superfamily
2hwjB02	Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain	0.9266	134	193	1.10.8.10
2hwjD01	Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain	0.9242	5	133	3.90.1530.10
2hwjD02	Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain	0.923	134	193	1.10.8.10
2hwjE02	Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;Ubiquitin-associated (UBA) domain	0.9213	134	193	1.10.8.10
2hwjD01	Alpha Beta;Alpha-Beta Complex;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain;Conserved hypothetical protein from pyrococcus furiosus pfu- 392566-001, ParB domain	0.917	5	133	3.90.1530.10

ID	Description	Score	Start	End
AF-A0A352S4Y7-F1-model_v4	Chromosome partitioning protein ParB	0.963	24	201
AF-A0A160U7H1-F1-model_v4	deleted	0.9616	11	204
AF-A0A349PAB0-F1-model_v4	Chromosome partitioning protein ParB	0.9602	9	199
AF-A0A366FNQ0-F1-model_v4	ParB-like nuclease	0.96	1	203
AF-A0A0N1AN77-F1-model_v4	Chromosome partitioning protein ParB	0.96	17	204

Feature Viewer

pLDDT	pTM	Quality
90.9	0.86	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F442322

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF08857

ParBc_2

Putative ParB-like nuclease

54

212

0.96

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map