F442309

General Info

Members Datasets Scaffolds Average Seq Length
431 219 431 258

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100125547|Ga0070713_1001255472
Length 303
Sequence MSVSTGPVSTEPXXXGAVSMRDLLEAGVHFGHQTRRWNPKMRRFIFAERGGIYIIDLTQTAERLDEARQFLRNVAERGGIVLFVGTKKQAQDAVENEAKSVDMPYVNHRWLGGLLTNWRTMADRIDRLHEMRRLRDEGQMELLPAKERISMANELEKLEANLGGVADMRRQPDAVVIVDLKKEALAVHEARRLGIPVVALVDTNCDPDEADYVIPGNDDAIRSCNLVIHSLAAAISDGKQKVSAEELQQDDVEQVEAGEQIEPVTEGESVPVPTGEDPAKEGAEETKRSDAALGDPTRGKEEA

Samples

Sample ID Description Type Environment
1 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
24 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
30 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
33 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
34 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
35 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
36 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
37 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
38 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
39 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
40 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
50 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
51 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
56 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
57 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
58 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
59 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
91 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
92 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
93 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
96 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
97 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
98 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
99 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
103 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
108 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
109 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
110 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
111 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
112 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
113 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
114 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
117 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
118 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
119 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
120 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
121 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
122 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
123 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
124 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
125 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
126 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
127 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
128 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
129 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
130 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
136 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
137 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
138 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
139 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
140 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
141 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
142 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
143 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
144 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
145 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
146 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
147 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
148 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
149 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
150 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
166 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
167 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
168 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
169 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
170 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
171 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
184 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
188 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
190 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
191 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
197 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
198 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
199 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
200 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
203 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
215 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.45
Metatranscriptomes 2.55
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.66
Rhizosphere 91.42
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARcpr5yngRDRAFT_c001838 3300000043 Bacteria 2269
2 Ga0070658_10011556 3300005327 Bacteria 7083
3 Ga0070683_100014696 3300005329 Bacteria 6858
4 Ga0070680_100013271 3300005336 Bacteria 6415
5 Ga0070680_100040517 3300005336 Bacteria 3772
6 Ga0070682_100026237 3300005337 Bacteria 3485
7 Ga0070682_100077763 3300005337 Bacteria 2139
8 Ga0070682_100136130 3300005337 Bacteria 1669
9 Ga0070660_100006608 3300005339 Bacteria 8047
10 Ga0070660_100022899 3300005339 Bacteria 4625
11 Ga0070660_100155584 3300005339 Bacteria 1840
12 Ga0070661_100012318 3300005344 Bacteria 5981
13 Ga0070661_100084931 3300005344 Bacteria 2339
14 Ga0070671_100134914 3300005355 Bacteria 2081
15 Ga0070674_100177133 3300005356 Bacteria 1630
16 Ga0070714_100446010 3300005435 Bacteria 1229
17 Ga0070713_100125547 3300005436 Bacteria 2256
18 Ga0070710_10000589 3300005437 Bacteria 17269
19 Ga0070701_10288272 3300005438 Bacteria 1005
20 Ga0070711_100006227 3300005439 Bacteria 7182
21 Ga0070711_100139233 3300005439 Bacteria 1817
22 Ga0070662_100132305 3300005457 Bacteria 1925
23 Ga0070681_10022196 3300005458 Bacteria 6371
24 Ga0070681_10128519 3300005458 Bacteria 2466
25 Ga0070681_10525583 3300005458 Bacteria 1096
26 Ga0070698_100198099 3300005471 Bacteria 1944
27 Ga0070699_100075946 3300005518 Bacteria 2924
28 Ga0070679_100004486 3300005530 Bacteria 12895
29 Ga0070679_100125025 3300005530 Bacteria 2554
30 Ga0070679_100171461 3300005530 Bacteria 2142
31 Ga0070684_100013758 3300005535 Bacteria 6531
32 Ga0070684_100246501 3300005535 Bacteria 1633
33 Ga0068855_100024621 3300005563 Bacteria 7201
34 Ga0068855_100094701 3300005563 Bacteria 3443
35 Ga0068855_100112396 3300005563 Bacteria 3126
36 Ga0068855_100157441 3300005563 Bacteria 2580
37 Ga0068855_100321453 3300005563 Bacteria 1710
38 Ga0070664_100039156 3300005564 Bacteria 3993
39 Ga0068857_100085780 3300005577 Bacteria 2814
40 Ga0068854_100217577 3300005578 Bacteria 1510
41 Ga0068856_100016629 3300005614 Bacteria 7122
42 Ga0068852_100076492 3300005616 Bacteria 2955
43 Ga0081455_10021826 3300005937 Bacteria 5997
44 Ga0081455_10032932 3300005937 Bacteria 4663
45 Ga0081455_10041201 3300005937 Bacteria 4064
46 Ga0081539_10001773 3300005985 Bacteria 34339
47 Ga0070717_10013735 3300006028 Bacteria 6213
48 Ga0070717_10038503 3300006028 Bacteria 3887
49 Ga0075432_10000710 3300006058 Bacteria 10274
50 Ga0070712_100006831 3300006175 Bacteria 7106
51 Ga0075428_100001303 3300006844 Bacteria 26471
52 Ga0075428_100009035 3300006844 Bacteria 11060
53 Ga0075430_100011120 3300006846 Bacteria 7629
54 Ga0075431_100002708 3300006847 Bacteria 17182
55 Ga0075431_100226479 3300006847 Bacteria 1906
56 Ga0075434_100026447 3300006871 Bacteria 5684
57 Ga0075429_100012647 3300006880 Bacteria 7319
58 Ga0105240_10031263 3300009093 Bacteria 6906
59 Ga0105240_10213719 3300009093 Bacteria 2252
60 Ga0111539_10003299 3300009094 Bacteria 21326
61 Ga0105245_10005247 3300009098 Bacteria 11385
62 Ga0105245_10172442 3300009098 Bacteria 2061
63 Ga0105247_10085199 3300009101 Bacteria 1998
64 Ga0114129_10004297 3300009147 Bacteria 20136
65 Ga0114129_10023134 3300009147 Bacteria 8814
66 Ga0105243_10014070 3300009148 Bacteria 6055
67 Ga0105243_10151211 3300009148 Bacteria 1991
68 Ga0105241_10240494 3300009174 Bacteria 1530
69 Ga0105248_10774078 3300009177 Bacteria 1083
70 Ga0105238_10051694 3300009551 Bacteria 4133
71 Ga0105238_10430288 3300009551 Bacteria 1315
72 Ga0105238_10528135 3300009551 Bacteria 1183
73 Ga0157373_10159906 3300013100 Bacteria 1585
74 Ga0157370_10018569 3300013104 Bacteria 6990
75 Ga0157370_10068747 3300013104 Bacteria 3347
76 Ga0157369_10023946 3300013105 Bacteria 6795
77 Ga0157369_10120081 3300013105 Bacteria 2789
78 Ga0157374_10099980 3300013296 Bacteria 2779
79 Ga0157372_10250496 3300013307 Bacteria 2056
80 Ga0157372_10254116 3300013307 Bacteria 2040
81 Ga0197907_10234031 3300020069 Bacteria 1924
82 Ga0197907_10359904 3300020069 Bacteria 2673
83 Ga0197907_10726687 3300020069 Bacteria 1919
84 Ga0197907_11198298 3300020069 Bacteria 1407
85 Ga0206356_11200640 3300020070 Bacteria 5006
86 Ga0206349_1346268 3300020075 Bacteria 1153
87 Ga0206352_10925246 3300020078 Bacteria 1076
88 Ga0206350_11217372 3300020080 Bacteria 1321
89 Ga0206354_10113154 3300020081 Bacteria 1386
90 Ga0206354_11559427 3300020081 Bacteria 2091
91 Ga0206353_10208862 3300020082 Bacteria 4522
92 Ga0213875_10072488 3300021388 Bacteria 1608
93 Ga0207692_10001763 3300025898 Bacteria 8214
94 Ga0207688_10006630 3300025901 Bacteria 6297
95 Ga0207685_10004476 3300025905 Bacteria 3560
96 Ga0207699_10007743 3300025906 Bacteria 5260
97 Ga0207699_10038233 3300025906 Bacteria 2749
98 Ga0207643_10011759 3300025908 Bacteria 4726
99 Ga0207705_10001180 3300025909 Bacteria 21214
100 Ga0207705_10046008 3300025909 Bacteria 3135
101 Ga0207654_10163853 3300025911 Bacteria 1438
102 Ga0207707_10021542 3300025912 Bacteria 5634
103 Ga0207707_10024966 3300025912 Bacteria 5229
104 Ga0207707_10027974 3300025912 Bacteria 4930
105 Ga0207707_10110075 3300025912 Bacteria 2407
106 Ga0207707_10119319 3300025912 Bacteria 2305
107 Ga0207707_10322067 3300025912 Bacteria 1335
108 Ga0207695_10016356 3300025913 Bacteria 8682
109 Ga0207695_10234036 3300025913 Bacteria 1740
110 Ga0207693_10000662 3300025915 Bacteria 30935
111 Ga0207693_10005535 3300025915 Bacteria 10507
112 Ga0207663_10000565 3300025916 Bacteria 16340
113 Ga0207660_10011797 3300025917 Bacteria 5697
114 Ga0207660_10276584 3300025917 Bacteria 1331
115 Ga0207657_10000054 3300025919 Bacteria 106767
116 Ga0207657_10006735 3300025919 Bacteria 11862
117 Ga0207657_10035892 3300025919 Bacteria 4440
118 Ga0207649_10033911 3300025920 Bacteria 3054
119 Ga0207652_10009549 3300025921 Bacteria 7802
120 Ga0207652_10013051 3300025921 Bacteria 6724
121 Ga0207652_10205816 3300025921 Bacteria 1771
122 Ga0207646_10067589 3300025922 Bacteria 3191
123 Ga0207646_10228305 3300025922 Bacteria 1682
124 Ga0207659_10186597 3300025926 Bacteria 1647
125 Ga0207687_10101329 3300025927 Bacteria 2120
126 Ga0207700_10003047 3300025928 Bacteria 9669
127 Ga0207700_10107760 3300025928 Bacteria 2236
128 Ga0207664_10012742 3300025929 Bacteria 6019
129 Ga0207664_10062657 3300025929 Bacteria 2970
130 Ga0207644_10075311 3300025931 Bacteria 2480
131 Ga0207690_10015778 3300025932 Bacteria 4584
132 Ga0207706_10012881 3300025933 Bacteria 7611
133 Ga0207669_10274271 3300025937 Bacteria 1268
134 Ga0207661_10033709 3300025944 Bacteria 3976
135 Ga0207661_10223145 3300025944 Bacteria 1666
136 Ga0207661_10375876 3300025944 Bacteria 1285
137 Ga0207661_10385647 3300025944 Bacteria 1269
138 Ga0207679_10166532 3300025945 Bacteria 1810
139 Ga0207667_10050745 3300025949 Bacteria 4376
140 Ga0207640_10399987 3300025981 Bacteria 1118
141 Ga0207677_10074687 3300026023 Bacteria 2407
142 Ga0207678_10290502 3300026067 Bacteria 1404
143 Ga0207698_10122042 3300026142 Bacteria 2207
144 Ga0207428_10000401 3300027907 Bacteria 53789
145 Ga0265322_10012838 3300028654 Bacteria 2427
146 Ga0265338_10066843 3300028800 Bacteria 3108
147 Ga0265330_10020193 3300031235 Bacteria 3045
148 Ga0265325_10018132 3300031241 Bacteria 3904
149 Ga0265340_10032465 3300031247 Bacteria 2607
150 Ga0265331_10084543 3300031250 Bacteria 1471
151 Ga0265327_10016624 3300031251 Bacteria 4661
152 Ga0265316_10031777 3300031344 Bacteria 4313
153 Ga0265313_10019644 3300031595 Bacteria 3753
154 Ga0265314_10002229 3300031711 Bacteria 20166
155 Ga0265342_10015926 3300031712 Bacteria 4930
156 Ga0373948_0023117 3300034817 Bacteria 1204
157 Ga0373957_0021689 3300035120 Bacteria 2283
158 Ga0373943_0010357 3300035170 Bacteria 4182
159 Ga0373955_0132524 3300035172 Bacteria 1456
160 Ga0373931_0026749 3300035691 Bacteria 2940
161 Ga0373937_0027346 3300036401 Bacteria 5157
162 Ga0395899_0003201 3300037312 Bacteria 12979
163 Ga0395899_0019832 3300037312 Bacteria 5102
164 Ga0395899_0096014 3300037312 Bacteria 2144
165 Ga0395900_0002489 3300037418 Bacteria 20243
166 Ga0395900_0021884 3300037418 Bacteria 6537
167 Ga0395900_0064679 3300037418 Bacteria 3758
168 Ga0395900_0066811 3300037418 Bacteria 3695
169 Ga0395900_0093504 3300037418 Bacteria 3088
170 Ga0395900_0243619 3300037418 Bacteria 1802
171 Ga0395900_0724780 3300037418 Bacteria 926
172 Ga0395898_0004411 3300037466 Bacteria 15397
173 Ga0395898_0007793 3300037466 Bacteria 11367
174 Ga0395898_0011522 3300037466 Bacteria 9182
175 Ga0395898_0099767 3300037466 Bacteria 2789
176 Ga0395905_0002440 3300037471 Bacteria 20609
177 Ga0395905_0076801 3300037471 Bacteria 3130
178 Ga0395905_0125874 3300037471 Bacteria 2409
179 Ga0395905_0200057 3300037471 Bacteria 1873
180 Ga0395905_0345988 3300037471 Bacteria 1378
181 Ga0436364_0115954 3300037853 Bacteria 10221
182 Ga0395901_0001334 3300038443 Bacteria 25911
183 Ga0395901_0009334 3300038443 Bacteria 9945
184 Ga0395901_0021306 3300038443 Bacteria 6639
185 Ga0395901_0029951 3300038443 Bacteria 5606
186 Ga0395901_0060412 3300038443 Bacteria 3944
187 Ga0395901_0200421 3300038443 Bacteria 2092
188 Ga0395901_0204233 3300038443 Bacteria 2070
189 Ga0436365_0088672 3300039437 Bacteria 1518
190 Ga0436365_1820242 3300039437 Bacteria 4216
191 Ga0466966_0006668 3300044684 Bacteria 7645
192 Ga0466961_0018001 3300044693 Bacteria 4542
193 Ga0466961_0019558 3300044693 Bacteria 4356
194 Ga0466961_0054355 3300044693 Bacteria 2554
195 Ga0466961_0100231 3300044693 Bacteria 1825
196 Ga0466961_0135946 3300044693 Bacteria 1540
197 Ga0466963_0003862 3300044694 Bacteria 8649
198 Ga0466963_0029776 3300044694 Bacteria 3517
199 Ga0466963_0030183 3300044694 Bacteria 3496
200 Ga0466963_0094301 3300044694 Bacteria 2041
201 Ga0466963_0311861 3300044694 Bacteria 1107
202 Ga0466964_0000569 3300044706 Bacteria 11600
203 Ga0466964_0002060 3300044706 Bacteria 7074
204 Ga0466971_0003274 3300044719 Bacteria 6912
205 Ga0466971_0015480 3300044719 Bacteria 3357
206 Ga0466968_0004507 3300044735 Bacteria 5210
207 Ga0466968_0070313 3300044735 Bacteria 1523
208 Ga0466970_0045917 3300044765 Bacteria 2326
209 Ga0466957_0002174 3300044842 Bacteria 10505
210 Ga0466957_0009981 3300044842 Bacteria 5434
211 Ga0466957_0068742 3300044842 Bacteria 2187
212 Ga0466960_0258890 3300044901 Bacteria 969
213 Ga0466959_0004417 3300045049 Bacteria 9414
214 Ga0466959_0026397 3300045049 Bacteria 4306
215 Ga0466959_0036589 3300045049 Bacteria 3627
216 Ga0466959_0222212 3300045049 Bacteria 1309
217 Ga0466958_0004001 3300045836 Bacteria 7727
218 Ga0466958_0068829 3300045836 Bacteria 2164
219 Ga0466958_0144948 3300045836 Bacteria 1496
220 Ga0466958_0167002 3300045836 Bacteria 1392
221 Ga0466967_0000305 3300045976 Bacteria 22092
222 Ga0466967_0013911 3300045976 Bacteria 6241
223 Ga0466967_0018695 3300045976 Bacteria 5548
224 Ga0466967_0029411 3300045976 Bacteria 4597
225 Ga0466967_0064467 3300045976 Bacteria 3258
226 Ga0466967_0065065 3300045976 Bacteria 3244
227 Ga0466967_0067296 3300045976 Bacteria 3194
228 Ga0466967_0106985 3300045976 Bacteria 2565
229 Ga0466967_0143491 3300045976 Bacteria 2225
230 Ga0466967_0229123 3300045976 Bacteria 1768
231 Ga0495592_0000100 3300046454 Bacteria 76535
232 Ga0495592_0194619 3300046454 Bacteria 1372
233 Ga0495629_0045886 3300046459 Bacteria 3065
234 Ga0495651_0000008 3300046462 Bacteria 156989
235 Ga0495651_0011313 3300046462 Bacteria 6858
236 Ga0495653_0000519 3300046463 Bacteria 29635
237 Ga0495664_0068286 3300046477 Bacteria 2121
238 Ga0495664_0091881 3300046477 Bacteria 1825
239 Ga0495608_0002853 3300046511 Bacteria 12379
240 Ga0495608_0178207 3300046511 Bacteria 1345
241 Ga0495618_0049434 3300046514 Bacteria 2655
242 Ga0495628_0001255 3300046516 Bacteria 23210
243 Ga0495628_0026156 3300046516 Bacteria 4764
244 Ga0495628_0151848 3300046516 Bacteria 1764
245 Ga0495630_0021978 3300046517 Bacteria 4713
246 Ga0495630_0088673 3300046517 Bacteria 2336
247 Ga0495630_0452345 3300046517 Bacteria 984
248 Ga0495642_0173147 3300046528 Bacteria 938
249 Ga0495652_0000888 3300046529 Bacteria 34393
250 Ga0495652_0109514 3300046529 Bacteria 2223
251 Ga0495652_0112906 3300046529 Bacteria 2182
252 Ga0495640_0017319 3300046533 Bacteria 5373
253 Ga0495640_0221478 3300046533 Bacteria 1193
254 Ga0495586_0004734 3300046535 Bacteria 7274
255 Ga0495587_0000048 3300046536 Bacteria 105358
256 Ga0495645_0000029 3300046543 Bacteria 113119
257 Ga0495667_0060630 3300046559 Bacteria 2481
258 Ga0495634_0247922 3300046642 Bacteria 1090
259 Ga0495588_0073524 3300046674 Bacteria 1780
260 Ga0495599_0040568 3300046678 Bacteria 2923
261 Ga0495623_0000093 3300046679 Bacteria 53441
262 Ga0495646_0000416 3300046680 Bacteria 22540
263 Ga0495658_0074143 3300046683 Bacteria 1982
264 Ga0495613_0033557 3300046689 Bacteria 3814
265 Ga0495613_0178363 3300046689 Bacteria 1505
266 Ga0495600_0126265 3300046809 Bacteria 1664
267 Ga0495600_0205244 3300046809 Bacteria 1264
268 Ga0495581_0120490 3300047315 Bacteria 1527
269 Ga0495604_0000111 3300047317 Bacteria 68576
270 Ga0495674_0001135 3300047319 Bacteria 25640
271 Ga0495674_0080702 3300047319 Bacteria 2791
272 Ga0495676_0049613 3300047321 Bacteria 3373
273 Ga0495680_0076192 3300047322 Bacteria 2544
274 Ga0495675_0000376 3300047444 Bacteria 30923
275 Ga0495684_0120198 3300047471 Bacteria 1979
276 Ga0495602_0000141 3300048088 Bacteria 67940
277 Ga0495602_0040057 3300048088 Bacteria 4304
278 Ga0496100_0344989 3300048903 Bacteria 1123
279 Ga0496101_0009494 3300048904 Bacteria 6395
280 Ga0496101_0060312 3300048904 Bacteria 2752
281 Ga0496101_0363033 3300048904 Bacteria 1138
282 Ga0496102_0010283 3300048905 Bacteria 8045
283 Ga0496102_0056653 3300048905 Bacteria 3576
284 Ga0496103_0009066 3300048906 Bacteria 5892
285 Ga0496104_0007716 3300048907 Bacteria 9528
286 Ga0496104_0025950 3300048907 Bacteria 5403
287 Ga0496105_0011620 3300048908 Bacteria 6965
288 Ga0496105_0041210 3300048908 Bacteria 3805
289 Ga0496105_0428177 3300048908 Bacteria 1047
290 Ga0496106_0011036 3300048909 Bacteria 6678
291 Ga0496106_0029182 3300048909 Bacteria 4110
292 Ga0496106_0238645 3300048909 Bacteria 1452
293 Ga0496107_0007244 3300048910 Bacteria 7640
294 Ga0496107_0045101 3300048910 Bacteria 3171
295 Ga0496107_0132903 3300048910 Bacteria 1838
296 Ga0496108_0010155 3300048911 Bacteria 7641
297 Ga0496109_0020732 3300048912 Bacteria 5805
298 Ga0496109_0411144 3300048912 Bacteria 1278
299 Ga0496110_0040694 3300048913 Bacteria 4051
300 Ga0496111_0006472 3300048914 Bacteria 7609
301 Ga0496112_0011606 3300048915 Bacteria 8056
302 Ga0496112_0199438 3300048915 Bacteria 1961
303 Ga0496114_0001144 3300048917 Bacteria 20053
304 Ga0496114_0016227 3300048917 Bacteria 5997
305 Ga0496114_0252055 3300048917 Bacteria 1553
306 Ga0496115_0001178 3300048918 Bacteria 18760
307 Ga0496115_0007850 3300048918 Bacteria 7869
308 Ga0496115_0278231 3300048918 Bacteria 1374
309 Ga0496115_0314633 3300048918 Bacteria 1281
310 Ga0496115_0431829 3300048918 Bacteria 1066
311 Ga0501031_0003240 3300049568 Bacteria 10461
312 Ga0501031_0006347 3300049568 Bacteria 7710
313 Ga0501032_0004716 3300049569 Bacteria 10229
314 Ga0501032_0146739 3300049569 Bacteria 1553
315 Ga0501033_0001524 3300049570 Bacteria 20470
316 Ga0501033_0004901 3300049570 Bacteria 10651
317 Ga0501033_0261399 3300049570 Bacteria 1225
318 Ga0501034_0068517 3300049571 Bacteria 3558
319 Ga0501034_0205119 3300049571 Bacteria 1928
320 Ga0501036_0012736 3300049572 Bacteria 6976
321 Ga0501036_0021527 3300049572 Bacteria 5421
322 Ga0501036_0021549 3300049572 Bacteria 5418
323 Ga0501037_0009401 3300049573 Bacteria 7173
324 Ga0501037_0019222 3300049573 Bacteria 5035
325 Ga0501038_0004743 3300049574 Bacteria 12641
326 Ga0501038_0005147 3300049574 Bacteria 12149
327 Ga0501038_0118388 3300049574 Bacteria 2187
328 Ga0501039_0010209 3300049575 Bacteria 7155
329 Ga0501039_0096614 3300049575 Bacteria 2303
330 Ga0501039_0324147 3300049575 Bacteria 1211
331 Ga0501039_0334330 3300049575 Bacteria 1190
332 Ga0501039_0459661 3300049575 Bacteria 1000
333 Ga0501040_0016469 3300049576 Bacteria 4894
334 Ga0501041_0025420 3300049577 Bacteria 3558
335 Ga0501041_0050491 3300049577 Bacteria 2535
336 Ga0501041_0079459 3300049577 Bacteria 2019
337 Ga0501042_0002063 3300049578 Bacteria 12186
338 Ga0501042_0005539 3300049578 Bacteria 8136
339 Ga0501043_0001469 3300049579 Bacteria 20613
340 Ga0501043_0072788 3300049579 Bacteria 2699
341 Ga0501046_0004797 3300049580 Bacteria 12191
342 Ga0501046_0027701 3300049580 Bacteria 4620
343 Ga0501047_0009800 3300049581 Bacteria 9053
344 Ga0501047_0205971 3300049581 Bacteria 1826
345 Ga0501047_0206951 3300049581 Bacteria 1821
346 Ga0501048_0007694 3300049582 Bacteria 8167
347 Ga0501048_0010275 3300049582 Bacteria 6999
348 Ga0501048_0013822 3300049582 Bacteria 5987
349 Ga0501048_0041582 3300049582 Bacteria 3291
350 Ga0501068_0007752 3300049584 Bacteria 5945
351 Ga0501068_0008952 3300049584 Bacteria 5586
352 Ga0501068_0089676 3300049584 Bacteria 1896
353 Ga0501069_0008637 3300049585 Bacteria 5363
354 Ga0501069_0031777 3300049585 Bacteria 2905
355 Ga0501069_0061785 3300049585 Bacteria 2092
356 Ga0501069_0096157 3300049585 Bacteria 1678
357 Ga0501070_0000880 3300049586 Bacteria 27241
358 Ga0501070_0018061 3300049586 Bacteria 5918
359 Ga0501070_0093793 3300049586 Bacteria 2483
360 Ga0501071_0016450 3300049587 Bacteria 5087
361 Ga0501071_0018342 3300049587 Bacteria 4843
362 Ga0501071_0045739 3300049587 Bacteria 3142
363 Ga0501071_0131939 3300049587 Bacteria 1856
364 Ga0501072_0014656 3300049588 Bacteria 6009
365 Ga0501072_0019409 3300049588 Bacteria 5253
366 Ga0501072_0027586 3300049588 Bacteria 4429
367 Ga0501072_0232991 3300049588 Bacteria 1467
368 Ga0501073_0004072 3300049589 Bacteria 10973
369 Ga0501073_0016288 3300049589 Bacteria 5388
370 Ga0501073_0095791 3300049589 Bacteria 2061
371 Ga0501074_0009978 3300049590 Bacteria 6896
372 Ga0501074_0017181 3300049590 Bacteria 5249
373 Ga0501074_0181043 3300049590 Bacteria 1503
374 Ga0501075_0012974 3300049591 Bacteria 5937
375 Ga0501075_0013183 3300049591 Bacteria 5894
376 Ga0501075_0023568 3300049591 Bacteria 4508
377 Ga0501075_0113981 3300049591 Bacteria 2055
378 Ga0501076_0027481 3300049592 Bacteria 4411
379 Ga0501076_0108419 3300049592 Bacteria 2243
380 Ga0501076_0266851 3300049592 Bacteria 1401
381 Ga0501076_0584895 3300049592 Bacteria 921
382 Ga0501077_0002842 3300049593 Bacteria 10382
383 Ga0501077_0062852 3300049593 Bacteria 2355
384 Ga0501079_0009101 3300049741 Bacteria 7518
385 Ga0501079_0022795 3300049741 Bacteria 4806
386 Ga0501079_0038518 3300049741 Bacteria 3686
387 Ga0501080_0002972 3300049742 Bacteria 14917
388 Ga0501080_0003472 3300049742 Bacteria 13888
389 Ga0501080_0062426 3300049742 Bacteria 3468
390 Ga0501080_0066619 3300049742 Bacteria 3349
391 Ga0501080_0141030 3300049742 Bacteria 2228
392 Ga0501080_0262274 3300049742 Bacteria 1574
393 Ga0501081_0005679 3300049743 Bacteria 8074
394 Ga0501081_0019573 3300049743 Bacteria 4507
395 Ga0501083_0007398 3300049744 Bacteria 7789
396 Ga0501083_0015009 3300049744 Bacteria 5422
397 Ga0501035_0007681 3300049822 Bacteria 10074
398 Ga0501035_0010914 3300049822 Bacteria 8412
399 Ga0501035_0047953 3300049822 Bacteria 3832
400 Ga0501045_0017467 3300049824 Bacteria 5093
401 Ga0501045_0023626 3300049824 Bacteria 4409
402 Ga0501045_0041485 3300049824 Bacteria 3348
403 nmdc:mga05p37_3733_c2 3300050507 Bacteria 13686
404 nmdc:mga05p37_62072_c1 3300050507 Bacteria 4600
405 nmdc:mga05p37_761353_c1 3300050507 Bacteria 1066
406 nmdc:mga09592_18299_c1 3300050508 Bacteria 5745
407 nmdc:mga08y16_8488_c1 3300050511 Bacteria 10760
408 nmdc:mga0n895_118964_c1 3300050512 Bacteria 2663
409 nmdc:mga0n895_287431_c1 3300050512 Bacteria 1667
410 nmdc:mga0n895_724616_c1 3300050512 Bacteria 989
411 nmdc:mga0rr50_35546_c1 3300050513 Bacteria 3579
412 Ga0495601_0000206 3300053077 Bacteria 31438
413 Ga0495601_0039889 3300053077 Bacteria 2940
414 Ga0495601_0108489 3300053077 Bacteria 1796
415 Ga0495655_0007003 3300053083 Bacteria 2078
416 Ga0495595_0009320 3300053084 Bacteria 4057
417 Ga0495595_0030444 3300053084 Bacteria 2421
418 Ga0495619_0000291 3300053085 Bacteria 35704
419 Ga0495619_0011106 3300053085 Bacteria 5664
420 Ga0495619_0033162 3300053085 Bacteria 3353
421 Ga0495619_0291630 3300053085 Bacteria 1130
422 Ga0501084_0044626 3300054114 Bacteria 3711
423 Ga0501084_0088815 3300054114 Bacteria 2594
424 Ga0501084_0090801 3300054114 Bacteria 2564
425 Ga0590071_004515 3300059421 Bacteria 3376
426 Ga0590075_017005 3300059424 Bacteria 1790
427 Ga0501082_0001301 3300060353 Bacteria 21897
428 Ga0501082_0020574 3300060353 Bacteria 5687
429 Ga0466962_0000350 3300061719 Bacteria 19782
430 Ga0530510_0025674 3300061734 Bacteria 4213
431 Ga0530510_0031709 3300061734 Bacteria 3801

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048908 Ga0496105_0428177 Ga0496105_0428177_233_1012 220
2 3300037312 Ga0395899_0019832 Ga0395899_0019832_3876_4613 221
3 3300037418 Ga0395900_0002489 Ga0395900_0002489_13199_13936 221
4 3300037466 Ga0395898_0007793 Ga0395898_0007793_6079_6816 221
5 3300037471 Ga0395905_0002440 Ga0395905_0002440_11024_11761 221
6 3300038443 Ga0395901_0001334 Ga0395901_0001334_12256_12993 221
7 3300044901 Ga0466960_0258890 Ga0466960_0258890_90_926 221
8 3300046528 Ga0495642_0173147 Ga0495642_0173147_41_880 222
9 3300049577 Ga0501041_0025420 Ga0501041_0025420_2675_3505 224
10 3300005355 Ga0070671_100134914 Ga0070671_1001349142 230
11 3300025931 Ga0207644_10075311 Ga0207644_100753112 230
12 3300028800 Ga0265338_10066843 Ga0265338_100668431 230
13 3300044693 Ga0466961_0135946 Ga0466961_0135946_22_768 230
14 3300053077 Ga0495601_0108489 Ga0495601_0108489_262_1125 230
15 3300020069 Ga0197907_10234031 Ga0197907_102340312 231
16 3300005435 Ga0070714_100446010 Ga0070714_1004460102 232
17 3300005563 Ga0068855_100157441 Ga0068855_1001574412 232
18 3300009093 Ga0105240_10031263 Ga0105240_100312632 232
19 3300013104 Ga0157370_10018569 Ga0157370_1001856910 232
20 3300025922 Ga0207646_10228305 Ga0207646_102283052 232
21 3300025944 Ga0207661_10223145 Ga0207661_102231452 232
22 3300035170 Ga0373943_0010357 Ga0373943_0010357_995_1963 232
23 3300044693 Ga0466961_0018001 Ga0466961_0018001_1417_2304 232
24 3300044719 Ga0466971_0015480 Ga0466971_0015480_607_1494 232
25 3300045836 Ga0466958_0004001 Ga0466958_0004001_5498_6385 232
26 3300047321 Ga0495676_0049613 Ga0495676_0049613_1835_2803 232
27 3300044693 Ga0466961_0054355 Ga0466961_0054355_920_1759 234
28 3300044694 Ga0466963_0003862 Ga0466963_0003862_6914_7753 234
29 3300044719 Ga0466971_0003274 Ga0466971_0003274_2421_3260 234
30 3300044842 Ga0466957_0002174 Ga0466957_0002174_8770_9609 234
31 3300045976 Ga0466967_0064467 Ga0466967_0064467_1688_2527 234
32 3300061719 Ga0466962_0000350 Ga0466962_0000350_44_883 234
33 3300005337 Ga0070682_100136130 Ga0070682_1001361303 235
34 3300005563 Ga0068855_100112396 Ga0068855_1001123963 235
35 3300009093 Ga0105240_10213719 Ga0105240_102137192 235
36 3300009551 Ga0105238_10051694 Ga0105238_100516942 235
37 3300013104 Ga0157370_10068747 Ga0157370_100687473 235
38 3300020078 Ga0206352_10925246 Ga0206352_109252462 235
39 3300025926 Ga0207659_10186597 Ga0207659_101865972 235
40 3300035120 Ga0373957_0021689 Ga0373957_0021689_758_1639 235
41 3300037312 Ga0395899_0096014 Ga0395899_0096014_334_1146 235
42 3300037466 Ga0395898_0099767 Ga0395898_0099767_1583_2395 235
43 3300038443 Ga0395901_0060412 Ga0395901_0060412_1461_2273 235
44 3300046689 Ga0495613_0178363 Ga0495613_0178363_598_1491 235
45 3300009098 Ga0105245_10172442 Ga0105245_101724422 236
46 3300009174 Ga0105241_10240494 Ga0105241_102404942 236
47 3300044693 Ga0466961_0100231 Ga0466961_0100231_771_1616 236
48 3300044694 Ga0466963_0311861 Ga0466963_0311861_114_1043 236
49 3300044735 Ga0466968_0004507 Ga0466968_0004507_655_1563 236
50 3300044765 Ga0466970_0045917 Ga0466970_0045917_1184_2092 236
51 3300044842 Ga0466957_0009981 Ga0466957_0009981_3525_4433 236
52 3300045049 Ga0466959_0004417 Ga0466959_0004417_3952_4860 236
53 3300045049 Ga0466959_0026397 Ga0466959_0026397_1221_2066 236
54 3300045976 Ga0466967_0018695 Ga0466967_0018695_2797_3705 236
55 3300046517 Ga0495630_0021978 Ga0495630_0021978_2504_3526 236
56 3300046535 Ga0495586_0004734 Ga0495586_0004734_2315_3337 236
57 3300046683 Ga0495658_0074143 Ga0495658_0074143_874_1896 236
58 3300049569 Ga0501032_0004716 Ga0501032_0004716_4634_5479 236
59 3300049570 Ga0501033_0004901 Ga0501033_0004901_4890_5735 236
60 3300049571 Ga0501034_0068517 Ga0501034_0068517_178_1023 236
61 3300049573 Ga0501037_0009401 Ga0501037_0009401_1804_2649 236
62 3300049578 Ga0501042_0005539 Ga0501042_0005539_3491_4336 236
63 3300049579 Ga0501043_0072788 Ga0501043_0072788_948_1793 236
64 3300049582 Ga0501048_0010275 Ga0501048_0010275_4431_5276 236
65 3300049589 Ga0501073_0016288 Ga0501073_0016288_4256_5101 236
66 3300049591 Ga0501075_0113981 Ga0501075_0113981_1041_1886 236
67 3300049592 Ga0501076_0266851 Ga0501076_0266851_512_1357 236
68 3300049822 Ga0501035_0007681 Ga0501035_0007681_4813_5658 236
69 3300053083 Ga0495655_0007003 Ga0495655_0007003_30_902 236
70 3300054114 Ga0501084_0090801 Ga0501084_0090801_913_1758 236
71 3300060353 Ga0501082_0020574 Ga0501082_0020574_1041_1886 236
72 3300005337 Ga0070682_100077763 Ga0070682_1000777632 237
73 3300005985 Ga0081539_10001773 Ga0081539_1000177321 237
74 3300013105 Ga0157369_10120081 Ga0157369_101200814 237
75 3300013307 Ga0157372_10250496 Ga0157372_102504963 237
76 3300026067 Ga0207678_10290502 Ga0207678_102905022 237
77 3300026142 Ga0207698_10122042 Ga0207698_101220422 237
78 3300031247 Ga0265340_10032465 Ga0265340_100324652 237
79 3300031595 Ga0265313_10019644 Ga0265313_100196446 237
80 3300031712 Ga0265342_10015926 Ga0265342_100159264 237
81 3300037418 Ga0395900_0243619 Ga0395900_0243619_343_1146 237
82 3300038443 Ga0395901_0029951 Ga0395901_0029951_2468_3271 237
83 3300046477 Ga0495664_0091881 Ga0495664_0091881_236_1087 237
84 3300046516 Ga0495628_0151848 Ga0495628_0151848_663_1514 237
85 3300046533 Ga0495640_0221478 Ga0495640_0221478_89_940 237
86 3300046559 Ga0495667_0060630 Ga0495667_0060630_1380_2231 237
87 3300047319 Ga0495674_0080702 Ga0495674_0080702_1787_2638 237
88 3300048088 Ga0495602_0040057 Ga0495602_0040057_3105_3956 237
89 3300048909 Ga0496106_0238645 Ga0496106_0238645_294_1394 237
90 3300048915 Ga0496112_0199438 Ga0496112_0199438_56_916 237
91 3300050512 nmdc:mga0n895_724616_c1 nmdc:mga0n895_724616_c1_44_928 237
92 3300005327 Ga0070658_10011556 Ga0070658_100115565 238
93 3300005329 Ga0070683_100014696 Ga0070683_1000146963 238
94 3300005339 Ga0070660_100006608 Ga0070660_10000660811 238
95 3300005344 Ga0070661_100084931 Ga0070661_1000849313 238
96 3300005458 Ga0070681_10022196 Ga0070681_100221961 238
97 3300005535 Ga0070684_100013758 Ga0070684_10001375811 238
98 3300005535 Ga0070684_100246501 Ga0070684_1002465012 238
99 3300005563 Ga0068855_100024621 Ga0068855_1000246218 238
100 3300025906 Ga0207699_10038233 Ga0207699_100382332 238
101 3300025912 Ga0207707_10119319 Ga0207707_101193192 238
102 3300025917 Ga0207660_10276584 Ga0207660_102765841 238
103 3300025919 Ga0207657_10000054 Ga0207657_1000005466 238
104 3300025944 Ga0207661_10375876 Ga0207661_103758762 238
105 3300025944 Ga0207661_10385647 Ga0207661_103856471 238
106 3300025949 Ga0207667_10050745 Ga0207667_100507453 238
107 3300028654 Ga0265322_10012838 Ga0265322_100128382 238
108 3300031235 Ga0265330_10020193 Ga0265330_100201935 238
109 3300031241 Ga0265325_10018132 Ga0265325_100181323 238
110 3300035172 Ga0373955_0132524 Ga0373955_0132524_34_933 238
111 3300046459 Ga0495629_0045886 Ga0495629_0045886_1190_2107 238
112 3300046529 Ga0495652_0109514 Ga0495652_0109514_23_922 238
113 3300046674 Ga0495588_0073524 Ga0495588_0073524_225_1136 238
114 3300046809 Ga0495600_0205244 Ga0495600_0205244_88_1062 238
115 3300048904 Ga0496101_0060312 Ga0496101_0060312_1083_1952 238
116 3300048910 Ga0496107_0045101 Ga0496107_0045101_1044_1913 238
117 3300048910 Ga0496107_0132903 Ga0496107_0132903_384_1328 238
118 3300048917 Ga0496114_0252055 Ga0496114_0252055_364_1275 238
119 3300048918 Ga0496115_0001178 Ga0496115_0001178_15866_16735 238
120 3300049568 Ga0501031_0003240 Ga0501031_0003240_2815_3648 238
121 3300049572 Ga0501036_0012736 Ga0501036_0012736_3491_4324 238
122 3300049574 Ga0501038_0004743 Ga0501038_0004743_4452_5285 238
123 3300049580 Ga0501046_0027701 Ga0501046_0027701_511_1344 238
124 3300049584 Ga0501068_0007752 Ga0501068_0007752_179_1012 238
125 3300049586 Ga0501070_0018061 Ga0501070_0018061_1580_2413 238
126 3300049587 Ga0501071_0131939 Ga0501071_0131939_512_1345 238
127 3300049588 Ga0501072_0019409 Ga0501072_0019409_4291_5124 238
128 3300049742 Ga0501080_0066619 Ga0501080_0066619_2005_2838 238
129 3300049744 Ga0501083_0015009 Ga0501083_0015009_4461_5294 238
130 3300049824 Ga0501045_0041485 Ga0501045_0041485_1733_2566 238
131 3300053084 Ga0495595_0030444 Ga0495595_0030444_362_1336 238
132 3300005336 Ga0070680_100013271 Ga0070680_1000132718 239
133 3300005339 Ga0070660_100022899 Ga0070660_1000228994 239
134 3300005339 Ga0070660_100155584 Ga0070660_1001555842 239
135 3300005458 Ga0070681_10128519 Ga0070681_101285192 239
136 3300005458 Ga0070681_10525583 Ga0070681_105255832 239
137 3300005471 Ga0070698_100198099 Ga0070698_1001980992 239
138 3300005518 Ga0070699_100075946 Ga0070699_1000759463 239
139 3300005530 Ga0070679_100004486 Ga0070679_10000448611 239
140 3300005530 Ga0070679_100125025 Ga0070679_1001250251 239
141 3300005563 Ga0068855_100094701 Ga0068855_1000947015 239
142 3300005937 Ga0081455_10041201 Ga0081455_100412017 239
143 3300009147 Ga0114129_10023134 Ga0114129_100231342 239
144 3300009551 Ga0105238_10528135 Ga0105238_105281352 239
145 3300013307 Ga0157372_10254116 Ga0157372_102541163 239
146 3300020069 Ga0197907_10359904 Ga0197907_103599042 239
147 3300020069 Ga0197907_10726687 Ga0197907_107266872 239
148 3300020069 Ga0197907_11198298 Ga0197907_111982982 239
149 3300020070 Ga0206356_11200640 Ga0206356_112006406 239
150 3300020075 Ga0206349_1346268 Ga0206349_13462681 239
151 3300020081 Ga0206354_11559427 Ga0206354_115594273 239
152 3300025909 Ga0207705_10001180 Ga0207705_100011807 239
153 3300025909 Ga0207705_10046008 Ga0207705_100460083 239
154 3300025911 Ga0207654_10163853 Ga0207654_101638531 239
155 3300025912 Ga0207707_10021542 Ga0207707_100215422 239
156 3300025912 Ga0207707_10024966 Ga0207707_100249666 239
157 3300025913 Ga0207695_10016356 Ga0207695_100163563 239
158 3300025919 Ga0207657_10006735 Ga0207657_1000673511 239
159 3300025919 Ga0207657_10035892 Ga0207657_100358926 239
160 3300025921 Ga0207652_10205816 Ga0207652_102058162 239
161 3300031250 Ga0265331_10084543 Ga0265331_100845432 239
162 3300031344 Ga0265316_10031777 Ga0265316_100317771 239
163 3300037418 Ga0395900_0724780 Ga0395900_0724780_39_881 239
164 3300039437 Ga0436365_0088672 Ga0436365_0088672_239_1183 239
165 3300046514 Ga0495618_0049434 Ga0495618_0049434_303_1196 239
166 3300048905 Ga0496102_0056653 Ga0496102_0056653_1784_2695 239
167 3300048915 Ga0496112_0011606 Ga0496112_0011606_5953_6864 239
168 3300049568 Ga0501031_0006347 Ga0501031_0006347_4405_5271 239
169 3300049570 Ga0501033_0001524 Ga0501033_0001524_11310_12176 239
170 3300049571 Ga0501034_0205119 Ga0501034_0205119_696_1565 239
171 3300049572 Ga0501036_0021527 Ga0501036_0021527_3312_4178 239
172 3300049573 Ga0501037_0019222 Ga0501037_0019222_3263_4129 239
173 3300049574 Ga0501038_0005147 Ga0501038_0005147_234_1085 239
174 3300049575 Ga0501039_0010209 Ga0501039_0010209_1232_2098 239
175 3300049575 Ga0501039_0324147 Ga0501039_0324147_288_1106 239
176 3300049576 Ga0501040_0016469 Ga0501040_0016469_2312_3178 239
177 3300049577 Ga0501041_0050491 Ga0501041_0050491_438_1304 239
178 3300049577 Ga0501041_0079459 Ga0501041_0079459_626_1540 239
179 3300049578 Ga0501042_0002063 Ga0501042_0002063_3652_4518 239
180 3300049579 Ga0501043_0001469 Ga0501043_0001469_8266_9132 239
181 3300049580 Ga0501046_0004797 Ga0501046_0004797_6018_6884 239
182 3300049581 Ga0501047_0206951 Ga0501047_0206951_696_1568 239
183 3300049582 Ga0501048_0013822 Ga0501048_0013822_1717_2583 239
184 3300049584 Ga0501068_0008952 Ga0501068_0008952_571_1437 239
185 3300049585 Ga0501069_0061785 Ga0501069_0061785_735_1601 239
186 3300049586 Ga0501070_0000880 Ga0501070_0000880_21197_22063 239
187 3300049588 Ga0501072_0014656 Ga0501072_0014656_1244_2110 239
188 3300049588 Ga0501072_0232991 Ga0501072_0232991_243_1061 239
189 3300049589 Ga0501073_0004072 Ga0501073_0004072_1716_2582 239
190 3300049590 Ga0501074_0009978 Ga0501074_0009978_5308_6174 239
191 3300049591 Ga0501075_0013183 Ga0501075_0013183_3312_4178 239
192 3300049592 Ga0501076_0108419 Ga0501076_0108419_1106_2020 239
193 3300049593 Ga0501077_0002842 Ga0501077_0002842_7295_8161 239
194 3300049741 Ga0501079_0038518 Ga0501079_0038518_1104_1970 239
195 3300049742 Ga0501080_0003472 Ga0501080_0003472_5576_6442 239
196 3300049742 Ga0501080_0141030 Ga0501080_0141030_197_1069 239
197 3300049742 Ga0501080_0262274 Ga0501080_0262274_684_1499 239
198 3300049743 Ga0501081_0019573 Ga0501081_0019573_569_1435 239
199 3300049744 Ga0501083_0007398 Ga0501083_0007398_3701_4567 239
200 3300049822 Ga0501035_0010914 Ga0501035_0010914_3352_4218 239
201 3300049824 Ga0501045_0017467 Ga0501045_0017467_1104_1970 239
202 3300050507 nmdc:mga05p37_62072_c1 nmdc:mga05p37_62072_c1_3113_4003 239
203 3300053077 Ga0495601_0039889 Ga0495601_0039889_1850_2743 239
204 3300054114 Ga0501084_0044626 Ga0501084_0044626_624_1490 239
205 3300061734 Ga0530510_0025674 Ga0530510_0025674_2432_3298 239
206 3300061734 Ga0530510_0031709 Ga0530510_0031709_1982_2875 239
207 3300005577 Ga0068857_100085780 Ga0068857_1000857803 240
208 3300009177 Ga0105248_10774078 Ga0105248_107740781 240
209 3300021388 Ga0213875_10072488 Ga0213875_100724881 240
210 3300025921 Ga0207652_10009549 Ga0207652_100095498 240
211 3300031251 Ga0265327_10016624 Ga0265327_100166242 240
212 3300031711 Ga0265314_10002229 Ga0265314_100022296 240
213 3300037853 Ga0436364_0115954 Ga0436364_0115954_9181_10032 240
214 3300046533 Ga0495640_0017319 Ga0495640_0017319_806_1765 240
215 3300048912 Ga0496109_0411144 Ga0496109_0411144_152_1228 240
216 3300049581 Ga0501047_0009800 Ga0501047_0009800_932_1870 240
217 3300005344 Ga0070661_100012318 Ga0070661_1000123186 241
218 3300005616 Ga0068852_100076492 Ga0068852_1000764922 241
219 3300005937 Ga0081455_10021826 Ga0081455_100218263 241
220 3300013296 Ga0157374_10099980 Ga0157374_100999802 241
221 3300025912 Ga0207707_10027974 Ga0207707_100279743 241
222 3300025913 Ga0207695_10234036 Ga0207695_102340361 241
223 3300039437 Ga0436365_1820242 Ga0436365_1820242_1457_2311 241
224 3300046454 Ga0495592_0194619 Ga0495592_0194619_34_948 241
225 3300046462 Ga0495651_0011313 Ga0495651_0011313_5134_6048 241
226 3300046477 Ga0495664_0068286 Ga0495664_0068286_1125_2039 241
227 3300046511 Ga0495608_0178207 Ga0495608_0178207_107_1021 241
228 3300046516 Ga0495628_0026156 Ga0495628_0026156_2958_3872 241
229 3300046529 Ga0495652_0112906 Ga0495652_0112906_131_1045 241
230 3300046642 Ga0495634_0247922 Ga0495634_0247922_82_1032 241
231 3300046678 Ga0495599_0040568 Ga0495599_0040568_1295_2209 241
232 3300046689 Ga0495613_0033557 Ga0495613_0033557_1748_2662 241
233 3300046809 Ga0495600_0126265 Ga0495600_0126265_50_964 241
234 3300047315 Ga0495581_0120490 Ga0495581_0120490_250_1164 241
235 3300047319 Ga0495674_0001135 Ga0495674_0001135_23404_24318 241
236 3300047322 Ga0495680_0076192 Ga0495680_0076192_1289_2239 241
237 3300047471 Ga0495684_0120198 Ga0495684_0120198_1021_1935 241
238 3300048909 Ga0496106_0011036 Ga0496106_0011036_910_1848 241
239 3300048918 Ga0496115_0431829 Ga0496115_0431829_90_932 241
240 3300049592 Ga0501076_0584895 Ga0501076_0584895_74_895 241
241 3300053085 Ga0495619_0011106 Ga0495619_0011106_1842_2792 241
242 3300053085 Ga0495619_0291630 Ga0495619_0291630_168_1082 241
243 3300005336 Ga0070680_100040517 Ga0070680_1000405174 242
244 3300005337 Ga0070682_100026237 Ga0070682_1000262375 242
245 3300005356 Ga0070674_100177133 Ga0070674_1001771332 242
246 3300005436 Ga0070713_100125547 Ga0070713_1001255472 242
247 3300005439 Ga0070711_100139233 Ga0070711_1001392332 242
248 3300005564 Ga0070664_100039156 Ga0070664_1000391562 242
249 3300005614 Ga0068856_100016629 Ga0068856_1000166297 242
250 3300005937 Ga0081455_10032932 Ga0081455_100329321 242
251 3300006028 Ga0070717_10038503 Ga0070717_100385032 242
252 3300006844 Ga0075428_100009035 Ga0075428_10000903510 242
253 3300006846 Ga0075430_100011120 Ga0075430_1000111206 242
254 3300006847 Ga0075431_100002708 Ga0075431_1000027087 242
255 3300009101 Ga0105247_10085199 Ga0105247_100851992 242
256 3300009148 Ga0105243_10151211 Ga0105243_101512112 242
257 3300025908 Ga0207643_10011759 Ga0207643_100117597 242
258 3300025915 Ga0207693_10005535 Ga0207693_1000553511 242
259 3300025917 Ga0207660_10011797 Ga0207660_100117977 242
260 3300025920 Ga0207649_10033911 Ga0207649_100339114 242
261 3300025921 Ga0207652_10013051 Ga0207652_100130515 242
262 3300025928 Ga0207700_10107760 Ga0207700_101077602 242
263 3300025929 Ga0207664_10062657 Ga0207664_100626572 242
264 3300025932 Ga0207690_10015778 Ga0207690_100157785 242
265 3300025937 Ga0207669_10274271 Ga0207669_102742712 242
266 3300025944 Ga0207661_10033709 Ga0207661_100337096 242
267 3300026023 Ga0207677_10074687 Ga0207677_100746872 242
268 3300037312 Ga0395899_0003201 Ga0395899_0003201_1183_2040 242
269 3300037418 Ga0395900_0066811 Ga0395900_0066811_2386_3276 242
270 3300037418 Ga0395900_0093504 Ga0395900_0093504_105_962 242
271 3300037466 Ga0395898_0011522 Ga0395898_0011522_5074_5964 242
272 3300037471 Ga0395905_0076801 Ga0395905_0076801_58_948 242
273 3300037471 Ga0395905_0125874 Ga0395905_0125874_1183_2040 242
274 3300038443 Ga0395901_0021306 Ga0395901_0021306_2393_3283 242
275 3300038443 Ga0395901_0204233 Ga0395901_0204233_884_1741 242
276 3300045049 Ga0466959_0036589 Ga0466959_0036589_2410_3234 242
277 3300045836 Ga0466958_0068829 Ga0466958_0068829_120_1031 242
278 3300045836 Ga0466958_0144948 Ga0466958_0144948_111_935 242
279 3300045976 Ga0466967_0000305 Ga0466967_0000305_10677_11588 242
280 3300048907 Ga0496104_0007716 Ga0496104_0007716_7087_7983 242
281 3300048908 Ga0496105_0011620 Ga0496105_0011620_1472_2368 242
282 3300048918 Ga0496115_0314633 Ga0496115_0314633_76_972 242
283 3300050507 nmdc:mga05p37_761353_c1 nmdc:mga05p37_761353_c1_97_909 242
284 3300059421 Ga0590071_004515 Ga0590071_004515_2154_3170 242
285 3300059424 Ga0590075_017005 Ga0590075_017005_50_1066 242
286 3300005438 Ga0070701_10288272 Ga0070701_102882721 243
287 3300005530 Ga0070679_100171461 Ga0070679_1001714612 243
288 3300006871 Ga0075434_100026447 Ga0075434_1000264471 243
289 3300009148 Ga0105243_10014070 Ga0105243_1001407010 243
290 3300025912 Ga0207707_10322067 Ga0207707_103220672 243
291 3300044694 Ga0466963_0029776 Ga0466963_0029776_170_1105 243
292 3300044706 Ga0466964_0002060 Ga0466964_0002060_3950_4849 243
293 3300045976 Ga0466967_0065065 Ga0466967_0065065_296_1195 243
294 3300046517 Ga0495630_0452345 Ga0495630_0452345_22_924 243
295 3300048917 Ga0496114_0016227 Ga0496114_0016227_834_1685 243
296 3300049581 Ga0501047_0205971 Ga0501047_0205971_879_1727 243
297 3300049585 Ga0501069_0096157 Ga0501069_0096157_756_1604 243
298 3300049586 Ga0501070_0093793 Ga0501070_0093793_462_1310 243
299 3300049590 Ga0501074_0181043 Ga0501074_0181043_46_894 243
300 3300050512 nmdc:mga0n895_118964_c1 nmdc:mga0n895_118964_c1_164_1066 243
301 3300050513 nmdc:mga0rr50_35546_c1 nmdc:mga0rr50_35546_c1_2651_3553 243
302 3300005563 Ga0068855_100321453 Ga0068855_1003214532 244
303 3300009551 Ga0105238_10430288 Ga0105238_104302881 244
304 3300013105 Ga0157369_10023946 Ga0157369_100239467 244
305 3300020081 Ga0206354_10113154 Ga0206354_101131542 244
306 3300036401 Ga0373937_0027346 Ga0373937_0027346_650_1567 244
307 3300044694 Ga0466963_0030183 Ga0466963_0030183_356_1156 244
308 3300044842 Ga0466957_0068742 Ga0466957_0068742_672_1508 244
309 3300045976 Ga0466967_0067296 Ga0466967_0067296_13_1011 244
310 3300045976 Ga0466967_0106985 Ga0466967_0106985_870_1670 244
311 3300046454 Ga0495592_0000100 Ga0495592_0000100_56800_57717 244
312 3300046462 Ga0495651_0000008 Ga0495651_0000008_73932_74849 244
313 3300046463 Ga0495653_0000519 Ga0495653_0000519_15619_16536 244
314 3300046511 Ga0495608_0002853 Ga0495608_0002853_7101_8018 244
315 3300046516 Ga0495628_0001255 Ga0495628_0001255_14463_15380 244
316 3300046529 Ga0495652_0000888 Ga0495652_0000888_14463_15380 244
317 3300046536 Ga0495587_0000048 Ga0495587_0000048_85495_86412 244
318 3300046543 Ga0495645_0000029 Ga0495645_0000029_26708_27625 244
319 3300046679 Ga0495623_0000093 Ga0495623_0000093_18391_19308 244
320 3300046680 Ga0495646_0000416 Ga0495646_0000416_897_1814 244
321 3300047317 Ga0495604_0000111 Ga0495604_0000111_7623_8540 244
322 3300047444 Ga0495675_0000376 Ga0495675_0000376_11618_12535 244
323 3300048088 Ga0495602_0000141 Ga0495602_0000141_24182_25099 244
324 3300048912 Ga0496109_0020732 Ga0496109_0020732_3055_3834 244
325 3300049575 Ga0501039_0459661 Ga0501039_0459661_23_853 244
326 3300049587 Ga0501071_0016450 Ga0501071_0016450_3263_4096 244
327 3300049589 Ga0501073_0095791 Ga0501073_0095791_75_875 244
328 3300053077 Ga0495601_0000206 Ga0495601_0000206_25148_26065 244
329 3300053084 Ga0495595_0009320 Ga0495595_0009320_1325_2242 244
330 3300053085 Ga0495619_0000291 Ga0495619_0000291_23953_24870 244
331 3300034817 Ga0373948_0023117 Ga0373948_0023117_262_1179 245
332 3300037418 Ga0395900_0064679 Ga0395900_0064679_2219_3022 245
333 3300038443 Ga0395901_0200421 Ga0395901_0200421_851_1654 245
334 3300044684 Ga0466966_0006668 Ga0466966_0006668_1891_2727 245
335 3300044693 Ga0466961_0019558 Ga0466961_0019558_3147_3983 245
336 3300044706 Ga0466964_0000569 Ga0466964_0000569_373_1227 245
337 3300044735 Ga0466968_0070313 Ga0466968_0070313_444_1268 245
338 3300045049 Ga0466959_0222212 Ga0466959_0222212_132_968 245
339 3300045836 Ga0466958_0167002 Ga0466958_0167002_438_1274 245
340 3300045976 Ga0466967_0029411 Ga0466967_0029411_1188_2042 245
341 3300045976 Ga0466967_0229123 Ga0466967_0229123_943_1755 245
342 3300048908 Ga0496105_0041210 Ga0496105_0041210_2690_3607 245
343 3300048911 Ga0496108_0010155 Ga0496108_0010155_2161_3078 245
344 3300048914 Ga0496111_0006472 Ga0496111_0006472_2482_3399 245
345 3300049569 Ga0501032_0146739 Ga0501032_0146739_513_1406 245
346 3300049570 Ga0501033_0261399 Ga0501033_0261399_272_1165 245
347 3300049572 Ga0501036_0021549 Ga0501036_0021549_1256_2149 245
348 3300049574 Ga0501038_0118388 Ga0501038_0118388_509_1414 245
349 3300049575 Ga0501039_0096614 Ga0501039_0096614_465_1370 245
350 3300049582 Ga0501048_0007694 Ga0501048_0007694_117_908 245
351 3300049582 Ga0501048_0041582 Ga0501048_0041582_419_1312 245
352 3300049587 Ga0501071_0018342 Ga0501071_0018342_816_1709 245
353 3300049588 Ga0501072_0027586 Ga0501072_0027586_3333_4226 245
354 3300049590 Ga0501074_0017181 Ga0501074_0017181_1862_2755 245
355 3300049591 Ga0501075_0023568 Ga0501075_0023568_204_1109 245
356 3300049592 Ga0501076_0027481 Ga0501076_0027481_2886_3779 245
357 3300049593 Ga0501077_0062852 Ga0501077_0062852_665_1558 245
358 3300049741 Ga0501079_0022795 Ga0501079_0022795_3449_4342 245
359 3300049742 Ga0501080_0062426 Ga0501080_0062426_2512_3417 245
360 3300049743 Ga0501081_0005679 Ga0501081_0005679_4704_5597 245
361 3300049822 Ga0501035_0047953 Ga0501035_0047953_2847_3740 245
362 3300049824 Ga0501045_0023626 Ga0501045_0023626_3227_4120 245
363 3300054114 Ga0501084_0088815 Ga0501084_0088815_1378_2271 245
364 3300037471 Ga0395905_0345988 Ga0395905_0345988_323_1243 246
365 3300045976 Ga0466967_0143491 Ga0466967_0143491_279_1139 246
366 3300049584 Ga0501068_0089676 Ga0501068_0089676_272_1054 246
367 3300049585 Ga0501069_0008637 Ga0501069_0008637_2036_2833 246
368 3300005437 Ga0070710_10000589 Ga0070710_1000058917 247
369 3300005439 Ga0070711_100006227 Ga0070711_1000062277 247
370 3300006028 Ga0070717_10013735 Ga0070717_100137358 247
371 3300006175 Ga0070712_100006831 Ga0070712_1000068316 247
372 3300025898 Ga0207692_10001763 Ga0207692_100017636 247
373 3300025905 Ga0207685_10004476 Ga0207685_100044764 247
374 3300025906 Ga0207699_10007743 Ga0207699_100077436 247
375 3300025915 Ga0207693_10000662 Ga0207693_1000066213 247
376 3300025916 Ga0207663_10000565 Ga0207663_1000056516 247
377 3300025922 Ga0207646_10067589 Ga0207646_100675893 247
378 3300025928 Ga0207700_10003047 Ga0207700_100030477 247
379 3300025929 Ga0207664_10012742 Ga0207664_100127427 247
380 3300025945 Ga0207679_10166532 Ga0207679_101665322 247
381 3300035691 Ga0373931_0026749 Ga0373931_0026749_1485_2402 247
382 3300045976 Ga0466967_0013911 Ga0466967_0013911_4988_5776 247
383 3300048904 Ga0496101_0009494 Ga0496101_0009494_4437_5354 247
384 3300048905 Ga0496102_0010283 Ga0496102_0010283_2251_3168 247
385 3300048906 Ga0496103_0009066 Ga0496103_0009066_1227_2144 247
386 3300048907 Ga0496104_0025950 Ga0496104_0025950_2800_3717 247
387 3300048910 Ga0496107_0007244 Ga0496107_0007244_691_1608 247
388 3300048913 Ga0496110_0040694 Ga0496110_0040694_1954_2871 247
389 3300048917 Ga0496114_0001144 Ga0496114_0001144_10344_11261 247
390 3300048918 Ga0496115_0007850 Ga0496115_0007850_1842_2759 247
391 3300049575 Ga0501039_0334330 Ga0501039_0334330_33_836 247
392 3300049585 Ga0501069_0031777 Ga0501069_0031777_1217_2020 247
393 3300049587 Ga0501071_0045739 Ga0501071_0045739_678_1481 247
394 3300049591 Ga0501075_0012974 Ga0501075_0012974_2868_3671 247
395 3300049741 Ga0501079_0009101 Ga0501079_0009101_1197_2000 247
396 3300049742 Ga0501080_0002972 Ga0501080_0002972_69_872 247
397 3300060353 Ga0501082_0001301 Ga0501082_0001301_10054_10857 247
398 3300013100 Ga0157373_10159906 Ga0157373_101599062 248
399 3300020080 Ga0206350_11217372 Ga0206350_112173721 250
400 3300020082 Ga0206353_10208862 Ga0206353_102088622 250
401 3300037418 Ga0395900_0021884 Ga0395900_0021884_389_1249 250
402 3300037466 Ga0395898_0004411 Ga0395898_0004411_9590_10450 250
403 3300037471 Ga0395905_0200057 Ga0395905_0200057_282_1142 250
404 3300038443 Ga0395901_0009334 Ga0395901_0009334_3656_4516 250
405 3300044694 Ga0466963_0094301 Ga0466963_0094301_885_1721 250
406 3300046517 Ga0495630_0088673 Ga0495630_0088673_778_1737 250
407 3300048903 Ga0496100_0344989 Ga0496100_0344989_92_1057 250
408 3300048909 Ga0496106_0029182 Ga0496106_0029182_3045_4010 250
409 3300053085 Ga0495619_0033162 Ga0495619_0033162_1440_2399 250
410 3300000043 ARcpr5yngRDRAFT_c001838 ARcpr5yngRDRAFT_0018382 251
411 3300005457 Ga0070662_100132305 Ga0070662_1001323051 251
412 3300005578 Ga0068854_100217577 Ga0068854_1002175772 251
413 3300006058 Ga0075432_10000710 Ga0075432_1000071013 251
414 3300006844 Ga0075428_100001303 Ga0075428_10000130330 251
415 3300006847 Ga0075431_100226479 Ga0075431_1002264792 251
416 3300006880 Ga0075429_100012647 Ga0075429_1000126477 251
417 3300009094 Ga0111539_10003299 Ga0111539_1000329913 251
418 3300009098 Ga0105245_10005247 Ga0105245_100052478 251
419 3300009147 Ga0114129_10004297 Ga0114129_1000429712 251
420 3300025901 Ga0207688_10006630 Ga0207688_100066302 251
421 3300025912 Ga0207707_10110075 Ga0207707_101100753 251
422 3300025927 Ga0207687_10101329 Ga0207687_101013292 251
423 3300025933 Ga0207706_10012881 Ga0207706_100128812 251
424 3300025981 Ga0207640_10399987 Ga0207640_103999871 251
425 3300027907 Ga0207428_10000401 Ga0207428_1000040113 251
426 3300048904 Ga0496101_0363033 Ga0496101_0363033_114_1079 251
427 3300048918 Ga0496115_0278231 Ga0496115_0278231_158_1123 251
428 3300050507 nmdc:mga05p37_3733_c2 nmdc:mga05p37_3733_c2_5945_6745 251
429 3300050508 nmdc:mga09592_18299_c1 nmdc:mga09592_18299_c1_2073_2873 251
430 3300050511 nmdc:mga08y16_8488_c1 nmdc:mga08y16_8488_c1_4652_5452 251
431 3300050512 nmdc:mga0n895_287431_c1 nmdc:mga0n895_287431_c1_660_1460 251

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00318

Ribosomal_S2

Ribosomal protein S2

23

238

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8buu-assembly1.cif.gz_b are-abcf vmlr2 bound to a 70s ribosome 0.9812 1 219
7p7u-assembly1.cif.gz_c e. faecalis 70s ribosome with p-trna, state iv 0.9807 2 218
8syl-assembly1.cif.gz_b cryo-em structure of the escherichia coli 70s ribosome in complex with amikacin, mrna, and a-, p-, and e-site trnas 0.9717 1 220
5o61-assembly1.cif.gz_BV the complete structure of the mycobacterium smegmatis 70s ribosome 0.9696 1 220
7s1k-assembly1.cif.gz_D cfr-modified escherichia coli stalled ribosome with antibiotic radezolid 0.9695 8 219
ID Description Score Start End Superfamily
4toiA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9703 1 218 3.40.50.10490
5iwaB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9627 24 219 3.40.50.10490
4toiA02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.96 98 145 1.10.287.610
5mmjb02 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;Helix hairpin bin 0.9579 92 140 1.10.287.610
1i94B01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.9456 41 217 3.40.50.10490
ID Description Score Start End GO Terms
AF-A0A1F7FU96-F1-model_v4 Small ribosomal subunit protein uS2 (30S ribosomal protein S2) 0.9923 22 200 GO:0003735
GO:0006412
GO:0022627
AF-K1Z3T0-F1-model_v4 Small ribosomal subunit protein uS2 0.9866 1 219 GO:0003735
GO:0006412
GO:0022627
AF-A0A445BJ28-F1-model_v4 V-ATPase proteolipid subunit C-like domain-containing protein 0.9832 1 222 GO:0003735
GO:0006412
GO:0009579
GO:0015078
GO:0015935
GO:0015986
GO:0045263
AF-A0A1F7FU96-F1-model_v4 Small ribosomal subunit protein uS2 (30S ribosomal protein S2) 0.9814 22 200 GO:0003735
GO:0006412
GO:0022627
AF-B1VA80-F1-model_v4 Small ribosomal subunit protein uS2 (30S ribosomal protein S2) 0.9809 2 220 GO:0003735
GO:0006412
GO:0022627

Feature Viewer

pLDDT pTM Quality
85.72 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map