F442198
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 430 | 276 | 424 | 210 |
Family's Representative Sequence
| Representative Sequence | 3300042876|Ga0451577_0236698|Ga0451577_0236698_37_732 |
| Length | 231 |
| Sequence | MPDELGGRIALSTILDRHPGEGMRFTTTAFAELEAIPAEYAFGKIDPRTHVALSDNLNPDFFWSDAPVGTRSFALLCHDPDVPSKGDDVNQEGKIISANLPRVDFFHWVLIDLPSTMTKIACGEFSNGVTPRGKAGPQAAHFARQGINDYTGWFSGDKDMAGDYYGYDGPCPPWNDSLVHRYVFTLYALSVPKLAVEGTFNGADVRAAFQGKILAQASVTGRYTLNPSIKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 2 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 3 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 4 | 2739367655 | Pusillimonas sp. YR330 | Isolate | Unclassified |
| 5 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 6 | 2881927736 | Candidimonas sp. SYP-B2681 | Isolate | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 64 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 65 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 145 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 147 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 149 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 150 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 156 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 157 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 160 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 161 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 162 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 163 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 164 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 166 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 167 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 168 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 169 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 170 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 171 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 172 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 173 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 174 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 175 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 176 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 177 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 178 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 179 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 180 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 181 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 182 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 183 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 184 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 185 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 186 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 187 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 188 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 189 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 190 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 220 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 221 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 222 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 223 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 224 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 225 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 226 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 227 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 228 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 229 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 239 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 245 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 246 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 249 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 250 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 251 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 255 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 263 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 264 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 265 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 266 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 271 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 273 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 276 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.37 |
| Metatranscriptomes | 0.23 |
| Isolates | 1.4 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.79 |
| Nodule | 0 |
| Rhizoplane | 2.09 |
| Rhizosphere | 90.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070658_10089749 | 3300005327 | Bacteria | 2531 |
| 2 | Ga0070676_10041775 | 3300005328 | Bacteria | 2660 |
| 3 | Ga0070676_10188126 | 3300005328 | Bacteria | 1346 |
| 4 | Ga0070676_10403245 | 3300005328 | Bacteria | 952 |
| 5 | Ga0070683_100022468 | 3300005329 | Bacteria | 5637 |
| 6 | Ga0070690_100117565 | 3300005330 | Bacteria | 1781 |
| 7 | Ga0070670_100001197 | 3300005331 | Bacteria | 20604 |
| 8 | Ga0070670_100024701 | 3300005331 | Bacteria | 5168 |
| 9 | Ga0070670_100028265 | 3300005331 | Bacteria | 4826 |
| 10 | Ga0070677_10027242 | 3300005333 | Bacteria | 2150 |
| 11 | Ga0068869_100070855 | 3300005334 | Bacteria | 2580 |
| 12 | Ga0070680_100067876 | 3300005336 | Bacteria | 2926 |
| 13 | Ga0070682_100056869 | 3300005337 | Bacteria | 2462 |
| 14 | Ga0068868_100003049 | 3300005338 | Bacteria | 11661 |
| 15 | Ga0070660_100003515 | 3300005339 | Bacteria | 10799 |
| 16 | Ga0070689_100541829 | 3300005340 | Bacteria | 1002 |
| 17 | Ga0070687_100397196 | 3300005343 | Bacteria | 903 |
| 18 | Ga0070661_100002781 | 3300005344 | Bacteria | 12011 |
| 19 | Ga0070661_100003527 | 3300005344 | Bacteria | 10774 |
| 20 | Ga0070661_100024587 | 3300005344 | Bacteria | 4321 |
| 21 | Ga0070668_100001234 | 3300005347 | Bacteria | 18213 |
| 22 | Ga0070668_100134402 | 3300005347 | Bacteria | 1988 |
| 23 | Ga0070669_100073138 | 3300005353 | Bacteria | 2539 |
| 24 | Ga0070675_100015295 | 3300005354 | Bacteria | 6063 |
| 25 | Ga0070675_100015455 | 3300005354 | Bacteria | 6035 |
| 26 | Ga0070671_100000422 | 3300005355 | Bacteria | 29439 |
| 27 | Ga0070671_100071860 | 3300005355 | Bacteria | 2888 |
| 28 | Ga0070674_100130855 | 3300005356 | Bacteria | 1870 |
| 29 | Ga0070674_100168478 | 3300005356 | Bacteria | 1668 |
| 30 | Ga0070674_100179210 | 3300005356 | Bacteria | 1622 |
| 31 | Ga0070674_100513377 | 3300005356 | Bacteria | 1000 |
| 32 | Ga0070673_100000427 | 3300005364 | Bacteria | 22201 |
| 33 | Ga0070673_100007645 | 3300005364 | Bacteria | 7150 |
| 34 | Ga0070673_100015599 | 3300005364 | Bacteria | 5343 |
| 35 | Ga0070673_100176262 | 3300005364 | Bacteria | 1828 |
| 36 | Ga0070673_100290764 | 3300005364 | Bacteria | 1436 |
| 37 | Ga0070673_100375728 | 3300005364 | Bacteria | 1266 |
| 38 | Ga0070659_100000556 | 3300005366 | Bacteria | 27336 |
| 39 | Ga0070667_100267206 | 3300005367 | Bacteria | 1533 |
| 40 | Ga0070667_100735233 | 3300005367 | Bacteria | 914 |
| 41 | Ga0070703_10161282 | 3300005406 | Bacteria | 851 |
| 42 | Ga0070711_100270729 | 3300005439 | Bacteria | 1340 |
| 43 | Ga0070700_100158615 | 3300005441 | Bacteria | 1555 |
| 44 | Ga0070694_100436834 | 3300005444 | Bacteria | 1031 |
| 45 | Ga0070708_100081242 | 3300005445 | Bacteria | 2934 |
| 46 | Ga0070708_100089294 | 3300005445 | Bacteria | 2804 |
| 47 | Ga0070708_100595049 | 3300005445 | Bacteria | 1043 |
| 48 | Ga0070663_100384115 | 3300005455 | Bacteria | 1144 |
| 49 | Ga0070663_100481131 | 3300005455 | Bacteria | 1028 |
| 50 | Ga0070678_100003766 | 3300005456 | Bacteria | 8502 |
| 51 | Ga0070678_100452954 | 3300005456 | Bacteria | 1124 |
| 52 | Ga0070662_100068697 | 3300005457 | Bacteria | 2606 |
| 53 | Ga0070662_100118399 | 3300005457 | Bacteria | 2027 |
| 54 | Ga0070662_100265082 | 3300005457 | Bacteria | 1385 |
| 55 | Ga0070681_10056356 | 3300005458 | Bacteria | 3912 |
| 56 | Ga0068867_100000054 | 3300005459 | Bacteria | 69032 |
| 57 | Ga0068867_100057185 | 3300005459 | Bacteria | 2888 |
| 58 | Ga0068867_100190079 | 3300005459 | Bacteria | 1638 |
| 59 | Ga0068867_100469258 | 3300005459 | Bacteria | 1076 |
| 60 | Ga0070685_10241745 | 3300005466 | Bacteria | 1192 |
| 61 | Ga0070706_100155667 | 3300005467 | Bacteria | 2133 |
| 62 | Ga0070707_100152978 | 3300005468 | Bacteria | 2246 |
| 63 | Ga0070707_100266147 | 3300005468 | Bacteria | 1667 |
| 64 | Ga0070698_100200424 | 3300005471 | Bacteria | 1932 |
| 65 | Ga0070699_100087025 | 3300005518 | Bacteria | 2727 |
| 66 | Ga0070679_100007610 | 3300005530 | Bacteria | 10137 |
| 67 | Ga0070684_100140344 | 3300005535 | Bacteria | 2185 |
| 68 | Ga0070697_100392336 | 3300005536 | Bacteria | 1204 |
| 69 | Ga0068853_100077187 | 3300005539 | Bacteria | 2910 |
| 70 | Ga0068853_100368750 | 3300005539 | Bacteria | 1339 |
| 71 | Ga0070672_100000765 | 3300005543 | Bacteria | 19130 |
| 72 | Ga0070672_100001631 | 3300005543 | Bacteria | 13960 |
| 73 | Ga0070672_100162353 | 3300005543 | Bacteria | 1854 |
| 74 | Ga0070696_100491011 | 3300005546 | Bacteria | 975 |
| 75 | Ga0070693_100178896 | 3300005547 | Bacteria | 1364 |
| 76 | Ga0070665_100023334 | 3300005548 | Bacteria | 6228 |
| 77 | Ga0070665_100682628 | 3300005548 | Bacteria | 1040 |
| 78 | Ga0070664_100025475 | 3300005564 | Bacteria | 4903 |
| 79 | Ga0070664_100041908 | 3300005564 | Bacteria | 3864 |
| 80 | Ga0068857_100069980 | 3300005577 | Bacteria | 3125 |
| 81 | Ga0068854_100006612 | 3300005578 | Bacteria | 7385 |
| 82 | Ga0068856_100038070 | 3300005614 | Bacteria | 4720 |
| 83 | Ga0068856_101104366 | 3300005614 | Bacteria | 810 |
| 84 | Ga0068852_100000755 | 3300005616 | Bacteria | 21268 |
| 85 | Ga0068852_100056345 | 3300005616 | Bacteria | 3396 |
| 86 | Ga0068859_101780864 | 3300005617 | Bacteria | 680 |
| 87 | Ga0068864_100010763 | 3300005618 | Bacteria | 7560 |
| 88 | Ga0068866_10308286 | 3300005718 | Bacteria | 991 |
| 89 | Ga0068861_100050223 | 3300005719 | Bacteria | 3162 |
| 90 | Ga0068851_10039177 | 3300005834 | Bacteria | 2380 |
| 91 | Ga0068863_100003205 | 3300005841 | Bacteria | 16191 |
| 92 | Ga0068863_100591148 | 3300005841 | Bacteria | 1098 |
| 93 | Ga0068863_100861266 | 3300005841 | Bacteria | 905 |
| 94 | Ga0068860_100170043 | 3300005843 | Bacteria | 2105 |
| 95 | Ga0068860_100263626 | 3300005843 | Bacteria | 1680 |
| 96 | Ga0068862_100173512 | 3300005844 | Bacteria | 1931 |
| 97 | Ga0068862_100752509 | 3300005844 | Bacteria | 948 |
| 98 | Ga0068862_101237747 | 3300005844 | Bacteria | 746 |
| 99 | Ga0075364_10014384 | 3300006051 | Bacteria | 4889 |
| 100 | Ga0075364_10087154 | 3300006051 | Bacteria | 2069 |
| 101 | Ga0070716_100347085 | 3300006173 | Bacteria | 1049 |
| 102 | Ga0075369_10021563 | 3300006186 | Bacteria | 2649 |
| 103 | Ga0075366_10007340 | 3300006195 | Bacteria | 6081 |
| 104 | Ga0075366_10167667 | 3300006195 | Bacteria | 1332 |
| 105 | Ga0097621_100013262 | 3300006237 | Bacteria | 6135 |
| 106 | Ga0097621_100096169 | 3300006237 | Bacteria | 2485 |
| 107 | Ga0097621_100307829 | 3300006237 | Bacteria | 1401 |
| 108 | Ga0097621_100373640 | 3300006237 | Bacteria | 1272 |
| 109 | Ga0075370_10040634 | 3300006353 | Bacteria | 2624 |
| 110 | Ga0068871_100045967 | 3300006358 | Bacteria | 3515 |
| 111 | Ga0068871_100053811 | 3300006358 | Bacteria | 3264 |
| 112 | Ga0068871_100067804 | 3300006358 | Bacteria | 2928 |
| 113 | Ga0068871_100087526 | 3300006358 | Bacteria | 2590 |
| 114 | Ga0068871_100291717 | 3300006358 | Bacteria | 1430 |
| 115 | Ga0075428_100000298 | 3300006844 | Bacteria | 48579 |
| 116 | Ga0075433_10013686 | 3300006852 | Bacteria | 6606 |
| 117 | Ga0075434_100048453 | 3300006871 | Bacteria | 4216 |
| 118 | Ga0075434_100344801 | 3300006871 | Bacteria | 1511 |
| 119 | Ga0075429_100006177 | 3300006880 | Bacteria | 10353 |
| 120 | Ga0075429_100007054 | 3300006880 | Bacteria | 9756 |
| 121 | Ga0075436_100077975 | 3300006914 | Bacteria | 2295 |
| 122 | Ga0097620_101780990 | 3300006931 | Bacteria | 680 |
| 123 | Ga0075435_100334081 | 3300007076 | Bacteria | 1298 |
| 124 | Ga0105240_10014286 | 3300009093 | Bacteria | 10844 |
| 125 | Ga0105245_10066310 | 3300009098 | Bacteria | 3267 |
| 126 | Ga0105245_10071791 | 3300009098 | Bacteria | 3144 |
| 127 | Ga0105245_10660243 | 3300009098 | Bacteria | 1076 |
| 128 | Ga0105247_10316671 | 3300009101 | Bacteria | 1087 |
| 129 | Ga0114129_10179079 | 3300009147 | Bacteria | 2886 |
| 130 | Ga0114129_10405186 | 3300009147 | Bacteria | 1797 |
| 131 | Ga0105243_10086947 | 3300009148 | Bacteria | 2565 |
| 132 | Ga0105242_11380373 | 3300009176 | Bacteria | 731 |
| 133 | Ga0105248_11325858 | 3300009177 | Bacteria | 814 |
| 134 | Ga0105237_10494151 | 3300009545 | Bacteria | 1230 |
| 135 | Ga0105238_10457285 | 3300009551 | Bacteria | 1274 |
| 136 | Ga0157373_10007999 | 3300013100 | Bacteria | 7863 |
| 137 | Ga0157370_10005229 | 3300013104 | Bacteria | 14615 |
| 138 | Ga0157374_10178576 | 3300013296 | Bacteria | 2073 |
| 139 | Ga0157378_10057680 | 3300013297 | Bacteria | 3461 |
| 140 | Ga0163162_10056926 | 3300013306 | Bacteria | 3937 |
| 141 | Ga0163162_10590107 | 3300013306 | Bacteria | 1238 |
| 142 | Ga0157372_10027067 | 3300013307 | Bacteria | 6241 |
| 143 | Ga0157372_10834222 | 3300013307 | Bacteria | 1070 |
| 144 | Ga0157375_10169650 | 3300013308 | Bacteria | 2329 |
| 145 | Ga0157380_10017562 | 3300014326 | Bacteria | 5295 |
| 146 | Ga0157380_10040379 | 3300014326 | Bacteria | 3634 |
| 147 | Ga0157380_10077405 | 3300014326 | Bacteria | 2711 |
| 148 | Ga0157380_10382288 | 3300014326 | Bacteria | 1329 |
| 149 | Ga0157380_10393462 | 3300014326 | Bacteria | 1312 |
| 150 | Ga0157377_10000006 | 3300014745 | Bacteria | 419853 |
| 151 | Ga0157376_10007541 | 3300014969 | Bacteria | 7777 |
| 152 | Ga0157376_10041283 | 3300014969 | Bacteria | 3776 |
| 153 | Ga0157376_10223801 | 3300014969 | Bacteria | 1744 |
| 154 | Ga0163161_10059727 | 3300017792 | Bacteria | 2774 |
| 155 | Ga0163161_10230450 | 3300017792 | Bacteria | 1437 |
| 156 | Ga0163161_10806105 | 3300017792 | Bacteria | 789 |
| 157 | Ga0206352_10665777 | 3300020078 | Bacteria | 1618 |
| 158 | Ga0207697_10013356 | 3300025315 | Bacteria | 3427 |
| 159 | Ga0207656_10057046 | 3300025321 | Bacteria | 1703 |
| 160 | Ga0207680_10015805 | 3300025903 | Bacteria | 3948 |
| 161 | Ga0207684_10086908 | 3300025910 | Bacteria | 2663 |
| 162 | Ga0207684_10461529 | 3300025910 | Bacteria | 1090 |
| 163 | Ga0207684_10566591 | 3300025910 | Bacteria | 971 |
| 164 | Ga0207707_10014085 | 3300025912 | Bacteria | 6971 |
| 165 | Ga0207671_10294261 | 3300025914 | Bacteria | 1282 |
| 166 | Ga0207660_10133216 | 3300025917 | Bacteria | 1894 |
| 167 | Ga0207662_10397056 | 3300025918 | Bacteria | 934 |
| 168 | Ga0207657_10002601 | 3300025919 | Bacteria | 19533 |
| 169 | Ga0207649_10007895 | 3300025920 | Bacteria | 5791 |
| 170 | Ga0207652_10006748 | 3300025921 | Bacteria | 9253 |
| 171 | Ga0207646_10006539 | 3300025922 | Bacteria | 12030 |
| 172 | Ga0207681_10018473 | 3300025923 | Bacteria | 4392 |
| 173 | Ga0207681_10268942 | 3300025923 | Bacteria | 1337 |
| 174 | Ga0207681_10373910 | 3300025923 | Bacteria | 1146 |
| 175 | Ga0207681_10601556 | 3300025923 | Bacteria | 909 |
| 176 | Ga0207650_10028688 | 3300025925 | Bacteria | 3993 |
| 177 | Ga0207659_10005506 | 3300025926 | Bacteria | 7681 |
| 178 | Ga0207659_10007871 | 3300025926 | Bacteria | 6588 |
| 179 | Ga0207687_10063374 | 3300025927 | Bacteria | 2617 |
| 180 | Ga0207644_10000382 | 3300025931 | Bacteria | 28809 |
| 181 | Ga0207690_10002227 | 3300025932 | Bacteria | 11826 |
| 182 | Ga0207706_10073246 | 3300025933 | Bacteria | 3012 |
| 183 | Ga0207706_10129540 | 3300025933 | Bacteria | 2219 |
| 184 | Ga0207706_10277537 | 3300025933 | Bacteria | 1462 |
| 185 | Ga0207709_10001742 | 3300025935 | Bacteria | 14644 |
| 186 | Ga0207670_10079482 | 3300025936 | Bacteria | 2290 |
| 187 | Ga0207670_10319079 | 3300025936 | Bacteria | 1222 |
| 188 | Ga0207669_10051658 | 3300025937 | Bacteria | 2464 |
| 189 | Ga0207669_10065274 | 3300025937 | Bacteria | 2257 |
| 190 | Ga0207691_10001510 | 3300025940 | Bacteria | 23128 |
| 191 | Ga0207691_10008589 | 3300025940 | Bacteria | 9800 |
| 192 | Ga0207691_10019836 | 3300025940 | Bacteria | 6359 |
| 193 | Ga0207679_10001241 | 3300025945 | Bacteria | 16227 |
| 194 | Ga0207679_10005879 | 3300025945 | Bacteria | 7712 |
| 195 | Ga0207679_10568479 | 3300025945 | Bacteria | 1019 |
| 196 | Ga0207679_10792769 | 3300025945 | Bacteria | 863 |
| 197 | Ga0207651_10010878 | 3300025960 | Bacteria | 5064 |
| 198 | Ga0207651_10119921 | 3300025960 | Bacteria | 1993 |
| 199 | Ga0207651_10383470 | 3300025960 | Bacteria | 1192 |
| 200 | Ga0207651_10390138 | 3300025960 | Bacteria | 1182 |
| 201 | Ga0207712_10226879 | 3300025961 | Bacteria | 1497 |
| 202 | Ga0207668_10070956 | 3300025972 | Bacteria | 2486 |
| 203 | Ga0207668_10353871 | 3300025972 | Bacteria | 1229 |
| 204 | Ga0207640_10002049 | 3300025981 | Bacteria | 10896 |
| 205 | Ga0207640_10140526 | 3300025981 | Bacteria | 1759 |
| 206 | Ga0207677_10036288 | 3300026023 | Bacteria | 3211 |
| 207 | Ga0207677_10147226 | 3300026023 | Bacteria | 1812 |
| 208 | Ga0207639_10086464 | 3300026041 | Bacteria | 2496 |
| 209 | Ga0207639_10167632 | 3300026041 | Bacteria | 1857 |
| 210 | Ga0207678_10922524 | 3300026067 | Bacteria | 772 |
| 211 | Ga0207708_10081515 | 3300026075 | Bacteria | 2487 |
| 212 | Ga0207708_10693615 | 3300026075 | Bacteria | 870 |
| 213 | Ga0207702_10131876 | 3300026078 | Bacteria | 2249 |
| 214 | Ga0207641_10013568 | 3300026088 | Bacteria | 6683 |
| 215 | Ga0207641_10067809 | 3300026088 | Bacteria | 3058 |
| 216 | Ga0207641_10179722 | 3300026088 | Bacteria | 1937 |
| 217 | Ga0207648_10000254 | 3300026089 | Bacteria | 57696 |
| 218 | Ga0207648_10024396 | 3300026089 | Bacteria | 5398 |
| 219 | Ga0207648_10033096 | 3300026089 | Bacteria | 4560 |
| 220 | Ga0207648_10189055 | 3300026089 | Bacteria | 1824 |
| 221 | Ga0207648_10399221 | 3300026089 | Bacteria | 1246 |
| 222 | Ga0207676_10023822 | 3300026095 | Bacteria | 4523 |
| 223 | Ga0207676_10053113 | 3300026095 | Bacteria | 3171 |
| 224 | Ga0207674_10342361 | 3300026116 | Bacteria | 1446 |
| 225 | Ga0207675_100069392 | 3300026118 | Bacteria | 3294 |
| 226 | Ga0207675_100870113 | 3300026118 | Bacteria | 917 |
| 227 | Ga0207683_10000350 | 3300026121 | Bacteria | 42128 |
| 228 | Ga0207683_10404439 | 3300026121 | Bacteria | 1256 |
| 229 | Ga0207698_10007084 | 3300026142 | Bacteria | 7022 |
| 230 | Ga0207698_10044898 | 3300026142 | Bacteria | 3324 |
| 231 | Ga0209371_1014048 | 3300027312 | Bacteria | 2213 |
| 232 | Ga0207428_10006015 | 3300027907 | Bacteria | 11227 |
| 233 | Ga0207428_10438530 | 3300027907 | Bacteria | 953 |
| 234 | Ga0268265_10154031 | 3300028380 | Bacteria | 1942 |
| 235 | Ga0268265_11037789 | 3300028380 | Bacteria | 811 |
| 236 | Ga0268264_10020106 | 3300028381 | Bacteria | 5455 |
| 237 | Ga0265318_10001243 | 3300028577 | Bacteria | 15473 |
| 238 | Ga0265330_10018387 | 3300031235 | Bacteria | 3210 |
| 239 | Ga0265332_10005370 | 3300031238 | Bacteria | 5914 |
| 240 | Ga0265332_10127837 | 3300031238 | Bacteria | 1066 |
| 241 | Ga0265328_10006395 | 3300031239 | Bacteria | 4992 |
| 242 | Ga0265320_10153056 | 3300031240 | Bacteria | 1041 |
| 243 | Ga0265329_10003340 | 3300031242 | Bacteria | 7020 |
| 244 | Ga0265339_10038328 | 3300031249 | Bacteria | 2675 |
| 245 | Ga0265331_10000487 | 3300031250 | Bacteria | 37832 |
| 246 | Ga0265331_10000887 | 3300031250 | Bacteria | 24296 |
| 247 | Ga0265327_10018554 | 3300031251 | Bacteria | 4308 |
| 248 | Ga0265316_10011844 | 3300031344 | Bacteria | 7843 |
| 249 | Ga0265316_10012941 | 3300031344 | Bacteria | 7447 |
| 250 | Ga0265314_10034544 | 3300031711 | Bacteria | 3695 |
| 251 | Ga0265342_10137274 | 3300031712 | Bacteria | 1366 |
| 252 | Ga0316578_10262032 | 3300031728 | Bacteria | 1036 |
| 253 | Ga0307516_10001028 | 3300031730 | Bacteria | 38713 |
| 254 | Ga0307405_10115414 | 3300031731 | Bacteria | 1827 |
| 255 | Ga0307410_10504613 | 3300031852 | Bacteria | 996 |
| 256 | Ga0307412_10322335 | 3300031911 | Bacteria | 1230 |
| 257 | Ga0307416_100507409 | 3300032002 | Bacteria | 1272 |
| 258 | Ga0307416_101145232 | 3300032002 | Bacteria | 883 |
| 259 | Ga0373957_0166510 | 3300035120 | Bacteria | 910 |
| 260 | Ga0316574_0314702 | 3300035398 | Bacteria | 994 |
| 261 | Ga0373924_0007823 | 3300035410 | Bacteria | 3865 |
| 262 | Ga0373927_0006064 | 3300035695 | Bacteria | 8280 |
| 263 | Ga0373937_0076404 | 3300036401 | Bacteria | 3093 |
| 264 | Ga0373937_0319468 | 3300036401 | Bacteria | 1469 |
| 265 | Ga0373925_0259648 | 3300037068 | Bacteria | 1395 |
| 266 | Ga0395899_0131036 | 3300037312 | Bacteria | 1790 |
| 267 | Ga0395905_0005907 | 3300037471 | Bacteria | 12410 |
| 268 | Ga0395905_0018689 | 3300037471 | Bacteria | 6574 |
| 269 | Ga0395901_0002767 | 3300038443 | Bacteria | 17671 |
| 270 | Ga0395901_0096796 | 3300038443 | Bacteria | 3093 |
| 271 | Ga0395901_0616879 | 3300038443 | Bacteria | 1092 |
| 272 | Ga0451841_1014916 | 3300041498 | Bacteria | 1179 |
| 273 | Ga0451845_0529383 | 3300041501 | Bacteria | 684 |
| 274 | Ga0451843_1697151 | 3300041509 | Bacteria | 935 |
| 275 | Ga0451853_1683080 | 3300041512 | Bacteria | 3493 |
| 276 | Ga0439441_001925 | 3300042001 | Bacteria | 2842 |
| 277 | Ga0439455_0012859 | 3300042012 | Bacteria | 1886 |
| 278 | Ga0439458_0067789 | 3300042157 | Bacteria | 898 |
| 279 | Ga0439435_0058698 | 3300042436 | Bacteria | 1117 |
| 280 | Ga0451577_0214601 | 3300042876 | Bacteria | 1739 |
| 281 | Ga0451577_0236698 | 3300042876 | Bacteria | 1652 |
| 282 | Ga0466969_0053778 | 3300044656 | Bacteria | 1974 |
| 283 | Ga0466972_0000224 | 3300044658 | Bacteria | 39867 |
| 284 | Ga0466972_0000934 | 3300044658 | Bacteria | 14050 |
| 285 | Ga0466972_0010208 | 3300044658 | Bacteria | 4717 |
| 286 | Ga0466972_0176113 | 3300044658 | Bacteria | 1003 |
| 287 | Ga0466965_0000404 | 3300044683 | Bacteria | 14818 |
| 288 | Ga0466965_0056283 | 3300044683 | Bacteria | 1958 |
| 289 | Ga0466966_0031683 | 3300044684 | Bacteria | 3428 |
| 290 | Ga0466966_0196049 | 3300044684 | Bacteria | 1223 |
| 291 | Ga0466961_0055885 | 3300044693 | Bacteria | 2515 |
| 292 | Ga0466961_0191714 | 3300044693 | Bacteria | 1267 |
| 293 | Ga0466964_0143158 | 3300044706 | Bacteria | 1101 |
| 294 | Ga0466964_0337464 | 3300044706 | Bacteria | 771 |
| 295 | Ga0453684_0009638 | 3300044712 | Bacteria | 16833 |
| 296 | Ga0453684_0965925 | 3300044712 | Bacteria | 908 |
| 297 | Ga0466971_0039799 | 3300044719 | Bacteria | 2110 |
| 298 | Ga0466971_0059533 | 3300044719 | Bacteria | 1725 |
| 299 | Ga0466968_0009095 | 3300044735 | Bacteria | 3819 |
| 300 | Ga0466968_0095284 | 3300044735 | Bacteria | 1324 |
| 301 | Ga0466968_0303432 | 3300044735 | Unclassified | 768 |
| 302 | Ga0466970_0013917 | 3300044765 | Bacteria | 4127 |
| 303 | Ga0466957_0062750 | 3300044842 | Bacteria | 2283 |
| 304 | Ga0466959_0006284 | 3300045049 | Bacteria | 8210 |
| 305 | Ga0466959_0055489 | 3300045049 | Bacteria | 2892 |
| 306 | Ga0466959_0124050 | 3300045049 | Bacteria | 1834 |
| 307 | Ga0451576_0016983 | 3300045051 | Bacteria | 8015 |
| 308 | Ga0451576_0107975 | 3300045051 | Bacteria | 2896 |
| 309 | Ga0451576_0151692 | 3300045051 | Bacteria | 2417 |
| 310 | Ga0451576_0560842 | 3300045051 | Bacteria | 1200 |
| 311 | Ga0451576_0746265 | 3300045051 | Bacteria | 1028 |
| 312 | Ga0495590_0015261 | 3300046457 | Bacteria | 2790 |
| 313 | Ga0495651_0024322 | 3300046462 | Bacteria | 4713 |
| 314 | Ga0495580_0210484 | 3300046472 | Bacteria | 1338 |
| 315 | Ga0495584_0002636 | 3300046491 | Bacteria | 10111 |
| 316 | Ga0495607_0005877 | 3300046501 | Bacteria | 8715 |
| 317 | Ga0495616_0021199 | 3300046513 | Bacteria | 3522 |
| 318 | Ga0495642_0012878 | 3300046528 | Bacteria | 3228 |
| 319 | Ga0495609_0000173 | 3300046538 | Bacteria | 66125 |
| 320 | Ga0495621_0036989 | 3300046539 | Bacteria | 1696 |
| 321 | Ga0495621_0220758 | 3300046539 | Bacteria | 767 |
| 322 | Ga0495668_0007994 | 3300046616 | Bacteria | 6665 |
| 323 | Ga0495625_0000578 | 3300046660 | Bacteria | 53326 |
| 324 | Ga0495659_0029550 | 3300046664 | Bacteria | 1903 |
| 325 | Ga0495661_0024112 | 3300046665 | Bacteria | 3940 |
| 326 | Ga0495658_0729382 | 3300046683 | Bacteria | 635 |
| 327 | Ga0495669_0000485 | 3300046684 | Bacteria | 18399 |
| 328 | Ga0495670_0245725 | 3300046691 | Bacteria | 953 |
| 329 | Ga0495660_0024465 | 3300046810 | Bacteria | 3439 |
| 330 | Ga0495636_0132203 | 3300047318 | Bacteria | 1110 |
| 331 | Ga0495687_016027 | 3300047443 | Bacteria | 3783 |
| 332 | Ga0495677_0020134 | 3300047445 | Bacteria | 2418 |
| 333 | Ga0495681_0038189 | 3300047470 | Bacteria | 2356 |
| 334 | Ga0496100_0492336 | 3300048903 | Bacteria | 944 |
| 335 | Ga0496101_0121980 | 3300048904 | Bacteria | 1971 |
| 336 | Ga0496105_0165166 | 3300048908 | Bacteria | 1816 |
| 337 | Ga0496108_0043681 | 3300048911 | Bacteria | 3743 |
| 338 | Ga0496109_0020414 | 3300048912 | Bacteria | 5852 |
| 339 | Ga0496109_0404310 | 3300048912 | Bacteria | 1290 |
| 340 | Ga0496110_0005024 | 3300048913 | Bacteria | 10333 |
| 341 | Ga0496111_0044908 | 3300048914 | Bacteria | 3177 |
| 342 | Ga0496114_0025747 | 3300048917 | Bacteria | 4811 |
| 343 | Ga0496116_0051360 | 3300048919 | Bacteria | 2739 |
| 344 | Ga0496116_0094788 | 3300048919 | Bacteria | 1803 |
| 345 | Ga0496118_0065843 | 3300048921 | Bacteria | 2648 |
| 346 | Ga0496121_0215435 | 3300048924 | Bacteria | 1357 |
| 347 | Ga0496122_0001693 | 3300048925 | Bacteria | 34184 |
| 348 | Ga0496123_0006735 | 3300048926 | Bacteria | 11052 |
| 349 | Ga0496124_0046812 | 3300048927 | Bacteria | 3702 |
| 350 | Ga0496126_0192324 | 3300048929 | Bacteria | 1727 |
| 351 | Ga0501031_0000300 | 3300049568 | Bacteria | 28253 |
| 352 | Ga0501031_0046281 | 3300049568 | Bacteria | 2837 |
| 353 | Ga0501031_0198212 | 3300049568 | Bacteria | 1310 |
| 354 | Ga0501032_0004122 | 3300049569 | Bacteria | 11011 |
| 355 | Ga0501033_0023748 | 3300049570 | Bacteria | 4625 |
| 356 | Ga0501033_0028471 | 3300049570 | Bacteria | 4197 |
| 357 | Ga0501034_0048437 | 3300049571 | Bacteria | 4288 |
| 358 | Ga0501034_0090052 | 3300049571 | Bacteria | 3066 |
| 359 | Ga0501034_0425886 | 3300049571 | Bacteria | 1248 |
| 360 | Ga0501034_0452302 | 3300049571 | Bacteria | 1202 |
| 361 | Ga0501036_0000045 | 3300049572 | Bacteria | 78277 |
| 362 | Ga0501036_0104316 | 3300049572 | Unclassified | 2397 |
| 363 | Ga0501037_0011714 | 3300049573 | Bacteria | 6456 |
| 364 | Ga0501038_0007503 | 3300049574 | Bacteria | 10056 |
| 365 | Ga0501038_0012626 | 3300049574 | Bacteria | 7721 |
| 366 | Ga0501040_0003260 | 3300049576 | Bacteria | 10481 |
| 367 | Ga0501041_0003596 | 3300049577 | Bacteria | 8913 |
| 368 | Ga0501042_0000826 | 3300049578 | Bacteria | 17189 |
| 369 | Ga0501043_0001245 | 3300049579 | Bacteria | 22460 |
| 370 | Ga0501043_0009921 | 3300049579 | Bacteria | 7466 |
| 371 | Ga0501046_0000365 | 3300049580 | Bacteria | 45681 |
| 372 | Ga0501046_0012013 | 3300049580 | Bacteria | 7387 |
| 373 | Ga0501047_0004943 | 3300049581 | Bacteria | 12515 |
| 374 | Ga0501047_0099378 | 3300049581 | Bacteria | 2789 |
| 375 | Ga0501047_0517371 | 3300049581 | Bacteria | 1019 |
| 376 | Ga0501048_0012751 | 3300049582 | Bacteria | 6250 |
| 377 | Ga0501067_0002335 | 3300049583 | Bacteria | 10494 |
| 378 | Ga0501068_0022319 | 3300049584 | Bacteria | 3700 |
| 379 | Ga0501068_0134417 | 3300049584 | Bacteria | 1548 |
| 380 | Ga0501069_0004591 | 3300049585 | Bacteria | 7144 |
| 381 | Ga0501069_0212924 | 3300049585 | Bacteria | 1122 |
| 382 | Ga0501070_0058851 | 3300049586 | Bacteria | 3185 |
| 383 | Ga0501071_0054252 | 3300049587 | Bacteria | 2892 |
| 384 | Ga0501072_0002297 | 3300049588 | Bacteria | 14312 |
| 385 | Ga0501072_0032042 | 3300049588 | Bacteria | 4115 |
| 386 | Ga0501073_0013771 | 3300049589 | Bacteria | 5883 |
| 387 | Ga0501073_0057671 | 3300049589 | Bacteria | 2714 |
| 388 | Ga0501074_0003029 | 3300049590 | Bacteria | 11837 |
| 389 | Ga0501074_0036719 | 3300049590 | Bacteria | 3549 |
| 390 | Ga0501075_0025702 | 3300049591 | Bacteria | 4326 |
| 391 | Ga0501076_0000658 | 3300049592 | Bacteria | 22170 |
| 392 | Ga0501077_0004182 | 3300049593 | Bacteria | 8719 |
| 393 | Ga0501222_000031 | 3300049662 | Bacteria | 56867 |
| 394 | Ga0501079_0170769 | 3300049741 | Unclassified | 1695 |
| 395 | Ga0501080_0001038 | 3300049742 | Bacteria | 22821 |
| 396 | Ga0501081_0004260 | 3300049743 | Bacteria | 9169 |
| 397 | Ga0501083_0003306 | 3300049744 | Bacteria | 11263 |
| 398 | Ga0501083_0025898 | 3300049744 | Bacteria | 4059 |
| 399 | Ga0501083_0078328 | 3300049744 | Bacteria | 2193 |
| 400 | Ga0501035_0001790 | 3300049822 | Bacteria | 21713 |
| 401 | Ga0501035_0085686 | 3300049822 | Bacteria | 2776 |
| 402 | Ga0501035_0124716 | 3300049822 | Bacteria | 2249 |
| 403 | Ga0501044_0001026 | 3300049823 | Bacteria | 33660 |
| 404 | Ga0501045_0000070 | 3300049824 | Bacteria | 47689 |
| 405 | nmdc:mga00v17_116085_c1 | 3300050491 | Bacteria | 1701 |
| 406 | nmdc:mga00v17_48106_c1 | 3300050491 | Bacteria | 2584 |
| 407 | nmdc:mga07m45_121250_c1 | 3300050496 | Bacteria | 1510 |
| 408 | nmdc:mga07m45_31539_c1 | 3300050496 | Bacteria | 2937 |
| 409 | nmdc:mga09592_1109_c1 | 3300050508 | Bacteria | 21409 |
| 410 | nmdc:mga0qj67_199487_c1 | 3300050509 | Bacteria | 1626 |
| 411 | nmdc:mga08y16_1286_c1 | 3300050511 | Bacteria | 24919 |
| 412 | nmdc:mga08y16_1295629_c1 | 3300050511 | Bacteria | 695 |
| 413 | nmdc:mga08y16_289077_c1 | 3300050511 | Bacteria | 1690 |
| 414 | nmdc:mga08y16_822309_c1 | 3300050511 | Bacteria | 920 |
| 415 | nmdc:mga0n895_47201_c1 | 3300050512 | Bacteria | 4210 |
| 416 | nmdc:mga0rr50_352017_c1 | 3300050513 | Bacteria | 1239 |
| 417 | nmdc:mga0a205_155658_c1 | 3300050515 | Bacteria | 2184 |
| 418 | nmdc:mga0sz30_35084_c1 | 3300050516 | Bacteria | 2091 |
| 419 | Ga0495619_0419393 | 3300053085 | Bacteria | 923 |
| 420 | Ga0500641_0007896 | 3300053096 | Bacteria | 3795 |
| 421 | Ga0501084_0001240 | 3300054114 | Bacteria | 20084 |
| 422 | Ga0501082_0118810 | 3300060353 | Bacteria | 2290 |
| 423 | Ga0466962_0260025 | 3300061719 | Bacteria | 854 |
| 424 | Ga0530510_0003829 | 3300061734 | Bacteria | 10370 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005337 | Ga0070682_100056869 | Ga0070682_1000568693 | 185 |
| 2 | 3300006871 | Ga0075434_100344801 | Ga0075434_1003448012 | 186 |
| 3 | 3300044658 | Ga0466972_0176113 | Ga0466972_0176113_399_974 | 187 |
| 4 | 3300046462 | Ga0495651_0024322 | Ga0495651_0024322_2161_2724 | 187 |
| 5 | 3300053085 | Ga0495619_0419393 | Ga0495619_0419393_43_606 | 187 |
| 6 | 3300046683 | Ga0495658_0729382 | Ga0495658_0729382_18_608 | 196 |
| 7 | 3300046539 | Ga0495621_0036989 | Ga0495621_0036989_420_1046 | 197 |
| 8 | 3300005445 | Ga0070708_100595049 | Ga0070708_1005950491 | 200 |
| 9 | 3300005468 | Ga0070707_100266147 | Ga0070707_1002661471 | 200 |
| 10 | 3300025910 | Ga0207684_10461529 | Ga0207684_104615292 | 200 |
| 11 | 3300031728 | Ga0316578_10262032 | Ga0316578_102620322 | 200 |
| 12 | 3300028577 | Ga0265318_10001243 | Ga0265318_1000124317 | 203 |
| 13 | 3300031238 | Ga0265332_10127837 | Ga0265332_101278372 | 203 |
| 14 | 3300031239 | Ga0265328_10006395 | Ga0265328_100063956 | 203 |
| 15 | 3300031240 | Ga0265320_10153056 | Ga0265320_101530561 | 203 |
| 16 | 3300031250 | Ga0265331_10000887 | Ga0265331_100008872 | 203 |
| 17 | 3300031344 | Ga0265316_10011844 | Ga0265316_100118441 | 203 |
| 18 | 3300031711 | Ga0265314_10034544 | Ga0265314_100345442 | 203 |
| 19 | 3300046491 | Ga0495584_0002636 | Ga0495584_0002636_7112_7744 | 204 |
| 20 | 3300046501 | Ga0495607_0005877 | Ga0495607_0005877_749_1381 | 204 |
| 21 | 3300046513 | Ga0495616_0021199 | Ga0495616_0021199_2596_3216 | 204 |
| 22 | 3300046528 | Ga0495642_0012878 | Ga0495642_0012878_1147_1779 | 204 |
| 23 | 3300046538 | Ga0495609_0000173 | Ga0495609_0000173_43239_43871 | 204 |
| 24 | 3300046616 | Ga0495668_0007994 | Ga0495668_0007994_4719_5351 | 204 |
| 25 | 3300046660 | Ga0495625_0000578 | Ga0495625_0000578_22651_23283 | 204 |
| 26 | 3300046664 | Ga0495659_0029550 | Ga0495659_0029550_1113_1733 | 204 |
| 27 | 3300046665 | Ga0495661_0024112 | Ga0495661_0024112_3258_3890 | 204 |
| 28 | 3300046684 | Ga0495669_0000485 | Ga0495669_0000485_14870_15502 | 204 |
| 29 | 3300046810 | Ga0495660_0024465 | Ga0495660_0024465_681_1313 | 204 |
| 30 | 3300047318 | Ga0495636_0132203 | Ga0495636_0132203_239_871 | 204 |
| 31 | 3300047443 | Ga0495687_016027 | Ga0495687_016027_2298_2918 | 204 |
| 32 | 3300047445 | Ga0495677_0020134 | Ga0495677_0020134_1504_2136 | 204 |
| 33 | 3300047470 | Ga0495681_0038189 | Ga0495681_0038189_1214_1846 | 204 |
| 34 | iso_pu_bacteria | 2643221569 | 2643861151 | 205 |
| 35 | iso_pu_bacteria | 2643221594 | 2643983386 | 205 |
| 36 | iso_pu_bacteria | 2643221621 | 2644124500 | 205 |
| 37 | iso_pu_bacteria | 2739367655 | 2739610584 | 205 |
| 38 | iso_pu_bacteria | 2808606395 | 2809032696 | 205 |
| 39 | iso_pu_bacteria | 2881927736 | 2881931231 | 205 |
| 40 | 3300036401 | Ga0373937_0319468 | Ga0373937_0319468_232_852 | 206 |
| 41 | 3300041498 | Ga0451841_1014916 | Ga0451841_1014916_67_687 | 206 |
| 42 | 3300049590 | Ga0501074_0036719 | Ga0501074_0036719_2273_2893 | 206 |
| 43 | 3300035398 | Ga0316574_0314702 | Ga0316574_0314702_207_830 | 207 |
| 44 | 3300050496 | nmdc:mga07m45_121250_c1 | nmdc:mga07m45_121250_c1_324_947 | 207 |
| 45 | 3300005336 | Ga0070680_100067876 | Ga0070680_1000678763 | 208 |
| 46 | 3300005344 | Ga0070661_100002781 | Ga0070661_1000027819 | 208 |
| 47 | 3300005364 | Ga0070673_100375728 | Ga0070673_1003757282 | 208 |
| 48 | 3300005458 | Ga0070681_10056356 | Ga0070681_100563562 | 208 |
| 49 | 3300005530 | Ga0070679_100007610 | Ga0070679_1000076107 | 208 |
| 50 | 3300005539 | Ga0068853_100077187 | Ga0068853_1000771872 | 208 |
| 51 | 3300006195 | Ga0075366_10167667 | Ga0075366_101676673 | 208 |
| 52 | 3300013100 | Ga0157373_10007999 | Ga0157373_100079995 | 208 |
| 53 | 3300013104 | Ga0157370_10005229 | Ga0157370_100052296 | 208 |
| 54 | 3300013307 | Ga0157372_10027067 | Ga0157372_100270672 | 208 |
| 55 | 3300025912 | Ga0207707_10014085 | Ga0207707_100140852 | 208 |
| 56 | 3300025917 | Ga0207660_10133216 | Ga0207660_101332162 | 208 |
| 57 | 3300025920 | Ga0207649_10007895 | Ga0207649_100078956 | 208 |
| 58 | 3300025921 | Ga0207652_10006748 | Ga0207652_100067487 | 208 |
| 59 | 3300025960 | Ga0207651_10390138 | Ga0207651_103901382 | 208 |
| 60 | 3300026041 | Ga0207639_10086464 | Ga0207639_100864642 | 208 |
| 61 | 3300031730 | Ga0307516_10001028 | Ga0307516_1000102839 | 208 |
| 62 | 3300036401 | Ga0373937_0076404 | Ga0373937_0076404_1655_2281 | 208 |
| 63 | 3300037471 | Ga0395905_0005907 | Ga0395905_0005907_5139_5771 | 208 |
| 64 | 3300042012 | Ga0439455_0012859 | Ga0439455_0012859_817_1455 | 208 |
| 65 | 3300042157 | Ga0439458_0067789 | Ga0439458_0067789_50_688 | 208 |
| 66 | 3300044683 | Ga0466965_0056283 | Ga0466965_0056283_124_750 | 208 |
| 67 | 3300044693 | Ga0466961_0055885 | Ga0466961_0055885_221_847 | 208 |
| 68 | 3300044719 | Ga0466971_0039799 | Ga0466971_0039799_14_640 | 208 |
| 69 | 3300044735 | Ga0466968_0095284 | Ga0466968_0095284_66_692 | 208 |
| 70 | 3300044842 | Ga0466957_0062750 | Ga0466957_0062750_1556_2182 | 208 |
| 71 | 3300045049 | Ga0466959_0055489 | Ga0466959_0055489_1573_2199 | 208 |
| 72 | 3300045051 | Ga0451576_0151692 | Ga0451576_0151692_180_806 | 208 |
| 73 | 3300045051 | Ga0451576_0746265 | Ga0451576_0746265_367_993 | 208 |
| 74 | 3300046457 | Ga0495590_0015261 | Ga0495590_0015261_97_729 | 208 |
| 75 | 3300049571 | Ga0501034_0090052 | Ga0501034_0090052_1145_1771 | 208 |
| 76 | 3300049581 | Ga0501047_0517371 | Ga0501047_0517371_380_1006 | 208 |
| 77 | 3300049583 | Ga0501067_0002335 | Ga0501067_0002335_5935_6561 | 208 |
| 78 | 3300049584 | Ga0501068_0134417 | Ga0501068_0134417_565_1191 | 208 |
| 79 | 3300049585 | Ga0501069_0212924 | Ga0501069_0212924_256_882 | 208 |
| 80 | 3300049586 | Ga0501070_0058851 | Ga0501070_0058851_729_1355 | 208 |
| 81 | 3300049588 | Ga0501072_0032042 | Ga0501072_0032042_3099_3725 | 208 |
| 82 | 3300049589 | Ga0501073_0057671 | Ga0501073_0057671_338_964 | 208 |
| 83 | 3300049742 | Ga0501080_0001038 | Ga0501080_0001038_15979_16605 | 208 |
| 84 | 3300049744 | Ga0501083_0003306 | Ga0501083_0003306_8967_9593 | 208 |
| 85 | 3300049744 | Ga0501083_0078328 | Ga0501083_0078328_259_885 | 208 |
| 86 | 3300049822 | Ga0501035_0124716 | Ga0501035_0124716_521_1147 | 208 |
| 87 | 3300005327 | Ga0070658_10089749 | Ga0070658_100897494 | 209 |
| 88 | 3300005328 | Ga0070676_10041775 | Ga0070676_100417754 | 209 |
| 89 | 3300005328 | Ga0070676_10188126 | Ga0070676_101881263 | 209 |
| 90 | 3300005328 | Ga0070676_10403245 | Ga0070676_104032452 | 209 |
| 91 | 3300005329 | Ga0070683_100022468 | Ga0070683_1000224684 | 209 |
| 92 | 3300005330 | Ga0070690_100117565 | Ga0070690_1001175652 | 209 |
| 93 | 3300005331 | Ga0070670_100001197 | Ga0070670_10000119718 | 209 |
| 94 | 3300005331 | Ga0070670_100024701 | Ga0070670_1000247014 | 209 |
| 95 | 3300005331 | Ga0070670_100028265 | Ga0070670_1000282655 | 209 |
| 96 | 3300005333 | Ga0070677_10027242 | Ga0070677_100272422 | 209 |
| 97 | 3300005334 | Ga0068869_100070855 | Ga0068869_1000708554 | 209 |
| 98 | 3300005338 | Ga0068868_100003049 | Ga0068868_10000304912 | 209 |
| 99 | 3300005339 | Ga0070660_100003515 | Ga0070660_10000351512 | 209 |
| 100 | 3300005340 | Ga0070689_100541829 | Ga0070689_1005418292 | 209 |
| 101 | 3300005343 | Ga0070687_100397196 | Ga0070687_1003971962 | 209 |
| 102 | 3300005344 | Ga0070661_100003527 | Ga0070661_1000035275 | 209 |
| 103 | 3300005344 | Ga0070661_100024587 | Ga0070661_1000245874 | 209 |
| 104 | 3300005347 | Ga0070668_100001234 | Ga0070668_10000123414 | 209 |
| 105 | 3300005347 | Ga0070668_100134402 | Ga0070668_1001344022 | 209 |
| 106 | 3300005353 | Ga0070669_100073138 | Ga0070669_1000731383 | 209 |
| 107 | 3300005354 | Ga0070675_100015295 | Ga0070675_1000152955 | 209 |
| 108 | 3300005354 | Ga0070675_100015455 | Ga0070675_1000154555 | 209 |
| 109 | 3300005355 | Ga0070671_100000422 | Ga0070671_1000004227 | 209 |
| 110 | 3300005355 | Ga0070671_100071860 | Ga0070671_1000718602 | 209 |
| 111 | 3300005356 | Ga0070674_100130855 | Ga0070674_1001308552 | 209 |
| 112 | 3300005356 | Ga0070674_100168478 | Ga0070674_1001684782 | 209 |
| 113 | 3300005356 | Ga0070674_100179210 | Ga0070674_1001792102 | 209 |
| 114 | 3300005356 | Ga0070674_100513377 | Ga0070674_1005133772 | 209 |
| 115 | 3300005364 | Ga0070673_100000427 | Ga0070673_10000042713 | 209 |
| 116 | 3300005364 | Ga0070673_100007645 | Ga0070673_1000076455 | 209 |
| 117 | 3300005364 | Ga0070673_100015599 | Ga0070673_1000155993 | 209 |
| 118 | 3300005364 | Ga0070673_100176262 | Ga0070673_1001762623 | 209 |
| 119 | 3300005364 | Ga0070673_100290764 | Ga0070673_1002907642 | 209 |
| 120 | 3300005366 | Ga0070659_100000556 | Ga0070659_10000055622 | 209 |
| 121 | 3300005367 | Ga0070667_100267206 | Ga0070667_1002672062 | 209 |
| 122 | 3300005367 | Ga0070667_100735233 | Ga0070667_1007352331 | 209 |
| 123 | 3300005406 | Ga0070703_10161282 | Ga0070703_101612822 | 209 |
| 124 | 3300005439 | Ga0070711_100270729 | Ga0070711_1002707292 | 209 |
| 125 | 3300005441 | Ga0070700_100158615 | Ga0070700_1001586151 | 209 |
| 126 | 3300005444 | Ga0070694_100436834 | Ga0070694_1004368342 | 209 |
| 127 | 3300005445 | Ga0070708_100081242 | Ga0070708_1000812424 | 209 |
| 128 | 3300005445 | Ga0070708_100089294 | Ga0070708_1000892943 | 209 |
| 129 | 3300005455 | Ga0070663_100384115 | Ga0070663_1003841152 | 209 |
| 130 | 3300005455 | Ga0070663_100481131 | Ga0070663_1004811312 | 209 |
| 131 | 3300005456 | Ga0070678_100003766 | Ga0070678_1000037669 | 209 |
| 132 | 3300005456 | Ga0070678_100452954 | Ga0070678_1004529542 | 209 |
| 133 | 3300005457 | Ga0070662_100068697 | Ga0070662_1000686973 | 209 |
| 134 | 3300005457 | Ga0070662_100118399 | Ga0070662_1001183992 | 209 |
| 135 | 3300005457 | Ga0070662_100265082 | Ga0070662_1002650822 | 209 |
| 136 | 3300005459 | Ga0068867_100000054 | Ga0068867_10000005449 | 209 |
| 137 | 3300005459 | Ga0068867_100057185 | Ga0068867_1000571853 | 209 |
| 138 | 3300005459 | Ga0068867_100190079 | Ga0068867_1001900792 | 209 |
| 139 | 3300005459 | Ga0068867_100469258 | Ga0068867_1004692581 | 209 |
| 140 | 3300005466 | Ga0070685_10241745 | Ga0070685_102417452 | 209 |
| 141 | 3300005467 | Ga0070706_100155667 | Ga0070706_1001556671 | 209 |
| 142 | 3300005468 | Ga0070707_100152978 | Ga0070707_1001529782 | 209 |
| 143 | 3300005471 | Ga0070698_100200424 | Ga0070698_1002004242 | 209 |
| 144 | 3300005518 | Ga0070699_100087025 | Ga0070699_1000870254 | 209 |
| 145 | 3300005535 | Ga0070684_100140344 | Ga0070684_1001403442 | 209 |
| 146 | 3300005536 | Ga0070697_100392336 | Ga0070697_1003923361 | 209 |
| 147 | 3300005539 | Ga0068853_100368750 | Ga0068853_1003687502 | 209 |
| 148 | 3300005543 | Ga0070672_100000765 | Ga0070672_1000007653 | 209 |
| 149 | 3300005543 | Ga0070672_100001631 | Ga0070672_10000163114 | 209 |
| 150 | 3300005543 | Ga0070672_100162353 | Ga0070672_1001623531 | 209 |
| 151 | 3300005546 | Ga0070696_100491011 | Ga0070696_1004910112 | 209 |
| 152 | 3300005547 | Ga0070693_100178896 | Ga0070693_1001788963 | 209 |
| 153 | 3300005548 | Ga0070665_100023334 | Ga0070665_1000233347 | 209 |
| 154 | 3300005548 | Ga0070665_100682628 | Ga0070665_1006826282 | 209 |
| 155 | 3300005564 | Ga0070664_100025475 | Ga0070664_1000254754 | 209 |
| 156 | 3300005564 | Ga0070664_100041908 | Ga0070664_1000419085 | 209 |
| 157 | 3300005577 | Ga0068857_100069980 | Ga0068857_1000699802 | 209 |
| 158 | 3300005578 | Ga0068854_100006612 | Ga0068854_1000066126 | 209 |
| 159 | 3300005614 | Ga0068856_100038070 | Ga0068856_1000380703 | 209 |
| 160 | 3300005614 | Ga0068856_101104366 | Ga0068856_1011043661 | 209 |
| 161 | 3300005616 | Ga0068852_100000755 | Ga0068852_10000075515 | 209 |
| 162 | 3300005616 | Ga0068852_100056345 | Ga0068852_1000563455 | 209 |
| 163 | 3300005617 | Ga0068859_101780864 | Ga0068859_1017808641 | 209 |
| 164 | 3300005618 | Ga0068864_100010763 | Ga0068864_1000107637 | 209 |
| 165 | 3300005718 | Ga0068866_10308286 | Ga0068866_103082861 | 209 |
| 166 | 3300005719 | Ga0068861_100050223 | Ga0068861_1000502235 | 209 |
| 167 | 3300005834 | Ga0068851_10039177 | Ga0068851_100391773 | 209 |
| 168 | 3300005841 | Ga0068863_100003205 | Ga0068863_10000320518 | 209 |
| 169 | 3300005841 | Ga0068863_100591148 | Ga0068863_1005911481 | 209 |
| 170 | 3300005841 | Ga0068863_100861266 | Ga0068863_1008612662 | 209 |
| 171 | 3300005843 | Ga0068860_100170043 | Ga0068860_1001700432 | 209 |
| 172 | 3300005843 | Ga0068860_100263626 | Ga0068860_1002636263 | 209 |
| 173 | 3300005844 | Ga0068862_100173512 | Ga0068862_1001735123 | 209 |
| 174 | 3300005844 | Ga0068862_100752509 | Ga0068862_1007525092 | 209 |
| 175 | 3300005844 | Ga0068862_101237747 | Ga0068862_1012377471 | 209 |
| 176 | 3300006051 | Ga0075364_10014384 | Ga0075364_100143842 | 209 |
| 177 | 3300006051 | Ga0075364_10087154 | Ga0075364_100871542 | 209 |
| 178 | 3300006173 | Ga0070716_100347085 | Ga0070716_1003470852 | 209 |
| 179 | 3300006186 | Ga0075369_10021563 | Ga0075369_100215633 | 209 |
| 180 | 3300006195 | Ga0075366_10007340 | Ga0075366_100073404 | 209 |
| 181 | 3300006237 | Ga0097621_100013262 | Ga0097621_1000132626 | 209 |
| 182 | 3300006237 | Ga0097621_100096169 | Ga0097621_1000961693 | 209 |
| 183 | 3300006237 | Ga0097621_100307829 | Ga0097621_1003078293 | 209 |
| 184 | 3300006237 | Ga0097621_100373640 | Ga0097621_1003736401 | 209 |
| 185 | 3300006353 | Ga0075370_10040634 | Ga0075370_100406343 | 209 |
| 186 | 3300006358 | Ga0068871_100045967 | Ga0068871_1000459673 | 209 |
| 187 | 3300006358 | Ga0068871_100053811 | Ga0068871_1000538114 | 209 |
| 188 | 3300006358 | Ga0068871_100067804 | Ga0068871_1000678045 | 209 |
| 189 | 3300006358 | Ga0068871_100087526 | Ga0068871_1000875262 | 209 |
| 190 | 3300006358 | Ga0068871_100291717 | Ga0068871_1002917173 | 209 |
| 191 | 3300006844 | Ga0075428_100000298 | Ga0075428_10000029820 | 209 |
| 192 | 3300006852 | Ga0075433_10013686 | Ga0075433_100136867 | 209 |
| 193 | 3300006871 | Ga0075434_100048453 | Ga0075434_1000484533 | 209 |
| 194 | 3300006880 | Ga0075429_100006177 | Ga0075429_1000061774 | 209 |
| 195 | 3300006880 | Ga0075429_100007054 | Ga0075429_10000705410 | 209 |
| 196 | 3300006914 | Ga0075436_100077975 | Ga0075436_1000779754 | 209 |
| 197 | 3300006931 | Ga0097620_101780990 | Ga0097620_1017809901 | 209 |
| 198 | 3300007076 | Ga0075435_100334081 | Ga0075435_1003340812 | 209 |
| 199 | 3300009093 | Ga0105240_10014286 | Ga0105240_100142867 | 209 |
| 200 | 3300009098 | Ga0105245_10066310 | Ga0105245_100663103 | 209 |
| 201 | 3300009098 | Ga0105245_10071791 | Ga0105245_100717913 | 209 |
| 202 | 3300009098 | Ga0105245_10660243 | Ga0105245_106602431 | 209 |
| 203 | 3300009101 | Ga0105247_10316671 | Ga0105247_103166712 | 209 |
| 204 | 3300009147 | Ga0114129_10179079 | Ga0114129_101790793 | 209 |
| 205 | 3300009147 | Ga0114129_10405186 | Ga0114129_104051862 | 209 |
| 206 | 3300009148 | Ga0105243_10086947 | Ga0105243_100869475 | 209 |
| 207 | 3300009176 | Ga0105242_11380373 | Ga0105242_113803731 | 209 |
| 208 | 3300009177 | Ga0105248_11325858 | Ga0105248_113258581 | 209 |
| 209 | 3300009545 | Ga0105237_10494151 | Ga0105237_104941512 | 209 |
| 210 | 3300009551 | Ga0105238_10457285 | Ga0105238_104572851 | 209 |
| 211 | 3300013296 | Ga0157374_10178576 | Ga0157374_101785763 | 209 |
| 212 | 3300013297 | Ga0157378_10057680 | Ga0157378_100576803 | 209 |
| 213 | 3300013306 | Ga0163162_10056926 | Ga0163162_100569264 | 209 |
| 214 | 3300013306 | Ga0163162_10590107 | Ga0163162_105901072 | 209 |
| 215 | 3300013307 | Ga0157372_10834222 | Ga0157372_108342222 | 209 |
| 216 | 3300013308 | Ga0157375_10169650 | Ga0157375_101696502 | 209 |
| 217 | 3300014326 | Ga0157380_10017562 | Ga0157380_100175622 | 209 |
| 218 | 3300014326 | Ga0157380_10040379 | Ga0157380_100403792 | 209 |
| 219 | 3300014326 | Ga0157380_10077405 | Ga0157380_100774053 | 209 |
| 220 | 3300014326 | Ga0157380_10382288 | Ga0157380_103822882 | 209 |
| 221 | 3300014326 | Ga0157380_10393462 | Ga0157380_103934622 | 209 |
| 222 | 3300014745 | Ga0157377_10000006 | Ga0157377_10000006381 | 209 |
| 223 | 3300014969 | Ga0157376_10007541 | Ga0157376_100075418 | 209 |
| 224 | 3300014969 | Ga0157376_10041283 | Ga0157376_100412832 | 209 |
| 225 | 3300014969 | Ga0157376_10223801 | Ga0157376_102238012 | 209 |
| 226 | 3300017792 | Ga0163161_10059727 | Ga0163161_100597275 | 209 |
| 227 | 3300017792 | Ga0163161_10230450 | Ga0163161_102304501 | 209 |
| 228 | 3300017792 | Ga0163161_10806105 | Ga0163161_108061051 | 209 |
| 229 | 3300020078 | Ga0206352_10665777 | Ga0206352_106657772 | 209 |
| 230 | 3300025315 | Ga0207697_10013356 | Ga0207697_100133562 | 209 |
| 231 | 3300025321 | Ga0207656_10057046 | Ga0207656_100570462 | 209 |
| 232 | 3300025903 | Ga0207680_10015805 | Ga0207680_100158054 | 209 |
| 233 | 3300025910 | Ga0207684_10086908 | Ga0207684_100869084 | 209 |
| 234 | 3300025910 | Ga0207684_10566591 | Ga0207684_105665912 | 209 |
| 235 | 3300025914 | Ga0207671_10294261 | Ga0207671_102942612 | 209 |
| 236 | 3300025918 | Ga0207662_10397056 | Ga0207662_103970561 | 209 |
| 237 | 3300025919 | Ga0207657_10002601 | Ga0207657_1000260122 | 209 |
| 238 | 3300025922 | Ga0207646_10006539 | Ga0207646_100065395 | 209 |
| 239 | 3300025923 | Ga0207681_10018473 | Ga0207681_100184735 | 209 |
| 240 | 3300025923 | Ga0207681_10268942 | Ga0207681_102689422 | 209 |
| 241 | 3300025923 | Ga0207681_10373910 | Ga0207681_103739102 | 209 |
| 242 | 3300025923 | Ga0207681_10601556 | Ga0207681_106015561 | 209 |
| 243 | 3300025925 | Ga0207650_10028688 | Ga0207650_100286885 | 209 |
| 244 | 3300025926 | Ga0207659_10005506 | Ga0207659_100055068 | 209 |
| 245 | 3300025926 | Ga0207659_10007871 | Ga0207659_100078716 | 209 |
| 246 | 3300025927 | Ga0207687_10063374 | Ga0207687_100633743 | 209 |
| 247 | 3300025931 | Ga0207644_10000382 | Ga0207644_100003828 | 209 |
| 248 | 3300025932 | Ga0207690_10002227 | Ga0207690_100022272 | 209 |
| 249 | 3300025933 | Ga0207706_10073246 | Ga0207706_100732463 | 209 |
| 250 | 3300025933 | Ga0207706_10129540 | Ga0207706_101295402 | 209 |
| 251 | 3300025933 | Ga0207706_10277537 | Ga0207706_102775372 | 209 |
| 252 | 3300025935 | Ga0207709_10001742 | Ga0207709_100017428 | 209 |
| 253 | 3300025936 | Ga0207670_10079482 | Ga0207670_100794824 | 209 |
| 254 | 3300025936 | Ga0207670_10319079 | Ga0207670_103190792 | 209 |
| 255 | 3300025937 | Ga0207669_10051658 | Ga0207669_100516582 | 209 |
| 256 | 3300025937 | Ga0207669_10065274 | Ga0207669_100652742 | 209 |
| 257 | 3300025940 | Ga0207691_10001510 | Ga0207691_1000151015 | 209 |
| 258 | 3300025940 | Ga0207691_10008589 | Ga0207691_100085894 | 209 |
| 259 | 3300025940 | Ga0207691_10019836 | Ga0207691_100198366 | 209 |
| 260 | 3300025945 | Ga0207679_10001241 | Ga0207679_1000124112 | 209 |
| 261 | 3300025945 | Ga0207679_10005879 | Ga0207679_100058798 | 209 |
| 262 | 3300025945 | Ga0207679_10568479 | Ga0207679_105684792 | 209 |
| 263 | 3300025945 | Ga0207679_10792769 | Ga0207679_107927692 | 209 |
| 264 | 3300025960 | Ga0207651_10010878 | Ga0207651_100108783 | 209 |
| 265 | 3300025960 | Ga0207651_10119921 | Ga0207651_101199211 | 209 |
| 266 | 3300025960 | Ga0207651_10383470 | Ga0207651_103834702 | 209 |
| 267 | 3300025961 | Ga0207712_10226879 | Ga0207712_102268792 | 209 |
| 268 | 3300025972 | Ga0207668_10070956 | Ga0207668_100709562 | 209 |
| 269 | 3300025972 | Ga0207668_10353871 | Ga0207668_103538712 | 209 |
| 270 | 3300025981 | Ga0207640_10002049 | Ga0207640_100020494 | 209 |
| 271 | 3300025981 | Ga0207640_10140526 | Ga0207640_101405263 | 209 |
| 272 | 3300026023 | Ga0207677_10036288 | Ga0207677_100362884 | 209 |
| 273 | 3300026023 | Ga0207677_10147226 | Ga0207677_101472262 | 209 |
| 274 | 3300026041 | Ga0207639_10167632 | Ga0207639_101676322 | 209 |
| 275 | 3300026067 | Ga0207678_10922524 | Ga0207678_109225241 | 209 |
| 276 | 3300026075 | Ga0207708_10081515 | Ga0207708_100815151 | 209 |
| 277 | 3300026075 | Ga0207708_10693615 | Ga0207708_106936152 | 209 |
| 278 | 3300026078 | Ga0207702_10131876 | Ga0207702_101318763 | 209 |
| 279 | 3300026088 | Ga0207641_10013568 | Ga0207641_100135685 | 209 |
| 280 | 3300026088 | Ga0207641_10067809 | Ga0207641_100678092 | 209 |
| 281 | 3300026088 | Ga0207641_10179722 | Ga0207641_101797222 | 209 |
| 282 | 3300026089 | Ga0207648_10000254 | Ga0207648_1000025429 | 209 |
| 283 | 3300026089 | Ga0207648_10024396 | Ga0207648_100243965 | 209 |
| 284 | 3300026089 | Ga0207648_10033096 | Ga0207648_100330962 | 209 |
| 285 | 3300026089 | Ga0207648_10189055 | Ga0207648_101890551 | 209 |
| 286 | 3300026089 | Ga0207648_10399221 | Ga0207648_103992212 | 209 |
| 287 | 3300026095 | Ga0207676_10023822 | Ga0207676_100238223 | 209 |
| 288 | 3300026095 | Ga0207676_10053113 | Ga0207676_100531132 | 209 |
| 289 | 3300026116 | Ga0207674_10342361 | Ga0207674_103423612 | 209 |
| 290 | 3300026118 | Ga0207675_100069392 | Ga0207675_1000693922 | 209 |
| 291 | 3300026118 | Ga0207675_100870113 | Ga0207675_1008701132 | 209 |
| 292 | 3300026121 | Ga0207683_10000350 | Ga0207683_1000035026 | 209 |
| 293 | 3300026121 | Ga0207683_10404439 | Ga0207683_104044392 | 209 |
| 294 | 3300026142 | Ga0207698_10007084 | Ga0207698_100070848 | 209 |
| 295 | 3300026142 | Ga0207698_10044898 | Ga0207698_100448982 | 209 |
| 296 | 3300027312 | Ga0209371_1014048 | Ga0209371_10140482 | 209 |
| 297 | 3300027907 | Ga0207428_10006015 | Ga0207428_100060154 | 209 |
| 298 | 3300027907 | Ga0207428_10438530 | Ga0207428_104385301 | 209 |
| 299 | 3300028380 | Ga0268265_10154031 | Ga0268265_101540312 | 209 |
| 300 | 3300028380 | Ga0268265_11037789 | Ga0268265_110377892 | 209 |
| 301 | 3300028381 | Ga0268264_10020106 | Ga0268264_100201062 | 209 |
| 302 | 3300031235 | Ga0265330_10018387 | Ga0265330_100183875 | 209 |
| 303 | 3300031238 | Ga0265332_10005370 | Ga0265332_100053702 | 209 |
| 304 | 3300031242 | Ga0265329_10003340 | Ga0265329_100033405 | 209 |
| 305 | 3300031249 | Ga0265339_10038328 | Ga0265339_100383285 | 209 |
| 306 | 3300031250 | Ga0265331_10000487 | Ga0265331_1000048719 | 209 |
| 307 | 3300031251 | Ga0265327_10018554 | Ga0265327_100185542 | 209 |
| 308 | 3300031344 | Ga0265316_10012941 | Ga0265316_100129417 | 209 |
| 309 | 3300031712 | Ga0265342_10137274 | Ga0265342_101372742 | 209 |
| 310 | 3300031731 | Ga0307405_10115414 | Ga0307405_101154142 | 209 |
| 311 | 3300031852 | Ga0307410_10504613 | Ga0307410_105046132 | 209 |
| 312 | 3300031911 | Ga0307412_10322335 | Ga0307412_103223352 | 209 |
| 313 | 3300032002 | Ga0307416_100507409 | Ga0307416_1005074091 | 209 |
| 314 | 3300032002 | Ga0307416_101145232 | Ga0307416_1011452321 | 209 |
| 315 | 3300035120 | Ga0373957_0166510 | Ga0373957_0166510_218_847 | 209 |
| 316 | 3300035410 | Ga0373924_0007823 | Ga0373924_0007823_1282_1911 | 209 |
| 317 | 3300035695 | Ga0373927_0006064 | Ga0373927_0006064_3632_4261 | 209 |
| 318 | 3300037068 | Ga0373925_0259648 | Ga0373925_0259648_594_1223 | 209 |
| 319 | 3300037312 | Ga0395899_0131036 | Ga0395899_0131036_1056_1697 | 209 |
| 320 | 3300037471 | Ga0395905_0018689 | Ga0395905_0018689_600_1241 | 209 |
| 321 | 3300038443 | Ga0395901_0002767 | Ga0395901_0002767_3864_4499 | 209 |
| 322 | 3300038443 | Ga0395901_0096796 | Ga0395901_0096796_2346_2984 | 209 |
| 323 | 3300038443 | Ga0395901_0616879 | Ga0395901_0616879_359_1000 | 209 |
| 324 | 3300041501 | Ga0451845_0529383 | Ga0451845_0529383_38_667 | 209 |
| 325 | 3300041509 | Ga0451843_1697151 | Ga0451843_1697151_125_754 | 209 |
| 326 | 3300041512 | Ga0451853_1683080 | Ga0451853_1683080_2470_3099 | 209 |
| 327 | 3300042001 | Ga0439441_001925 | Ga0439441_001925_1255_1884 | 209 |
| 328 | 3300042436 | Ga0439435_0058698 | Ga0439435_0058698_380_1009 | 209 |
| 329 | 3300042876 | Ga0451577_0214601 | Ga0451577_0214601_528_1157 | 209 |
| 330 | 3300042876 | Ga0451577_0236698 | Ga0451577_0236698_37_732 | 209 |
| 331 | 3300044656 | Ga0466969_0053778 | Ga0466969_0053778_321_962 | 209 |
| 332 | 3300044658 | Ga0466972_0000224 | Ga0466972_0000224_28532_29194 | 209 |
| 333 | 3300044658 | Ga0466972_0000934 | Ga0466972_0000934_12048_12677 | 209 |
| 334 | 3300044658 | Ga0466972_0010208 | Ga0466972_0010208_1496_2158 | 209 |
| 335 | 3300044683 | Ga0466965_0000404 | Ga0466965_0000404_10861_11523 | 209 |
| 336 | 3300044684 | Ga0466966_0031683 | Ga0466966_0031683_2368_3009 | 209 |
| 337 | 3300044684 | Ga0466966_0196049 | Ga0466966_0196049_371_1033 | 209 |
| 338 | 3300044693 | Ga0466961_0191714 | Ga0466961_0191714_87_728 | 209 |
| 339 | 3300044706 | Ga0466964_0143158 | Ga0466964_0143158_33_674 | 209 |
| 340 | 3300044706 | Ga0466964_0337464 | Ga0466964_0337464_49_711 | 209 |
| 341 | 3300044712 | Ga0453684_0009638 | Ga0453684_0009638_864_1493 | 209 |
| 342 | 3300044712 | Ga0453684_0965925 | Ga0453684_0965925_68_697 | 209 |
| 343 | 3300044719 | Ga0466971_0059533 | Ga0466971_0059533_412_1053 | 209 |
| 344 | 3300044735 | Ga0466968_0009095 | Ga0466968_0009095_1347_2009 | 209 |
| 345 | 3300044735 | Ga0466968_0303432 | Ga0466968_0303432_89_730 | 209 |
| 346 | 3300044765 | Ga0466970_0013917 | Ga0466970_0013917_3375_4028 | 209 |
| 347 | 3300045049 | Ga0466959_0006284 | Ga0466959_0006284_6525_7178 | 209 |
| 348 | 3300045049 | Ga0466959_0124050 | Ga0466959_0124050_139_780 | 209 |
| 349 | 3300045051 | Ga0451576_0016983 | Ga0451576_0016983_133_762 | 209 |
| 350 | 3300045051 | Ga0451576_0107975 | Ga0451576_0107975_865_1503 | 209 |
| 351 | 3300045051 | Ga0451576_0560842 | Ga0451576_0560842_426_1121 | 209 |
| 352 | 3300046472 | Ga0495580_0210484 | Ga0495580_0210484_648_1277 | 209 |
| 353 | 3300046539 | Ga0495621_0220758 | Ga0495621_0220758_76_705 | 209 |
| 354 | 3300046691 | Ga0495670_0245725 | Ga0495670_0245725_127_756 | 209 |
| 355 | 3300048903 | Ga0496100_0492336 | Ga0496100_0492336_81_710 | 209 |
| 356 | 3300048904 | Ga0496101_0121980 | Ga0496101_0121980_1166_1795 | 209 |
| 357 | 3300048908 | Ga0496105_0165166 | Ga0496105_0165166_711_1340 | 209 |
| 358 | 3300048911 | Ga0496108_0043681 | Ga0496108_0043681_2619_3248 | 209 |
| 359 | 3300048912 | Ga0496109_0020414 | Ga0496109_0020414_1151_1780 | 209 |
| 360 | 3300048912 | Ga0496109_0404310 | Ga0496109_0404310_102_773 | 209 |
| 361 | 3300048913 | Ga0496110_0005024 | Ga0496110_0005024_8806_9435 | 209 |
| 362 | 3300048914 | Ga0496111_0044908 | Ga0496111_0044908_1968_2597 | 209 |
| 363 | 3300048917 | Ga0496114_0025747 | Ga0496114_0025747_2144_2773 | 209 |
| 364 | 3300048919 | Ga0496116_0051360 | Ga0496116_0051360_1631_2284 | 209 |
| 365 | 3300048919 | Ga0496116_0094788 | Ga0496116_0094788_938_1591 | 209 |
| 366 | 3300048921 | Ga0496118_0065843 | Ga0496118_0065843_1181_1861 | 209 |
| 367 | 3300048924 | Ga0496121_0215435 | Ga0496121_0215435_453_1106 | 209 |
| 368 | 3300048925 | Ga0496122_0001693 | Ga0496122_0001693_2475_3128 | 209 |
| 369 | 3300048926 | Ga0496123_0006735 | Ga0496123_0006735_7986_8639 | 209 |
| 370 | 3300048927 | Ga0496124_0046812 | Ga0496124_0046812_995_1648 | 209 |
| 371 | 3300048929 | Ga0496126_0192324 | Ga0496126_0192324_631_1284 | 209 |
| 372 | 3300049568 | Ga0501031_0000300 | Ga0501031_0000300_26334_26966 | 209 |
| 373 | 3300049568 | Ga0501031_0046281 | Ga0501031_0046281_504_1136 | 209 |
| 374 | 3300049568 | Ga0501031_0198212 | Ga0501031_0198212_174_806 | 209 |
| 375 | 3300049569 | Ga0501032_0004122 | Ga0501032_0004122_4084_4716 | 209 |
| 376 | 3300049570 | Ga0501033_0023748 | Ga0501033_0023748_633_1265 | 209 |
| 377 | 3300049570 | Ga0501033_0028471 | Ga0501033_0028471_818_1450 | 209 |
| 378 | 3300049571 | Ga0501034_0048437 | Ga0501034_0048437_2912_3544 | 209 |
| 379 | 3300049571 | Ga0501034_0425886 | Ga0501034_0425886_518_1171 | 209 |
| 380 | 3300049571 | Ga0501034_0452302 | Ga0501034_0452302_34_675 | 209 |
| 381 | 3300049572 | Ga0501036_0000045 | Ga0501036_0000045_59991_60623 | 209 |
| 382 | 3300049572 | Ga0501036_0104316 | Ga0501036_0104316_1357_1989 | 209 |
| 383 | 3300049573 | Ga0501037_0011714 | Ga0501037_0011714_1920_2552 | 209 |
| 384 | 3300049574 | Ga0501038_0007503 | Ga0501038_0007503_8656_9288 | 209 |
| 385 | 3300049574 | Ga0501038_0012626 | Ga0501038_0012626_321_953 | 209 |
| 386 | 3300049576 | Ga0501040_0003260 | Ga0501040_0003260_7795_8427 | 209 |
| 387 | 3300049577 | Ga0501041_0003596 | Ga0501041_0003596_1851_2483 | 209 |
| 388 | 3300049578 | Ga0501042_0000826 | Ga0501042_0000826_14388_15020 | 209 |
| 389 | 3300049579 | Ga0501043_0001245 | Ga0501043_0001245_20633_21265 | 209 |
| 390 | 3300049579 | Ga0501043_0009921 | Ga0501043_0009921_2764_3396 | 209 |
| 391 | 3300049580 | Ga0501046_0000365 | Ga0501046_0000365_43064_43696 | 209 |
| 392 | 3300049580 | Ga0501046_0012013 | Ga0501046_0012013_754_1386 | 209 |
| 393 | 3300049581 | Ga0501047_0004943 | Ga0501047_0004943_10314_10946 | 209 |
| 394 | 3300049581 | Ga0501047_0099378 | Ga0501047_0099378_1416_2048 | 209 |
| 395 | 3300049582 | Ga0501048_0012751 | Ga0501048_0012751_3857_4489 | 209 |
| 396 | 3300049584 | Ga0501068_0022319 | Ga0501068_0022319_2202_2834 | 209 |
| 397 | 3300049585 | Ga0501069_0004591 | Ga0501069_0004591_3963_4595 | 209 |
| 398 | 3300049587 | Ga0501071_0054252 | Ga0501071_0054252_373_1005 | 209 |
| 399 | 3300049588 | Ga0501072_0002297 | Ga0501072_0002297_11818_12450 | 209 |
| 400 | 3300049589 | Ga0501073_0013771 | Ga0501073_0013771_3409_4041 | 209 |
| 401 | 3300049590 | Ga0501074_0003029 | Ga0501074_0003029_55_687 | 209 |
| 402 | 3300049591 | Ga0501075_0025702 | Ga0501075_0025702_2033_2665 | 209 |
| 403 | 3300049592 | Ga0501076_0000658 | Ga0501076_0000658_2955_3587 | 209 |
| 404 | 3300049593 | Ga0501077_0004182 | Ga0501077_0004182_2567_3199 | 209 |
| 405 | 3300049662 | Ga0501222_000031 | Ga0501222_000031_26306_26950 | 209 |
| 406 | 3300049741 | Ga0501079_0170769 | Ga0501079_0170769_691_1323 | 209 |
| 407 | 3300049743 | Ga0501081_0004260 | Ga0501081_0004260_5267_5899 | 209 |
| 408 | 3300049744 | Ga0501083_0025898 | Ga0501083_0025898_1003_1635 | 209 |
| 409 | 3300049822 | Ga0501035_0001790 | Ga0501035_0001790_13559_14191 | 209 |
| 410 | 3300049822 | Ga0501035_0085686 | Ga0501035_0085686_181_813 | 209 |
| 411 | 3300049823 | Ga0501044_0001026 | Ga0501044_0001026_775_1407 | 209 |
| 412 | 3300049824 | Ga0501045_0000070 | Ga0501045_0000070_4246_4878 | 209 |
| 413 | 3300050491 | nmdc:mga00v17_116085_c1 | nmdc:mga00v17_116085_c1_271_900 | 209 |
| 414 | 3300050491 | nmdc:mga00v17_48106_c1 | nmdc:mga00v17_48106_c1_614_1267 | 209 |
| 415 | 3300050496 | nmdc:mga07m45_31539_c1 | nmdc:mga07m45_31539_c1_1253_1882 | 209 |
| 416 | 3300050508 | nmdc:mga09592_1109_c1 | nmdc:mga09592_1109_c1_6733_7362 | 209 |
| 417 | 3300050509 | nmdc:mga0qj67_199487_c1 | nmdc:mga0qj67_199487_c1_718_1347 | 209 |
| 418 | 3300050511 | nmdc:mga08y16_1286_c1 | nmdc:mga08y16_1286_c1_5026_5655 | 209 |
| 419 | 3300050511 | nmdc:mga08y16_1295629_c1 | nmdc:mga08y16_1295629_c1_51_680 | 209 |
| 420 | 3300050511 | nmdc:mga08y16_289077_c1 | nmdc:mga08y16_289077_c1_993_1622 | 209 |
| 421 | 3300050511 | nmdc:mga08y16_822309_c1 | nmdc:mga08y16_822309_c1_206_847 | 209 |
| 422 | 3300050512 | nmdc:mga0n895_47201_c1 | nmdc:mga0n895_47201_c1_2015_2644 | 209 |
| 423 | 3300050513 | nmdc:mga0rr50_352017_c1 | nmdc:mga0rr50_352017_c1_25_654 | 209 |
| 424 | 3300050515 | nmdc:mga0a205_155658_c1 | nmdc:mga0a205_155658_c1_1082_1711 | 209 |
| 425 | 3300050516 | nmdc:mga0sz30_35084_c1 | nmdc:mga0sz30_35084_c1_732_1361 | 209 |
| 426 | 3300053096 | Ga0500641_0007896 | Ga0500641_0007896_1715_2344 | 209 |
| 427 | 3300054114 | Ga0501084_0001240 | Ga0501084_0001240_18683_19315 | 209 |
| 428 | 3300060353 | Ga0501082_0118810 | Ga0501082_0118810_872_1504 | 209 |
| 429 | 3300061719 | Ga0466962_0260025 | Ga0466962_0260025_190_831 | 209 |
| 430 | 3300061734 | Ga0530510_0003829 | Ga0530510_0003829_8686_9318 | 209 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3n08-assembly1.cif.gz_B | crystal structure of a putative phosphatidylethanolamine-binding protein (pebp) homolog ct736 from chlamydia trachomatis d/uw-3/cx | 0.8953 | 3 | 201 |
| 1vi3-assembly1.cif.gz_A | crystal structure of an hypothetical protein | 0.8863 | 3 | 202 |
| 1fjj-assembly1.cif.gz_A-2 | crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family | 0.8862 | 3 | 202 |
| 4beg-assembly1.cif.gz_A | structure of rv2140c, a phosphatidyl-ethanolamine binding protein from mycobacterium tuberculosis in complex with sulphate | 0.8861 | 2 | 202 |
| 1fux-assembly1.cif.gz_B | crystal structure of e.coli ybcl, a new member of the mammalian pebp family | 0.8673 | 2 | 202 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3n08A00 | Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like | 0.9009 | 2 | 201 | 3.90.280.10 |
| 4begB00 | Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like | 0.8959 | 2 | 202 | 3.90.280.10 |
| 1fjjA00 | Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like | 0.8801 | 1 | 199 | 3.90.280.10 |
| af_P77368_20_183_3.90.280.10 | Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like | 0.8724 | 2 | 202 | 3.90.280.10 |
| 3n08A00 | Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like | 0.8667 | 2 | 201 | 3.90.280.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A257QJA4-F1-model_v4 | Pyruvate, phosphate dikinase (Pyruvate, orthophosphate dikinase) | 0.9995 | 28 | 207 |
GO:0006090
GO:0050242 |
| AF-C3X4Y9-F1-model_v4 | YbhB/YbcL family Raf kinase inhibitor-like protein | 0.9989 | 1 | 207 |
|
| AF-A0A536Z6T9-F1-model_v4 | YbhB/YbcL family Raf kinase inhibitor-like protein | 0.9981 | 19 | 206 |
|
| AF-A0A7I8ECA7-F1-model_v4 | Phospholipid-binding protein | 0.9974 | 1 | 208 |
|
| AF-A0A4Y6PTT7-F1-model_v4 | YbhB/YbcL family Raf kinase inhibitor-like protein | 0.9971 | 1 | 205 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar