F442198

General Info

Members Datasets Scaffolds Average Seq Length
430 276 424 210

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0236698|Ga0451577_0236698_37_732
Length 231
Sequence MPDELGGRIALSTILDRHPGEGMRFTTTAFAELEAIPAEYAFGKIDPRTHVALSDNLNPDFFWSDAPVGTRSFALLCHDPDVPSKGDDVNQEGKIISANLPRVDFFHWVLIDLPSTMTKIACGEFSNGVTPRGKAGPQAAHFARQGINDYTGWFSGDKDMAGDYYGYDGPCPPWNDSLVHRYVFTLYALSVPKLAVEGTFNGADVRAAFQGKILAQASVTGRYTLNPSIKL

Samples

Sample ID Description Type Environment
1 2643221569 Achromobacter sp. Root565 Isolate Unclassified
2 2643221594 Achromobacter sp. Root170 Isolate Unclassified
3 2643221621 Achromobacter sp. Root83 Isolate Unclassified
4 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
5 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
6 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
145 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
146 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
149 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
150 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
151 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
155 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
156 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
167 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
169 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
170 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
171 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
172 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
173 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
174 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
175 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
181 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
182 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
183 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
184 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
187 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
188 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
189 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
190 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
198 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
199 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
200 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
201 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
205 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
206 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
207 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
208 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
209 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
210 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
211 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
222 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
223 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
224 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
225 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
226 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
227 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
244 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
245 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
250 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
251 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
252 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
253 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
254 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
255 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
256 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
257 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
258 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
264 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
265 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
266 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
267 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
268 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
269 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
270 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
271 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
272 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
273 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
274 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
275 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0.23
Isolates 1.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.79
Nodule 0
Rhizoplane 2.09
Rhizosphere 90.93
Stem 0
Stem Tuber 0
Unclassified 4.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10089749 3300005327 Bacteria 2531
2 Ga0070676_10041775 3300005328 Bacteria 2660
3 Ga0070676_10188126 3300005328 Bacteria 1346
4 Ga0070676_10403245 3300005328 Bacteria 952
5 Ga0070683_100022468 3300005329 Bacteria 5637
6 Ga0070690_100117565 3300005330 Bacteria 1781
7 Ga0070670_100001197 3300005331 Bacteria 20604
8 Ga0070670_100024701 3300005331 Bacteria 5168
9 Ga0070670_100028265 3300005331 Bacteria 4826
10 Ga0070677_10027242 3300005333 Bacteria 2150
11 Ga0068869_100070855 3300005334 Bacteria 2580
12 Ga0070680_100067876 3300005336 Bacteria 2926
13 Ga0070682_100056869 3300005337 Bacteria 2462
14 Ga0068868_100003049 3300005338 Bacteria 11661
15 Ga0070660_100003515 3300005339 Bacteria 10799
16 Ga0070689_100541829 3300005340 Bacteria 1002
17 Ga0070687_100397196 3300005343 Bacteria 903
18 Ga0070661_100002781 3300005344 Bacteria 12011
19 Ga0070661_100003527 3300005344 Bacteria 10774
20 Ga0070661_100024587 3300005344 Bacteria 4321
21 Ga0070668_100001234 3300005347 Bacteria 18213
22 Ga0070668_100134402 3300005347 Bacteria 1988
23 Ga0070669_100073138 3300005353 Bacteria 2539
24 Ga0070675_100015295 3300005354 Bacteria 6063
25 Ga0070675_100015455 3300005354 Bacteria 6035
26 Ga0070671_100000422 3300005355 Bacteria 29439
27 Ga0070671_100071860 3300005355 Bacteria 2888
28 Ga0070674_100130855 3300005356 Bacteria 1870
29 Ga0070674_100168478 3300005356 Bacteria 1668
30 Ga0070674_100179210 3300005356 Bacteria 1622
31 Ga0070674_100513377 3300005356 Bacteria 1000
32 Ga0070673_100000427 3300005364 Bacteria 22201
33 Ga0070673_100007645 3300005364 Bacteria 7150
34 Ga0070673_100015599 3300005364 Bacteria 5343
35 Ga0070673_100176262 3300005364 Bacteria 1828
36 Ga0070673_100290764 3300005364 Bacteria 1436
37 Ga0070673_100375728 3300005364 Bacteria 1266
38 Ga0070659_100000556 3300005366 Bacteria 27336
39 Ga0070667_100267206 3300005367 Bacteria 1533
40 Ga0070667_100735233 3300005367 Bacteria 914
41 Ga0070703_10161282 3300005406 Bacteria 851
42 Ga0070711_100270729 3300005439 Bacteria 1340
43 Ga0070700_100158615 3300005441 Bacteria 1555
44 Ga0070694_100436834 3300005444 Bacteria 1031
45 Ga0070708_100081242 3300005445 Bacteria 2934
46 Ga0070708_100089294 3300005445 Bacteria 2804
47 Ga0070708_100595049 3300005445 Bacteria 1043
48 Ga0070663_100384115 3300005455 Bacteria 1144
49 Ga0070663_100481131 3300005455 Bacteria 1028
50 Ga0070678_100003766 3300005456 Bacteria 8502
51 Ga0070678_100452954 3300005456 Bacteria 1124
52 Ga0070662_100068697 3300005457 Bacteria 2606
53 Ga0070662_100118399 3300005457 Bacteria 2027
54 Ga0070662_100265082 3300005457 Bacteria 1385
55 Ga0070681_10056356 3300005458 Bacteria 3912
56 Ga0068867_100000054 3300005459 Bacteria 69032
57 Ga0068867_100057185 3300005459 Bacteria 2888
58 Ga0068867_100190079 3300005459 Bacteria 1638
59 Ga0068867_100469258 3300005459 Bacteria 1076
60 Ga0070685_10241745 3300005466 Bacteria 1192
61 Ga0070706_100155667 3300005467 Bacteria 2133
62 Ga0070707_100152978 3300005468 Bacteria 2246
63 Ga0070707_100266147 3300005468 Bacteria 1667
64 Ga0070698_100200424 3300005471 Bacteria 1932
65 Ga0070699_100087025 3300005518 Bacteria 2727
66 Ga0070679_100007610 3300005530 Bacteria 10137
67 Ga0070684_100140344 3300005535 Bacteria 2185
68 Ga0070697_100392336 3300005536 Bacteria 1204
69 Ga0068853_100077187 3300005539 Bacteria 2910
70 Ga0068853_100368750 3300005539 Bacteria 1339
71 Ga0070672_100000765 3300005543 Bacteria 19130
72 Ga0070672_100001631 3300005543 Bacteria 13960
73 Ga0070672_100162353 3300005543 Bacteria 1854
74 Ga0070696_100491011 3300005546 Bacteria 975
75 Ga0070693_100178896 3300005547 Bacteria 1364
76 Ga0070665_100023334 3300005548 Bacteria 6228
77 Ga0070665_100682628 3300005548 Bacteria 1040
78 Ga0070664_100025475 3300005564 Bacteria 4903
79 Ga0070664_100041908 3300005564 Bacteria 3864
80 Ga0068857_100069980 3300005577 Bacteria 3125
81 Ga0068854_100006612 3300005578 Bacteria 7385
82 Ga0068856_100038070 3300005614 Bacteria 4720
83 Ga0068856_101104366 3300005614 Bacteria 810
84 Ga0068852_100000755 3300005616 Bacteria 21268
85 Ga0068852_100056345 3300005616 Bacteria 3396
86 Ga0068859_101780864 3300005617 Bacteria 680
87 Ga0068864_100010763 3300005618 Bacteria 7560
88 Ga0068866_10308286 3300005718 Bacteria 991
89 Ga0068861_100050223 3300005719 Bacteria 3162
90 Ga0068851_10039177 3300005834 Bacteria 2380
91 Ga0068863_100003205 3300005841 Bacteria 16191
92 Ga0068863_100591148 3300005841 Bacteria 1098
93 Ga0068863_100861266 3300005841 Bacteria 905
94 Ga0068860_100170043 3300005843 Bacteria 2105
95 Ga0068860_100263626 3300005843 Bacteria 1680
96 Ga0068862_100173512 3300005844 Bacteria 1931
97 Ga0068862_100752509 3300005844 Bacteria 948
98 Ga0068862_101237747 3300005844 Bacteria 746
99 Ga0075364_10014384 3300006051 Bacteria 4889
100 Ga0075364_10087154 3300006051 Bacteria 2069
101 Ga0070716_100347085 3300006173 Bacteria 1049
102 Ga0075369_10021563 3300006186 Bacteria 2649
103 Ga0075366_10007340 3300006195 Bacteria 6081
104 Ga0075366_10167667 3300006195 Bacteria 1332
105 Ga0097621_100013262 3300006237 Bacteria 6135
106 Ga0097621_100096169 3300006237 Bacteria 2485
107 Ga0097621_100307829 3300006237 Bacteria 1401
108 Ga0097621_100373640 3300006237 Bacteria 1272
109 Ga0075370_10040634 3300006353 Bacteria 2624
110 Ga0068871_100045967 3300006358 Bacteria 3515
111 Ga0068871_100053811 3300006358 Bacteria 3264
112 Ga0068871_100067804 3300006358 Bacteria 2928
113 Ga0068871_100087526 3300006358 Bacteria 2590
114 Ga0068871_100291717 3300006358 Bacteria 1430
115 Ga0075428_100000298 3300006844 Bacteria 48579
116 Ga0075433_10013686 3300006852 Bacteria 6606
117 Ga0075434_100048453 3300006871 Bacteria 4216
118 Ga0075434_100344801 3300006871 Bacteria 1511
119 Ga0075429_100006177 3300006880 Bacteria 10353
120 Ga0075429_100007054 3300006880 Bacteria 9756
121 Ga0075436_100077975 3300006914 Bacteria 2295
122 Ga0097620_101780990 3300006931 Bacteria 680
123 Ga0075435_100334081 3300007076 Bacteria 1298
124 Ga0105240_10014286 3300009093 Bacteria 10844
125 Ga0105245_10066310 3300009098 Bacteria 3267
126 Ga0105245_10071791 3300009098 Bacteria 3144
127 Ga0105245_10660243 3300009098 Bacteria 1076
128 Ga0105247_10316671 3300009101 Bacteria 1087
129 Ga0114129_10179079 3300009147 Bacteria 2886
130 Ga0114129_10405186 3300009147 Bacteria 1797
131 Ga0105243_10086947 3300009148 Bacteria 2565
132 Ga0105242_11380373 3300009176 Bacteria 731
133 Ga0105248_11325858 3300009177 Bacteria 814
134 Ga0105237_10494151 3300009545 Bacteria 1230
135 Ga0105238_10457285 3300009551 Bacteria 1274
136 Ga0157373_10007999 3300013100 Bacteria 7863
137 Ga0157370_10005229 3300013104 Bacteria 14615
138 Ga0157374_10178576 3300013296 Bacteria 2073
139 Ga0157378_10057680 3300013297 Bacteria 3461
140 Ga0163162_10056926 3300013306 Bacteria 3937
141 Ga0163162_10590107 3300013306 Bacteria 1238
142 Ga0157372_10027067 3300013307 Bacteria 6241
143 Ga0157372_10834222 3300013307 Bacteria 1070
144 Ga0157375_10169650 3300013308 Bacteria 2329
145 Ga0157380_10017562 3300014326 Bacteria 5295
146 Ga0157380_10040379 3300014326 Bacteria 3634
147 Ga0157380_10077405 3300014326 Bacteria 2711
148 Ga0157380_10382288 3300014326 Bacteria 1329
149 Ga0157380_10393462 3300014326 Bacteria 1312
150 Ga0157377_10000006 3300014745 Bacteria 419853
151 Ga0157376_10007541 3300014969 Bacteria 7777
152 Ga0157376_10041283 3300014969 Bacteria 3776
153 Ga0157376_10223801 3300014969 Bacteria 1744
154 Ga0163161_10059727 3300017792 Bacteria 2774
155 Ga0163161_10230450 3300017792 Bacteria 1437
156 Ga0163161_10806105 3300017792 Bacteria 789
157 Ga0206352_10665777 3300020078 Bacteria 1618
158 Ga0207697_10013356 3300025315 Bacteria 3427
159 Ga0207656_10057046 3300025321 Bacteria 1703
160 Ga0207680_10015805 3300025903 Bacteria 3948
161 Ga0207684_10086908 3300025910 Bacteria 2663
162 Ga0207684_10461529 3300025910 Bacteria 1090
163 Ga0207684_10566591 3300025910 Bacteria 971
164 Ga0207707_10014085 3300025912 Bacteria 6971
165 Ga0207671_10294261 3300025914 Bacteria 1282
166 Ga0207660_10133216 3300025917 Bacteria 1894
167 Ga0207662_10397056 3300025918 Bacteria 934
168 Ga0207657_10002601 3300025919 Bacteria 19533
169 Ga0207649_10007895 3300025920 Bacteria 5791
170 Ga0207652_10006748 3300025921 Bacteria 9253
171 Ga0207646_10006539 3300025922 Bacteria 12030
172 Ga0207681_10018473 3300025923 Bacteria 4392
173 Ga0207681_10268942 3300025923 Bacteria 1337
174 Ga0207681_10373910 3300025923 Bacteria 1146
175 Ga0207681_10601556 3300025923 Bacteria 909
176 Ga0207650_10028688 3300025925 Bacteria 3993
177 Ga0207659_10005506 3300025926 Bacteria 7681
178 Ga0207659_10007871 3300025926 Bacteria 6588
179 Ga0207687_10063374 3300025927 Bacteria 2617
180 Ga0207644_10000382 3300025931 Bacteria 28809
181 Ga0207690_10002227 3300025932 Bacteria 11826
182 Ga0207706_10073246 3300025933 Bacteria 3012
183 Ga0207706_10129540 3300025933 Bacteria 2219
184 Ga0207706_10277537 3300025933 Bacteria 1462
185 Ga0207709_10001742 3300025935 Bacteria 14644
186 Ga0207670_10079482 3300025936 Bacteria 2290
187 Ga0207670_10319079 3300025936 Bacteria 1222
188 Ga0207669_10051658 3300025937 Bacteria 2464
189 Ga0207669_10065274 3300025937 Bacteria 2257
190 Ga0207691_10001510 3300025940 Bacteria 23128
191 Ga0207691_10008589 3300025940 Bacteria 9800
192 Ga0207691_10019836 3300025940 Bacteria 6359
193 Ga0207679_10001241 3300025945 Bacteria 16227
194 Ga0207679_10005879 3300025945 Bacteria 7712
195 Ga0207679_10568479 3300025945 Bacteria 1019
196 Ga0207679_10792769 3300025945 Bacteria 863
197 Ga0207651_10010878 3300025960 Bacteria 5064
198 Ga0207651_10119921 3300025960 Bacteria 1993
199 Ga0207651_10383470 3300025960 Bacteria 1192
200 Ga0207651_10390138 3300025960 Bacteria 1182
201 Ga0207712_10226879 3300025961 Bacteria 1497
202 Ga0207668_10070956 3300025972 Bacteria 2486
203 Ga0207668_10353871 3300025972 Bacteria 1229
204 Ga0207640_10002049 3300025981 Bacteria 10896
205 Ga0207640_10140526 3300025981 Bacteria 1759
206 Ga0207677_10036288 3300026023 Bacteria 3211
207 Ga0207677_10147226 3300026023 Bacteria 1812
208 Ga0207639_10086464 3300026041 Bacteria 2496
209 Ga0207639_10167632 3300026041 Bacteria 1857
210 Ga0207678_10922524 3300026067 Bacteria 772
211 Ga0207708_10081515 3300026075 Bacteria 2487
212 Ga0207708_10693615 3300026075 Bacteria 870
213 Ga0207702_10131876 3300026078 Bacteria 2249
214 Ga0207641_10013568 3300026088 Bacteria 6683
215 Ga0207641_10067809 3300026088 Bacteria 3058
216 Ga0207641_10179722 3300026088 Bacteria 1937
217 Ga0207648_10000254 3300026089 Bacteria 57696
218 Ga0207648_10024396 3300026089 Bacteria 5398
219 Ga0207648_10033096 3300026089 Bacteria 4560
220 Ga0207648_10189055 3300026089 Bacteria 1824
221 Ga0207648_10399221 3300026089 Bacteria 1246
222 Ga0207676_10023822 3300026095 Bacteria 4523
223 Ga0207676_10053113 3300026095 Bacteria 3171
224 Ga0207674_10342361 3300026116 Bacteria 1446
225 Ga0207675_100069392 3300026118 Bacteria 3294
226 Ga0207675_100870113 3300026118 Bacteria 917
227 Ga0207683_10000350 3300026121 Bacteria 42128
228 Ga0207683_10404439 3300026121 Bacteria 1256
229 Ga0207698_10007084 3300026142 Bacteria 7022
230 Ga0207698_10044898 3300026142 Bacteria 3324
231 Ga0209371_1014048 3300027312 Bacteria 2213
232 Ga0207428_10006015 3300027907 Bacteria 11227
233 Ga0207428_10438530 3300027907 Bacteria 953
234 Ga0268265_10154031 3300028380 Bacteria 1942
235 Ga0268265_11037789 3300028380 Bacteria 811
236 Ga0268264_10020106 3300028381 Bacteria 5455
237 Ga0265318_10001243 3300028577 Bacteria 15473
238 Ga0265330_10018387 3300031235 Bacteria 3210
239 Ga0265332_10005370 3300031238 Bacteria 5914
240 Ga0265332_10127837 3300031238 Bacteria 1066
241 Ga0265328_10006395 3300031239 Bacteria 4992
242 Ga0265320_10153056 3300031240 Bacteria 1041
243 Ga0265329_10003340 3300031242 Bacteria 7020
244 Ga0265339_10038328 3300031249 Bacteria 2675
245 Ga0265331_10000487 3300031250 Bacteria 37832
246 Ga0265331_10000887 3300031250 Bacteria 24296
247 Ga0265327_10018554 3300031251 Bacteria 4308
248 Ga0265316_10011844 3300031344 Bacteria 7843
249 Ga0265316_10012941 3300031344 Bacteria 7447
250 Ga0265314_10034544 3300031711 Bacteria 3695
251 Ga0265342_10137274 3300031712 Bacteria 1366
252 Ga0316578_10262032 3300031728 Bacteria 1036
253 Ga0307516_10001028 3300031730 Bacteria 38713
254 Ga0307405_10115414 3300031731 Bacteria 1827
255 Ga0307410_10504613 3300031852 Bacteria 996
256 Ga0307412_10322335 3300031911 Bacteria 1230
257 Ga0307416_100507409 3300032002 Bacteria 1272
258 Ga0307416_101145232 3300032002 Bacteria 883
259 Ga0373957_0166510 3300035120 Bacteria 910
260 Ga0316574_0314702 3300035398 Bacteria 994
261 Ga0373924_0007823 3300035410 Bacteria 3865
262 Ga0373927_0006064 3300035695 Bacteria 8280
263 Ga0373937_0076404 3300036401 Bacteria 3093
264 Ga0373937_0319468 3300036401 Bacteria 1469
265 Ga0373925_0259648 3300037068 Bacteria 1395
266 Ga0395899_0131036 3300037312 Bacteria 1790
267 Ga0395905_0005907 3300037471 Bacteria 12410
268 Ga0395905_0018689 3300037471 Bacteria 6574
269 Ga0395901_0002767 3300038443 Bacteria 17671
270 Ga0395901_0096796 3300038443 Bacteria 3093
271 Ga0395901_0616879 3300038443 Bacteria 1092
272 Ga0451841_1014916 3300041498 Bacteria 1179
273 Ga0451845_0529383 3300041501 Bacteria 684
274 Ga0451843_1697151 3300041509 Bacteria 935
275 Ga0451853_1683080 3300041512 Bacteria 3493
276 Ga0439441_001925 3300042001 Bacteria 2842
277 Ga0439455_0012859 3300042012 Bacteria 1886
278 Ga0439458_0067789 3300042157 Bacteria 898
279 Ga0439435_0058698 3300042436 Bacteria 1117
280 Ga0451577_0214601 3300042876 Bacteria 1739
281 Ga0451577_0236698 3300042876 Bacteria 1652
282 Ga0466969_0053778 3300044656 Bacteria 1974
283 Ga0466972_0000224 3300044658 Bacteria 39867
284 Ga0466972_0000934 3300044658 Bacteria 14050
285 Ga0466972_0010208 3300044658 Bacteria 4717
286 Ga0466972_0176113 3300044658 Bacteria 1003
287 Ga0466965_0000404 3300044683 Bacteria 14818
288 Ga0466965_0056283 3300044683 Bacteria 1958
289 Ga0466966_0031683 3300044684 Bacteria 3428
290 Ga0466966_0196049 3300044684 Bacteria 1223
291 Ga0466961_0055885 3300044693 Bacteria 2515
292 Ga0466961_0191714 3300044693 Bacteria 1267
293 Ga0466964_0143158 3300044706 Bacteria 1101
294 Ga0466964_0337464 3300044706 Bacteria 771
295 Ga0453684_0009638 3300044712 Bacteria 16833
296 Ga0453684_0965925 3300044712 Bacteria 908
297 Ga0466971_0039799 3300044719 Bacteria 2110
298 Ga0466971_0059533 3300044719 Bacteria 1725
299 Ga0466968_0009095 3300044735 Bacteria 3819
300 Ga0466968_0095284 3300044735 Bacteria 1324
301 Ga0466968_0303432 3300044735 Unclassified 768
302 Ga0466970_0013917 3300044765 Bacteria 4127
303 Ga0466957_0062750 3300044842 Bacteria 2283
304 Ga0466959_0006284 3300045049 Bacteria 8210
305 Ga0466959_0055489 3300045049 Bacteria 2892
306 Ga0466959_0124050 3300045049 Bacteria 1834
307 Ga0451576_0016983 3300045051 Bacteria 8015
308 Ga0451576_0107975 3300045051 Bacteria 2896
309 Ga0451576_0151692 3300045051 Bacteria 2417
310 Ga0451576_0560842 3300045051 Bacteria 1200
311 Ga0451576_0746265 3300045051 Bacteria 1028
312 Ga0495590_0015261 3300046457 Bacteria 2790
313 Ga0495651_0024322 3300046462 Bacteria 4713
314 Ga0495580_0210484 3300046472 Bacteria 1338
315 Ga0495584_0002636 3300046491 Bacteria 10111
316 Ga0495607_0005877 3300046501 Bacteria 8715
317 Ga0495616_0021199 3300046513 Bacteria 3522
318 Ga0495642_0012878 3300046528 Bacteria 3228
319 Ga0495609_0000173 3300046538 Bacteria 66125
320 Ga0495621_0036989 3300046539 Bacteria 1696
321 Ga0495621_0220758 3300046539 Bacteria 767
322 Ga0495668_0007994 3300046616 Bacteria 6665
323 Ga0495625_0000578 3300046660 Bacteria 53326
324 Ga0495659_0029550 3300046664 Bacteria 1903
325 Ga0495661_0024112 3300046665 Bacteria 3940
326 Ga0495658_0729382 3300046683 Bacteria 635
327 Ga0495669_0000485 3300046684 Bacteria 18399
328 Ga0495670_0245725 3300046691 Bacteria 953
329 Ga0495660_0024465 3300046810 Bacteria 3439
330 Ga0495636_0132203 3300047318 Bacteria 1110
331 Ga0495687_016027 3300047443 Bacteria 3783
332 Ga0495677_0020134 3300047445 Bacteria 2418
333 Ga0495681_0038189 3300047470 Bacteria 2356
334 Ga0496100_0492336 3300048903 Bacteria 944
335 Ga0496101_0121980 3300048904 Bacteria 1971
336 Ga0496105_0165166 3300048908 Bacteria 1816
337 Ga0496108_0043681 3300048911 Bacteria 3743
338 Ga0496109_0020414 3300048912 Bacteria 5852
339 Ga0496109_0404310 3300048912 Bacteria 1290
340 Ga0496110_0005024 3300048913 Bacteria 10333
341 Ga0496111_0044908 3300048914 Bacteria 3177
342 Ga0496114_0025747 3300048917 Bacteria 4811
343 Ga0496116_0051360 3300048919 Bacteria 2739
344 Ga0496116_0094788 3300048919 Bacteria 1803
345 Ga0496118_0065843 3300048921 Bacteria 2648
346 Ga0496121_0215435 3300048924 Bacteria 1357
347 Ga0496122_0001693 3300048925 Bacteria 34184
348 Ga0496123_0006735 3300048926 Bacteria 11052
349 Ga0496124_0046812 3300048927 Bacteria 3702
350 Ga0496126_0192324 3300048929 Bacteria 1727
351 Ga0501031_0000300 3300049568 Bacteria 28253
352 Ga0501031_0046281 3300049568 Bacteria 2837
353 Ga0501031_0198212 3300049568 Bacteria 1310
354 Ga0501032_0004122 3300049569 Bacteria 11011
355 Ga0501033_0023748 3300049570 Bacteria 4625
356 Ga0501033_0028471 3300049570 Bacteria 4197
357 Ga0501034_0048437 3300049571 Bacteria 4288
358 Ga0501034_0090052 3300049571 Bacteria 3066
359 Ga0501034_0425886 3300049571 Bacteria 1248
360 Ga0501034_0452302 3300049571 Bacteria 1202
361 Ga0501036_0000045 3300049572 Bacteria 78277
362 Ga0501036_0104316 3300049572 Unclassified 2397
363 Ga0501037_0011714 3300049573 Bacteria 6456
364 Ga0501038_0007503 3300049574 Bacteria 10056
365 Ga0501038_0012626 3300049574 Bacteria 7721
366 Ga0501040_0003260 3300049576 Bacteria 10481
367 Ga0501041_0003596 3300049577 Bacteria 8913
368 Ga0501042_0000826 3300049578 Bacteria 17189
369 Ga0501043_0001245 3300049579 Bacteria 22460
370 Ga0501043_0009921 3300049579 Bacteria 7466
371 Ga0501046_0000365 3300049580 Bacteria 45681
372 Ga0501046_0012013 3300049580 Bacteria 7387
373 Ga0501047_0004943 3300049581 Bacteria 12515
374 Ga0501047_0099378 3300049581 Bacteria 2789
375 Ga0501047_0517371 3300049581 Bacteria 1019
376 Ga0501048_0012751 3300049582 Bacteria 6250
377 Ga0501067_0002335 3300049583 Bacteria 10494
378 Ga0501068_0022319 3300049584 Bacteria 3700
379 Ga0501068_0134417 3300049584 Bacteria 1548
380 Ga0501069_0004591 3300049585 Bacteria 7144
381 Ga0501069_0212924 3300049585 Bacteria 1122
382 Ga0501070_0058851 3300049586 Bacteria 3185
383 Ga0501071_0054252 3300049587 Bacteria 2892
384 Ga0501072_0002297 3300049588 Bacteria 14312
385 Ga0501072_0032042 3300049588 Bacteria 4115
386 Ga0501073_0013771 3300049589 Bacteria 5883
387 Ga0501073_0057671 3300049589 Bacteria 2714
388 Ga0501074_0003029 3300049590 Bacteria 11837
389 Ga0501074_0036719 3300049590 Bacteria 3549
390 Ga0501075_0025702 3300049591 Bacteria 4326
391 Ga0501076_0000658 3300049592 Bacteria 22170
392 Ga0501077_0004182 3300049593 Bacteria 8719
393 Ga0501222_000031 3300049662 Bacteria 56867
394 Ga0501079_0170769 3300049741 Unclassified 1695
395 Ga0501080_0001038 3300049742 Bacteria 22821
396 Ga0501081_0004260 3300049743 Bacteria 9169
397 Ga0501083_0003306 3300049744 Bacteria 11263
398 Ga0501083_0025898 3300049744 Bacteria 4059
399 Ga0501083_0078328 3300049744 Bacteria 2193
400 Ga0501035_0001790 3300049822 Bacteria 21713
401 Ga0501035_0085686 3300049822 Bacteria 2776
402 Ga0501035_0124716 3300049822 Bacteria 2249
403 Ga0501044_0001026 3300049823 Bacteria 33660
404 Ga0501045_0000070 3300049824 Bacteria 47689
405 nmdc:mga00v17_116085_c1 3300050491 Bacteria 1701
406 nmdc:mga00v17_48106_c1 3300050491 Bacteria 2584
407 nmdc:mga07m45_121250_c1 3300050496 Bacteria 1510
408 nmdc:mga07m45_31539_c1 3300050496 Bacteria 2937
409 nmdc:mga09592_1109_c1 3300050508 Bacteria 21409
410 nmdc:mga0qj67_199487_c1 3300050509 Bacteria 1626
411 nmdc:mga08y16_1286_c1 3300050511 Bacteria 24919
412 nmdc:mga08y16_1295629_c1 3300050511 Bacteria 695
413 nmdc:mga08y16_289077_c1 3300050511 Bacteria 1690
414 nmdc:mga08y16_822309_c1 3300050511 Bacteria 920
415 nmdc:mga0n895_47201_c1 3300050512 Bacteria 4210
416 nmdc:mga0rr50_352017_c1 3300050513 Bacteria 1239
417 nmdc:mga0a205_155658_c1 3300050515 Bacteria 2184
418 nmdc:mga0sz30_35084_c1 3300050516 Bacteria 2091
419 Ga0495619_0419393 3300053085 Bacteria 923
420 Ga0500641_0007896 3300053096 Bacteria 3795
421 Ga0501084_0001240 3300054114 Bacteria 20084
422 Ga0501082_0118810 3300060353 Bacteria 2290
423 Ga0466962_0260025 3300061719 Bacteria 854
424 Ga0530510_0003829 3300061734 Bacteria 10370

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005337 Ga0070682_100056869 Ga0070682_1000568693 185
2 3300006871 Ga0075434_100344801 Ga0075434_1003448012 186
3 3300044658 Ga0466972_0176113 Ga0466972_0176113_399_974 187
4 3300046462 Ga0495651_0024322 Ga0495651_0024322_2161_2724 187
5 3300053085 Ga0495619_0419393 Ga0495619_0419393_43_606 187
6 3300046683 Ga0495658_0729382 Ga0495658_0729382_18_608 196
7 3300046539 Ga0495621_0036989 Ga0495621_0036989_420_1046 197
8 3300005445 Ga0070708_100595049 Ga0070708_1005950491 200
9 3300005468 Ga0070707_100266147 Ga0070707_1002661471 200
10 3300025910 Ga0207684_10461529 Ga0207684_104615292 200
11 3300031728 Ga0316578_10262032 Ga0316578_102620322 200
12 3300028577 Ga0265318_10001243 Ga0265318_1000124317 203
13 3300031238 Ga0265332_10127837 Ga0265332_101278372 203
14 3300031239 Ga0265328_10006395 Ga0265328_100063956 203
15 3300031240 Ga0265320_10153056 Ga0265320_101530561 203
16 3300031250 Ga0265331_10000887 Ga0265331_100008872 203
17 3300031344 Ga0265316_10011844 Ga0265316_100118441 203
18 3300031711 Ga0265314_10034544 Ga0265314_100345442 203
19 3300046491 Ga0495584_0002636 Ga0495584_0002636_7112_7744 204
20 3300046501 Ga0495607_0005877 Ga0495607_0005877_749_1381 204
21 3300046513 Ga0495616_0021199 Ga0495616_0021199_2596_3216 204
22 3300046528 Ga0495642_0012878 Ga0495642_0012878_1147_1779 204
23 3300046538 Ga0495609_0000173 Ga0495609_0000173_43239_43871 204
24 3300046616 Ga0495668_0007994 Ga0495668_0007994_4719_5351 204
25 3300046660 Ga0495625_0000578 Ga0495625_0000578_22651_23283 204
26 3300046664 Ga0495659_0029550 Ga0495659_0029550_1113_1733 204
27 3300046665 Ga0495661_0024112 Ga0495661_0024112_3258_3890 204
28 3300046684 Ga0495669_0000485 Ga0495669_0000485_14870_15502 204
29 3300046810 Ga0495660_0024465 Ga0495660_0024465_681_1313 204
30 3300047318 Ga0495636_0132203 Ga0495636_0132203_239_871 204
31 3300047443 Ga0495687_016027 Ga0495687_016027_2298_2918 204
32 3300047445 Ga0495677_0020134 Ga0495677_0020134_1504_2136 204
33 3300047470 Ga0495681_0038189 Ga0495681_0038189_1214_1846 204
34 iso_pu_bacteria 2643221569 2643861151 205
35 iso_pu_bacteria 2643221594 2643983386 205
36 iso_pu_bacteria 2643221621 2644124500 205
37 iso_pu_bacteria 2739367655 2739610584 205
38 iso_pu_bacteria 2808606395 2809032696 205
39 iso_pu_bacteria 2881927736 2881931231 205
40 3300036401 Ga0373937_0319468 Ga0373937_0319468_232_852 206
41 3300041498 Ga0451841_1014916 Ga0451841_1014916_67_687 206
42 3300049590 Ga0501074_0036719 Ga0501074_0036719_2273_2893 206
43 3300035398 Ga0316574_0314702 Ga0316574_0314702_207_830 207
44 3300050496 nmdc:mga07m45_121250_c1 nmdc:mga07m45_121250_c1_324_947 207
45 3300005336 Ga0070680_100067876 Ga0070680_1000678763 208
46 3300005344 Ga0070661_100002781 Ga0070661_1000027819 208
47 3300005364 Ga0070673_100375728 Ga0070673_1003757282 208
48 3300005458 Ga0070681_10056356 Ga0070681_100563562 208
49 3300005530 Ga0070679_100007610 Ga0070679_1000076107 208
50 3300005539 Ga0068853_100077187 Ga0068853_1000771872 208
51 3300006195 Ga0075366_10167667 Ga0075366_101676673 208
52 3300013100 Ga0157373_10007999 Ga0157373_100079995 208
53 3300013104 Ga0157370_10005229 Ga0157370_100052296 208
54 3300013307 Ga0157372_10027067 Ga0157372_100270672 208
55 3300025912 Ga0207707_10014085 Ga0207707_100140852 208
56 3300025917 Ga0207660_10133216 Ga0207660_101332162 208
57 3300025920 Ga0207649_10007895 Ga0207649_100078956 208
58 3300025921 Ga0207652_10006748 Ga0207652_100067487 208
59 3300025960 Ga0207651_10390138 Ga0207651_103901382 208
60 3300026041 Ga0207639_10086464 Ga0207639_100864642 208
61 3300031730 Ga0307516_10001028 Ga0307516_1000102839 208
62 3300036401 Ga0373937_0076404 Ga0373937_0076404_1655_2281 208
63 3300037471 Ga0395905_0005907 Ga0395905_0005907_5139_5771 208
64 3300042012 Ga0439455_0012859 Ga0439455_0012859_817_1455 208
65 3300042157 Ga0439458_0067789 Ga0439458_0067789_50_688 208
66 3300044683 Ga0466965_0056283 Ga0466965_0056283_124_750 208
67 3300044693 Ga0466961_0055885 Ga0466961_0055885_221_847 208
68 3300044719 Ga0466971_0039799 Ga0466971_0039799_14_640 208
69 3300044735 Ga0466968_0095284 Ga0466968_0095284_66_692 208
70 3300044842 Ga0466957_0062750 Ga0466957_0062750_1556_2182 208
71 3300045049 Ga0466959_0055489 Ga0466959_0055489_1573_2199 208
72 3300045051 Ga0451576_0151692 Ga0451576_0151692_180_806 208
73 3300045051 Ga0451576_0746265 Ga0451576_0746265_367_993 208
74 3300046457 Ga0495590_0015261 Ga0495590_0015261_97_729 208
75 3300049571 Ga0501034_0090052 Ga0501034_0090052_1145_1771 208
76 3300049581 Ga0501047_0517371 Ga0501047_0517371_380_1006 208
77 3300049583 Ga0501067_0002335 Ga0501067_0002335_5935_6561 208
78 3300049584 Ga0501068_0134417 Ga0501068_0134417_565_1191 208
79 3300049585 Ga0501069_0212924 Ga0501069_0212924_256_882 208
80 3300049586 Ga0501070_0058851 Ga0501070_0058851_729_1355 208
81 3300049588 Ga0501072_0032042 Ga0501072_0032042_3099_3725 208
82 3300049589 Ga0501073_0057671 Ga0501073_0057671_338_964 208
83 3300049742 Ga0501080_0001038 Ga0501080_0001038_15979_16605 208
84 3300049744 Ga0501083_0003306 Ga0501083_0003306_8967_9593 208
85 3300049744 Ga0501083_0078328 Ga0501083_0078328_259_885 208
86 3300049822 Ga0501035_0124716 Ga0501035_0124716_521_1147 208
87 3300005327 Ga0070658_10089749 Ga0070658_100897494 209
88 3300005328 Ga0070676_10041775 Ga0070676_100417754 209
89 3300005328 Ga0070676_10188126 Ga0070676_101881263 209
90 3300005328 Ga0070676_10403245 Ga0070676_104032452 209
91 3300005329 Ga0070683_100022468 Ga0070683_1000224684 209
92 3300005330 Ga0070690_100117565 Ga0070690_1001175652 209
93 3300005331 Ga0070670_100001197 Ga0070670_10000119718 209
94 3300005331 Ga0070670_100024701 Ga0070670_1000247014 209
95 3300005331 Ga0070670_100028265 Ga0070670_1000282655 209
96 3300005333 Ga0070677_10027242 Ga0070677_100272422 209
97 3300005334 Ga0068869_100070855 Ga0068869_1000708554 209
98 3300005338 Ga0068868_100003049 Ga0068868_10000304912 209
99 3300005339 Ga0070660_100003515 Ga0070660_10000351512 209
100 3300005340 Ga0070689_100541829 Ga0070689_1005418292 209
101 3300005343 Ga0070687_100397196 Ga0070687_1003971962 209
102 3300005344 Ga0070661_100003527 Ga0070661_1000035275 209
103 3300005344 Ga0070661_100024587 Ga0070661_1000245874 209
104 3300005347 Ga0070668_100001234 Ga0070668_10000123414 209
105 3300005347 Ga0070668_100134402 Ga0070668_1001344022 209
106 3300005353 Ga0070669_100073138 Ga0070669_1000731383 209
107 3300005354 Ga0070675_100015295 Ga0070675_1000152955 209
108 3300005354 Ga0070675_100015455 Ga0070675_1000154555 209
109 3300005355 Ga0070671_100000422 Ga0070671_1000004227 209
110 3300005355 Ga0070671_100071860 Ga0070671_1000718602 209
111 3300005356 Ga0070674_100130855 Ga0070674_1001308552 209
112 3300005356 Ga0070674_100168478 Ga0070674_1001684782 209
113 3300005356 Ga0070674_100179210 Ga0070674_1001792102 209
114 3300005356 Ga0070674_100513377 Ga0070674_1005133772 209
115 3300005364 Ga0070673_100000427 Ga0070673_10000042713 209
116 3300005364 Ga0070673_100007645 Ga0070673_1000076455 209
117 3300005364 Ga0070673_100015599 Ga0070673_1000155993 209
118 3300005364 Ga0070673_100176262 Ga0070673_1001762623 209
119 3300005364 Ga0070673_100290764 Ga0070673_1002907642 209
120 3300005366 Ga0070659_100000556 Ga0070659_10000055622 209
121 3300005367 Ga0070667_100267206 Ga0070667_1002672062 209
122 3300005367 Ga0070667_100735233 Ga0070667_1007352331 209
123 3300005406 Ga0070703_10161282 Ga0070703_101612822 209
124 3300005439 Ga0070711_100270729 Ga0070711_1002707292 209
125 3300005441 Ga0070700_100158615 Ga0070700_1001586151 209
126 3300005444 Ga0070694_100436834 Ga0070694_1004368342 209
127 3300005445 Ga0070708_100081242 Ga0070708_1000812424 209
128 3300005445 Ga0070708_100089294 Ga0070708_1000892943 209
129 3300005455 Ga0070663_100384115 Ga0070663_1003841152 209
130 3300005455 Ga0070663_100481131 Ga0070663_1004811312 209
131 3300005456 Ga0070678_100003766 Ga0070678_1000037669 209
132 3300005456 Ga0070678_100452954 Ga0070678_1004529542 209
133 3300005457 Ga0070662_100068697 Ga0070662_1000686973 209
134 3300005457 Ga0070662_100118399 Ga0070662_1001183992 209
135 3300005457 Ga0070662_100265082 Ga0070662_1002650822 209
136 3300005459 Ga0068867_100000054 Ga0068867_10000005449 209
137 3300005459 Ga0068867_100057185 Ga0068867_1000571853 209
138 3300005459 Ga0068867_100190079 Ga0068867_1001900792 209
139 3300005459 Ga0068867_100469258 Ga0068867_1004692581 209
140 3300005466 Ga0070685_10241745 Ga0070685_102417452 209
141 3300005467 Ga0070706_100155667 Ga0070706_1001556671 209
142 3300005468 Ga0070707_100152978 Ga0070707_1001529782 209
143 3300005471 Ga0070698_100200424 Ga0070698_1002004242 209
144 3300005518 Ga0070699_100087025 Ga0070699_1000870254 209
145 3300005535 Ga0070684_100140344 Ga0070684_1001403442 209
146 3300005536 Ga0070697_100392336 Ga0070697_1003923361 209
147 3300005539 Ga0068853_100368750 Ga0068853_1003687502 209
148 3300005543 Ga0070672_100000765 Ga0070672_1000007653 209
149 3300005543 Ga0070672_100001631 Ga0070672_10000163114 209
150 3300005543 Ga0070672_100162353 Ga0070672_1001623531 209
151 3300005546 Ga0070696_100491011 Ga0070696_1004910112 209
152 3300005547 Ga0070693_100178896 Ga0070693_1001788963 209
153 3300005548 Ga0070665_100023334 Ga0070665_1000233347 209
154 3300005548 Ga0070665_100682628 Ga0070665_1006826282 209
155 3300005564 Ga0070664_100025475 Ga0070664_1000254754 209
156 3300005564 Ga0070664_100041908 Ga0070664_1000419085 209
157 3300005577 Ga0068857_100069980 Ga0068857_1000699802 209
158 3300005578 Ga0068854_100006612 Ga0068854_1000066126 209
159 3300005614 Ga0068856_100038070 Ga0068856_1000380703 209
160 3300005614 Ga0068856_101104366 Ga0068856_1011043661 209
161 3300005616 Ga0068852_100000755 Ga0068852_10000075515 209
162 3300005616 Ga0068852_100056345 Ga0068852_1000563455 209
163 3300005617 Ga0068859_101780864 Ga0068859_1017808641 209
164 3300005618 Ga0068864_100010763 Ga0068864_1000107637 209
165 3300005718 Ga0068866_10308286 Ga0068866_103082861 209
166 3300005719 Ga0068861_100050223 Ga0068861_1000502235 209
167 3300005834 Ga0068851_10039177 Ga0068851_100391773 209
168 3300005841 Ga0068863_100003205 Ga0068863_10000320518 209
169 3300005841 Ga0068863_100591148 Ga0068863_1005911481 209
170 3300005841 Ga0068863_100861266 Ga0068863_1008612662 209
171 3300005843 Ga0068860_100170043 Ga0068860_1001700432 209
172 3300005843 Ga0068860_100263626 Ga0068860_1002636263 209
173 3300005844 Ga0068862_100173512 Ga0068862_1001735123 209
174 3300005844 Ga0068862_100752509 Ga0068862_1007525092 209
175 3300005844 Ga0068862_101237747 Ga0068862_1012377471 209
176 3300006051 Ga0075364_10014384 Ga0075364_100143842 209
177 3300006051 Ga0075364_10087154 Ga0075364_100871542 209
178 3300006173 Ga0070716_100347085 Ga0070716_1003470852 209
179 3300006186 Ga0075369_10021563 Ga0075369_100215633 209
180 3300006195 Ga0075366_10007340 Ga0075366_100073404 209
181 3300006237 Ga0097621_100013262 Ga0097621_1000132626 209
182 3300006237 Ga0097621_100096169 Ga0097621_1000961693 209
183 3300006237 Ga0097621_100307829 Ga0097621_1003078293 209
184 3300006237 Ga0097621_100373640 Ga0097621_1003736401 209
185 3300006353 Ga0075370_10040634 Ga0075370_100406343 209
186 3300006358 Ga0068871_100045967 Ga0068871_1000459673 209
187 3300006358 Ga0068871_100053811 Ga0068871_1000538114 209
188 3300006358 Ga0068871_100067804 Ga0068871_1000678045 209
189 3300006358 Ga0068871_100087526 Ga0068871_1000875262 209
190 3300006358 Ga0068871_100291717 Ga0068871_1002917173 209
191 3300006844 Ga0075428_100000298 Ga0075428_10000029820 209
192 3300006852 Ga0075433_10013686 Ga0075433_100136867 209
193 3300006871 Ga0075434_100048453 Ga0075434_1000484533 209
194 3300006880 Ga0075429_100006177 Ga0075429_1000061774 209
195 3300006880 Ga0075429_100007054 Ga0075429_10000705410 209
196 3300006914 Ga0075436_100077975 Ga0075436_1000779754 209
197 3300006931 Ga0097620_101780990 Ga0097620_1017809901 209
198 3300007076 Ga0075435_100334081 Ga0075435_1003340812 209
199 3300009093 Ga0105240_10014286 Ga0105240_100142867 209
200 3300009098 Ga0105245_10066310 Ga0105245_100663103 209
201 3300009098 Ga0105245_10071791 Ga0105245_100717913 209
202 3300009098 Ga0105245_10660243 Ga0105245_106602431 209
203 3300009101 Ga0105247_10316671 Ga0105247_103166712 209
204 3300009147 Ga0114129_10179079 Ga0114129_101790793 209
205 3300009147 Ga0114129_10405186 Ga0114129_104051862 209
206 3300009148 Ga0105243_10086947 Ga0105243_100869475 209
207 3300009176 Ga0105242_11380373 Ga0105242_113803731 209
208 3300009177 Ga0105248_11325858 Ga0105248_113258581 209
209 3300009545 Ga0105237_10494151 Ga0105237_104941512 209
210 3300009551 Ga0105238_10457285 Ga0105238_104572851 209
211 3300013296 Ga0157374_10178576 Ga0157374_101785763 209
212 3300013297 Ga0157378_10057680 Ga0157378_100576803 209
213 3300013306 Ga0163162_10056926 Ga0163162_100569264 209
214 3300013306 Ga0163162_10590107 Ga0163162_105901072 209
215 3300013307 Ga0157372_10834222 Ga0157372_108342222 209
216 3300013308 Ga0157375_10169650 Ga0157375_101696502 209
217 3300014326 Ga0157380_10017562 Ga0157380_100175622 209
218 3300014326 Ga0157380_10040379 Ga0157380_100403792 209
219 3300014326 Ga0157380_10077405 Ga0157380_100774053 209
220 3300014326 Ga0157380_10382288 Ga0157380_103822882 209
221 3300014326 Ga0157380_10393462 Ga0157380_103934622 209
222 3300014745 Ga0157377_10000006 Ga0157377_10000006381 209
223 3300014969 Ga0157376_10007541 Ga0157376_100075418 209
224 3300014969 Ga0157376_10041283 Ga0157376_100412832 209
225 3300014969 Ga0157376_10223801 Ga0157376_102238012 209
226 3300017792 Ga0163161_10059727 Ga0163161_100597275 209
227 3300017792 Ga0163161_10230450 Ga0163161_102304501 209
228 3300017792 Ga0163161_10806105 Ga0163161_108061051 209
229 3300020078 Ga0206352_10665777 Ga0206352_106657772 209
230 3300025315 Ga0207697_10013356 Ga0207697_100133562 209
231 3300025321 Ga0207656_10057046 Ga0207656_100570462 209
232 3300025903 Ga0207680_10015805 Ga0207680_100158054 209
233 3300025910 Ga0207684_10086908 Ga0207684_100869084 209
234 3300025910 Ga0207684_10566591 Ga0207684_105665912 209
235 3300025914 Ga0207671_10294261 Ga0207671_102942612 209
236 3300025918 Ga0207662_10397056 Ga0207662_103970561 209
237 3300025919 Ga0207657_10002601 Ga0207657_1000260122 209
238 3300025922 Ga0207646_10006539 Ga0207646_100065395 209
239 3300025923 Ga0207681_10018473 Ga0207681_100184735 209
240 3300025923 Ga0207681_10268942 Ga0207681_102689422 209
241 3300025923 Ga0207681_10373910 Ga0207681_103739102 209
242 3300025923 Ga0207681_10601556 Ga0207681_106015561 209
243 3300025925 Ga0207650_10028688 Ga0207650_100286885 209
244 3300025926 Ga0207659_10005506 Ga0207659_100055068 209
245 3300025926 Ga0207659_10007871 Ga0207659_100078716 209
246 3300025927 Ga0207687_10063374 Ga0207687_100633743 209
247 3300025931 Ga0207644_10000382 Ga0207644_100003828 209
248 3300025932 Ga0207690_10002227 Ga0207690_100022272 209
249 3300025933 Ga0207706_10073246 Ga0207706_100732463 209
250 3300025933 Ga0207706_10129540 Ga0207706_101295402 209
251 3300025933 Ga0207706_10277537 Ga0207706_102775372 209
252 3300025935 Ga0207709_10001742 Ga0207709_100017428 209
253 3300025936 Ga0207670_10079482 Ga0207670_100794824 209
254 3300025936 Ga0207670_10319079 Ga0207670_103190792 209
255 3300025937 Ga0207669_10051658 Ga0207669_100516582 209
256 3300025937 Ga0207669_10065274 Ga0207669_100652742 209
257 3300025940 Ga0207691_10001510 Ga0207691_1000151015 209
258 3300025940 Ga0207691_10008589 Ga0207691_100085894 209
259 3300025940 Ga0207691_10019836 Ga0207691_100198366 209
260 3300025945 Ga0207679_10001241 Ga0207679_1000124112 209
261 3300025945 Ga0207679_10005879 Ga0207679_100058798 209
262 3300025945 Ga0207679_10568479 Ga0207679_105684792 209
263 3300025945 Ga0207679_10792769 Ga0207679_107927692 209
264 3300025960 Ga0207651_10010878 Ga0207651_100108783 209
265 3300025960 Ga0207651_10119921 Ga0207651_101199211 209
266 3300025960 Ga0207651_10383470 Ga0207651_103834702 209
267 3300025961 Ga0207712_10226879 Ga0207712_102268792 209
268 3300025972 Ga0207668_10070956 Ga0207668_100709562 209
269 3300025972 Ga0207668_10353871 Ga0207668_103538712 209
270 3300025981 Ga0207640_10002049 Ga0207640_100020494 209
271 3300025981 Ga0207640_10140526 Ga0207640_101405263 209
272 3300026023 Ga0207677_10036288 Ga0207677_100362884 209
273 3300026023 Ga0207677_10147226 Ga0207677_101472262 209
274 3300026041 Ga0207639_10167632 Ga0207639_101676322 209
275 3300026067 Ga0207678_10922524 Ga0207678_109225241 209
276 3300026075 Ga0207708_10081515 Ga0207708_100815151 209
277 3300026075 Ga0207708_10693615 Ga0207708_106936152 209
278 3300026078 Ga0207702_10131876 Ga0207702_101318763 209
279 3300026088 Ga0207641_10013568 Ga0207641_100135685 209
280 3300026088 Ga0207641_10067809 Ga0207641_100678092 209
281 3300026088 Ga0207641_10179722 Ga0207641_101797222 209
282 3300026089 Ga0207648_10000254 Ga0207648_1000025429 209
283 3300026089 Ga0207648_10024396 Ga0207648_100243965 209
284 3300026089 Ga0207648_10033096 Ga0207648_100330962 209
285 3300026089 Ga0207648_10189055 Ga0207648_101890551 209
286 3300026089 Ga0207648_10399221 Ga0207648_103992212 209
287 3300026095 Ga0207676_10023822 Ga0207676_100238223 209
288 3300026095 Ga0207676_10053113 Ga0207676_100531132 209
289 3300026116 Ga0207674_10342361 Ga0207674_103423612 209
290 3300026118 Ga0207675_100069392 Ga0207675_1000693922 209
291 3300026118 Ga0207675_100870113 Ga0207675_1008701132 209
292 3300026121 Ga0207683_10000350 Ga0207683_1000035026 209
293 3300026121 Ga0207683_10404439 Ga0207683_104044392 209
294 3300026142 Ga0207698_10007084 Ga0207698_100070848 209
295 3300026142 Ga0207698_10044898 Ga0207698_100448982 209
296 3300027312 Ga0209371_1014048 Ga0209371_10140482 209
297 3300027907 Ga0207428_10006015 Ga0207428_100060154 209
298 3300027907 Ga0207428_10438530 Ga0207428_104385301 209
299 3300028380 Ga0268265_10154031 Ga0268265_101540312 209
300 3300028380 Ga0268265_11037789 Ga0268265_110377892 209
301 3300028381 Ga0268264_10020106 Ga0268264_100201062 209
302 3300031235 Ga0265330_10018387 Ga0265330_100183875 209
303 3300031238 Ga0265332_10005370 Ga0265332_100053702 209
304 3300031242 Ga0265329_10003340 Ga0265329_100033405 209
305 3300031249 Ga0265339_10038328 Ga0265339_100383285 209
306 3300031250 Ga0265331_10000487 Ga0265331_1000048719 209
307 3300031251 Ga0265327_10018554 Ga0265327_100185542 209
308 3300031344 Ga0265316_10012941 Ga0265316_100129417 209
309 3300031712 Ga0265342_10137274 Ga0265342_101372742 209
310 3300031731 Ga0307405_10115414 Ga0307405_101154142 209
311 3300031852 Ga0307410_10504613 Ga0307410_105046132 209
312 3300031911 Ga0307412_10322335 Ga0307412_103223352 209
313 3300032002 Ga0307416_100507409 Ga0307416_1005074091 209
314 3300032002 Ga0307416_101145232 Ga0307416_1011452321 209
315 3300035120 Ga0373957_0166510 Ga0373957_0166510_218_847 209
316 3300035410 Ga0373924_0007823 Ga0373924_0007823_1282_1911 209
317 3300035695 Ga0373927_0006064 Ga0373927_0006064_3632_4261 209
318 3300037068 Ga0373925_0259648 Ga0373925_0259648_594_1223 209
319 3300037312 Ga0395899_0131036 Ga0395899_0131036_1056_1697 209
320 3300037471 Ga0395905_0018689 Ga0395905_0018689_600_1241 209
321 3300038443 Ga0395901_0002767 Ga0395901_0002767_3864_4499 209
322 3300038443 Ga0395901_0096796 Ga0395901_0096796_2346_2984 209
323 3300038443 Ga0395901_0616879 Ga0395901_0616879_359_1000 209
324 3300041501 Ga0451845_0529383 Ga0451845_0529383_38_667 209
325 3300041509 Ga0451843_1697151 Ga0451843_1697151_125_754 209
326 3300041512 Ga0451853_1683080 Ga0451853_1683080_2470_3099 209
327 3300042001 Ga0439441_001925 Ga0439441_001925_1255_1884 209
328 3300042436 Ga0439435_0058698 Ga0439435_0058698_380_1009 209
329 3300042876 Ga0451577_0214601 Ga0451577_0214601_528_1157 209
330 3300042876 Ga0451577_0236698 Ga0451577_0236698_37_732 209
331 3300044656 Ga0466969_0053778 Ga0466969_0053778_321_962 209
332 3300044658 Ga0466972_0000224 Ga0466972_0000224_28532_29194 209
333 3300044658 Ga0466972_0000934 Ga0466972_0000934_12048_12677 209
334 3300044658 Ga0466972_0010208 Ga0466972_0010208_1496_2158 209
335 3300044683 Ga0466965_0000404 Ga0466965_0000404_10861_11523 209
336 3300044684 Ga0466966_0031683 Ga0466966_0031683_2368_3009 209
337 3300044684 Ga0466966_0196049 Ga0466966_0196049_371_1033 209
338 3300044693 Ga0466961_0191714 Ga0466961_0191714_87_728 209
339 3300044706 Ga0466964_0143158 Ga0466964_0143158_33_674 209
340 3300044706 Ga0466964_0337464 Ga0466964_0337464_49_711 209
341 3300044712 Ga0453684_0009638 Ga0453684_0009638_864_1493 209
342 3300044712 Ga0453684_0965925 Ga0453684_0965925_68_697 209
343 3300044719 Ga0466971_0059533 Ga0466971_0059533_412_1053 209
344 3300044735 Ga0466968_0009095 Ga0466968_0009095_1347_2009 209
345 3300044735 Ga0466968_0303432 Ga0466968_0303432_89_730 209
346 3300044765 Ga0466970_0013917 Ga0466970_0013917_3375_4028 209
347 3300045049 Ga0466959_0006284 Ga0466959_0006284_6525_7178 209
348 3300045049 Ga0466959_0124050 Ga0466959_0124050_139_780 209
349 3300045051 Ga0451576_0016983 Ga0451576_0016983_133_762 209
350 3300045051 Ga0451576_0107975 Ga0451576_0107975_865_1503 209
351 3300045051 Ga0451576_0560842 Ga0451576_0560842_426_1121 209
352 3300046472 Ga0495580_0210484 Ga0495580_0210484_648_1277 209
353 3300046539 Ga0495621_0220758 Ga0495621_0220758_76_705 209
354 3300046691 Ga0495670_0245725 Ga0495670_0245725_127_756 209
355 3300048903 Ga0496100_0492336 Ga0496100_0492336_81_710 209
356 3300048904 Ga0496101_0121980 Ga0496101_0121980_1166_1795 209
357 3300048908 Ga0496105_0165166 Ga0496105_0165166_711_1340 209
358 3300048911 Ga0496108_0043681 Ga0496108_0043681_2619_3248 209
359 3300048912 Ga0496109_0020414 Ga0496109_0020414_1151_1780 209
360 3300048912 Ga0496109_0404310 Ga0496109_0404310_102_773 209
361 3300048913 Ga0496110_0005024 Ga0496110_0005024_8806_9435 209
362 3300048914 Ga0496111_0044908 Ga0496111_0044908_1968_2597 209
363 3300048917 Ga0496114_0025747 Ga0496114_0025747_2144_2773 209
364 3300048919 Ga0496116_0051360 Ga0496116_0051360_1631_2284 209
365 3300048919 Ga0496116_0094788 Ga0496116_0094788_938_1591 209
366 3300048921 Ga0496118_0065843 Ga0496118_0065843_1181_1861 209
367 3300048924 Ga0496121_0215435 Ga0496121_0215435_453_1106 209
368 3300048925 Ga0496122_0001693 Ga0496122_0001693_2475_3128 209
369 3300048926 Ga0496123_0006735 Ga0496123_0006735_7986_8639 209
370 3300048927 Ga0496124_0046812 Ga0496124_0046812_995_1648 209
371 3300048929 Ga0496126_0192324 Ga0496126_0192324_631_1284 209
372 3300049568 Ga0501031_0000300 Ga0501031_0000300_26334_26966 209
373 3300049568 Ga0501031_0046281 Ga0501031_0046281_504_1136 209
374 3300049568 Ga0501031_0198212 Ga0501031_0198212_174_806 209
375 3300049569 Ga0501032_0004122 Ga0501032_0004122_4084_4716 209
376 3300049570 Ga0501033_0023748 Ga0501033_0023748_633_1265 209
377 3300049570 Ga0501033_0028471 Ga0501033_0028471_818_1450 209
378 3300049571 Ga0501034_0048437 Ga0501034_0048437_2912_3544 209
379 3300049571 Ga0501034_0425886 Ga0501034_0425886_518_1171 209
380 3300049571 Ga0501034_0452302 Ga0501034_0452302_34_675 209
381 3300049572 Ga0501036_0000045 Ga0501036_0000045_59991_60623 209
382 3300049572 Ga0501036_0104316 Ga0501036_0104316_1357_1989 209
383 3300049573 Ga0501037_0011714 Ga0501037_0011714_1920_2552 209
384 3300049574 Ga0501038_0007503 Ga0501038_0007503_8656_9288 209
385 3300049574 Ga0501038_0012626 Ga0501038_0012626_321_953 209
386 3300049576 Ga0501040_0003260 Ga0501040_0003260_7795_8427 209
387 3300049577 Ga0501041_0003596 Ga0501041_0003596_1851_2483 209
388 3300049578 Ga0501042_0000826 Ga0501042_0000826_14388_15020 209
389 3300049579 Ga0501043_0001245 Ga0501043_0001245_20633_21265 209
390 3300049579 Ga0501043_0009921 Ga0501043_0009921_2764_3396 209
391 3300049580 Ga0501046_0000365 Ga0501046_0000365_43064_43696 209
392 3300049580 Ga0501046_0012013 Ga0501046_0012013_754_1386 209
393 3300049581 Ga0501047_0004943 Ga0501047_0004943_10314_10946 209
394 3300049581 Ga0501047_0099378 Ga0501047_0099378_1416_2048 209
395 3300049582 Ga0501048_0012751 Ga0501048_0012751_3857_4489 209
396 3300049584 Ga0501068_0022319 Ga0501068_0022319_2202_2834 209
397 3300049585 Ga0501069_0004591 Ga0501069_0004591_3963_4595 209
398 3300049587 Ga0501071_0054252 Ga0501071_0054252_373_1005 209
399 3300049588 Ga0501072_0002297 Ga0501072_0002297_11818_12450 209
400 3300049589 Ga0501073_0013771 Ga0501073_0013771_3409_4041 209
401 3300049590 Ga0501074_0003029 Ga0501074_0003029_55_687 209
402 3300049591 Ga0501075_0025702 Ga0501075_0025702_2033_2665 209
403 3300049592 Ga0501076_0000658 Ga0501076_0000658_2955_3587 209
404 3300049593 Ga0501077_0004182 Ga0501077_0004182_2567_3199 209
405 3300049662 Ga0501222_000031 Ga0501222_000031_26306_26950 209
406 3300049741 Ga0501079_0170769 Ga0501079_0170769_691_1323 209
407 3300049743 Ga0501081_0004260 Ga0501081_0004260_5267_5899 209
408 3300049744 Ga0501083_0025898 Ga0501083_0025898_1003_1635 209
409 3300049822 Ga0501035_0001790 Ga0501035_0001790_13559_14191 209
410 3300049822 Ga0501035_0085686 Ga0501035_0085686_181_813 209
411 3300049823 Ga0501044_0001026 Ga0501044_0001026_775_1407 209
412 3300049824 Ga0501045_0000070 Ga0501045_0000070_4246_4878 209
413 3300050491 nmdc:mga00v17_116085_c1 nmdc:mga00v17_116085_c1_271_900 209
414 3300050491 nmdc:mga00v17_48106_c1 nmdc:mga00v17_48106_c1_614_1267 209
415 3300050496 nmdc:mga07m45_31539_c1 nmdc:mga07m45_31539_c1_1253_1882 209
416 3300050508 nmdc:mga09592_1109_c1 nmdc:mga09592_1109_c1_6733_7362 209
417 3300050509 nmdc:mga0qj67_199487_c1 nmdc:mga0qj67_199487_c1_718_1347 209
418 3300050511 nmdc:mga08y16_1286_c1 nmdc:mga08y16_1286_c1_5026_5655 209
419 3300050511 nmdc:mga08y16_1295629_c1 nmdc:mga08y16_1295629_c1_51_680 209
420 3300050511 nmdc:mga08y16_289077_c1 nmdc:mga08y16_289077_c1_993_1622 209
421 3300050511 nmdc:mga08y16_822309_c1 nmdc:mga08y16_822309_c1_206_847 209
422 3300050512 nmdc:mga0n895_47201_c1 nmdc:mga0n895_47201_c1_2015_2644 209
423 3300050513 nmdc:mga0rr50_352017_c1 nmdc:mga0rr50_352017_c1_25_654 209
424 3300050515 nmdc:mga0a205_155658_c1 nmdc:mga0a205_155658_c1_1082_1711 209
425 3300050516 nmdc:mga0sz30_35084_c1 nmdc:mga0sz30_35084_c1_732_1361 209
426 3300053096 Ga0500641_0007896 Ga0500641_0007896_1715_2344 209
427 3300054114 Ga0501084_0001240 Ga0501084_0001240_18683_19315 209
428 3300060353 Ga0501082_0118810 Ga0501082_0118810_872_1504 209
429 3300061719 Ga0466962_0260025 Ga0466962_0260025_190_831 209
430 3300061734 Ga0530510_0003829 Ga0530510_0003829_8686_9318 209

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01161

PBP

Phosphatidylethanolamine-binding protein

35

223

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3n08-assembly1.cif.gz_B crystal structure of a putative phosphatidylethanolamine-binding protein (pebp) homolog ct736 from chlamydia trachomatis d/uw-3/cx 0.8953 3 201
1vi3-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.8863 3 202
1fjj-assembly1.cif.gz_A-2 crystal structure of e.coli ybhb protein, a new member of the mammalian pebp family 0.8862 3 202
4beg-assembly1.cif.gz_A structure of rv2140c, a phosphatidyl-ethanolamine binding protein from mycobacterium tuberculosis in complex with sulphate 0.8861 2 202
1fux-assembly1.cif.gz_B crystal structure of e.coli ybcl, a new member of the mammalian pebp family 0.8673 2 202
ID Description Score Start End Superfamily
3n08A00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.9009 2 201 3.90.280.10
4begB00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8959 2 202 3.90.280.10
1fjjA00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8801 1 199 3.90.280.10
af_P77368_20_183_3.90.280.10 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8724 2 202 3.90.280.10
3n08A00 Alpha Beta;Alpha-Beta Complex;Phosphatidylethanolamine-binding Protein;PEBP-like 0.8667 2 201 3.90.280.10
ID Description Score Start End GO Terms
AF-A0A257QJA4-F1-model_v4 Pyruvate, phosphate dikinase (Pyruvate, orthophosphate dikinase) 0.9995 28 207 GO:0006090
GO:0050242
AF-C3X4Y9-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9989 1 207
AF-A0A536Z6T9-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9981 19 206
AF-A0A7I8ECA7-F1-model_v4 Phospholipid-binding protein 0.9974 1 208
AF-A0A4Y6PTT7-F1-model_v4 YbhB/YbcL family Raf kinase inhibitor-like protein 0.9971 1 205

Feature Viewer

pLDDT pTM Quality
96.3 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map