F442192

General Info

Members Datasets Scaffolds Average Seq Length
430 224 860 111

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_1602607|Ga0436363_1602607_187_573
Length 128
Sequence MTKTTSDRLRGTLDALILKALLAGPLHGYGISRWLRTRARALRVEEGTLYPALYRLERLGWIEAEWGSSELGRRARFYRLTPEGERQLEAEIRTFAEFVAAVSPILLPGWRADGAPALAGAAAAAPQG

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
57 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
58 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
135 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
136 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
137 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
138 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
139 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
140 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
141 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
142 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
146 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
147 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
148 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300038698 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot15 Metagenome Rhizosphere
153 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
154 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
155 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
156 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
157 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
158 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
159 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
160 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
161 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
162 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
165 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
166 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
173 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
174 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
177 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
178 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
179 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
180 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
181 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
182 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
183 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
184 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
187 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
188 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
189 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
193 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
194 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
195 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
196 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
197 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
198 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
199 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
202 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
203 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
204 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
205 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
206 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
208 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
209 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
210 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
211 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
212 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
213 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
214 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
215 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
216 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
221 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
223 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
224 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.86
Nodule 0
Rhizoplane 4.65
Rhizosphere 92.33
Stem 0
Stem Tuber 0
Unclassified 18.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_1602607 3300039450 Bacteria 590
2 Ga0065712_10079596 3300005290 Unclassified 3201
3 Ga0065712_10106688 3300005290 Bacteria 1912
4 Ga0065712_10384426 3300005290 Bacteria 748
5 Ga0065715_10316685 3300005293 Bacteria 1010
6 Ga0065715_10347856 3300005293 Bacteria 937
7 Ga0065715_10439272 3300005293 Unclassified 838
8 Ga0065715_10719170 3300005293 Bacteria 644
9 Ga0065707_10061023 3300005295 Bacteria 793
10 Ga0070683_101834225 3300005329 Bacteria 583
11 Ga0070670_100224330 3300005331 Bacteria 1635
12 Ga0070670_100697739 3300005331 Bacteria 913
13 Ga0070677_10187092 3300005333 Unclassified 990
14 Ga0070677_10480895 3300005333 Unclassified 670
15 Ga0070677_10811221 3300005333 Bacteria 535
16 Ga0070666_10142385 3300005335 Bacteria 1670
17 Ga0070680_100082745 3300005336 Bacteria 2650
18 Ga0070680_100159881 3300005336 Bacteria 1893
19 Ga0068868_101767728 3300005338 Bacteria 584
20 Ga0070660_101721773 3300005339 Bacteria 534
21 Ga0070689_100244545 3300005340 Bacteria 1479
22 Ga0070689_100382849 3300005340 Bacteria 1186
23 Ga0070689_102221420 3300005340 Bacteria 503
24 Ga0070687_100095769 3300005343 Bacteria 1651
25 Ga0070661_100158688 3300005344 Bacteria 1712
26 Ga0070661_101486479 3300005344 Bacteria 571
27 Ga0070668_100039908 3300005347 Bacteria 3591
28 Ga0070668_101441986 3300005347 Bacteria 628
29 Ga0070668_101568790 3300005347 Bacteria 603
30 Ga0070669_100496312 3300005353 Bacteria 1012
31 Ga0070669_100757449 3300005353 Bacteria 823
32 Ga0070669_101059293 3300005353 Unclassified 697
33 Ga0070675_100073195 3300005354 Bacteria 2845
34 Ga0070675_100315483 3300005354 Bacteria 1380
35 Ga0070675_100330771 3300005354 Bacteria 1348
36 Ga0070671_100018344 3300005355 Bacteria 5683
37 Ga0070671_100291634 3300005355 Bacteria 1388
38 Ga0070674_100730820 3300005356 Bacteria 849
39 Ga0070674_100948077 3300005356 Bacteria 752
40 Ga0070673_100043710 3300005364 Bacteria 3464
41 Ga0070688_100190639 3300005365 Bacteria 1428
42 Ga0070688_100528041 3300005365 Bacteria 894
43 Ga0070659_100025538 3300005366 Bacteria 4539
44 Ga0070659_101024595 3300005366 Archaea 725
45 Ga0070667_100005819 3300005367 Bacteria 10283
46 Ga0070667_100156662 3300005367 Bacteria 2004
47 Ga0070703_10270459 3300005406 Bacteria 697
48 Ga0070711_100001564 3300005439 Bacteria 12599
49 Ga0070711_100089071 3300005439 Bacteria 2219
50 Ga0070705_100063141 3300005440 Bacteria 2208
51 Ga0070705_101024677 3300005440 Bacteria 671
52 Ga0070708_101535058 3300005445 Bacteria 620
53 Ga0070663_102092018 3300005455 Bacteria 510
54 Ga0070678_100020573 3300005456 Bacteria 4332
55 Ga0070678_100343094 3300005456 Bacteria 1282
56 Ga0070678_100985397 3300005456 Bacteria 774
57 Ga0070678_102253570 3300005456 Bacteria 517
58 Ga0070662_100144926 3300005457 Bacteria 1844
59 Ga0070681_10080330 3300005458 Bacteria 3217
60 Ga0070681_10510155 3300005458 Bacteria 1116
61 Ga0068867_100188152 3300005459 Bacteria 1646
62 Ga0070685_10394145 3300005466 Bacteria 957
63 Ga0070706_100942051 3300005467 Bacteria 797
64 Ga0070707_100719949 3300005468 Bacteria 961
65 Ga0070698_100475843 3300005471 Unclassified 1186
66 Ga0070699_101574538 3300005518 Bacteria 602
67 Ga0070679_100138679 3300005530 Bacteria 2413
68 Ga0070679_100439385 3300005530 Bacteria 1250
69 Ga0070672_100004590 3300005543 Bacteria 9044
70 Ga0070672_100080550 3300005543 Bacteria 2609
71 Ga0070672_101678939 3300005543 Unclassified 570
72 Ga0070686_100823689 3300005544 Unclassified 750
73 Ga0070665_100171776 3300005548 Bacteria 2169
74 Ga0070664_101493862 3300005564 Bacteria 639
75 Ga0068857_100100263 3300005577 Unclassified 2598
76 Ga0068854_100782685 3300005578 Bacteria 830
77 Ga0068854_102283273 3300005578 Unclassified 501
78 Ga0070702_100107148 3300005615 Bacteria 1725
79 Ga0068852_100654924 3300005616 Bacteria 1058
80 Ga0068859_100239652 3300005617 Bacteria 1903
81 Ga0068859_100451802 3300005617 Bacteria 1381
82 Ga0068859_100578264 3300005617 Bacteria 1217
83 Ga0068859_100647530 3300005617 Bacteria 1149
84 Ga0068859_100716298 3300005617 Bacteria 1091
85 Ga0068870_10628009 3300005840 Bacteria 733
86 Ga0068863_100000533 3300005841 Bacteria 38898
87 Ga0068863_101249739 3300005841 Unclassified 749
88 Ga0068858_100988971 3300005842 Bacteria 824
89 Ga0068858_101733779 3300005842 Unclassified 617
90 Ga0068860_102108395 3300005843 Bacteria 585
91 Ga0068862_100869082 3300005844 Bacteria 885
92 Ga0068862_101608079 3300005844 Bacteria 657
93 Ga0068862_102202900 3300005844 Bacteria 563
94 Ga0075368_10249603 3300006042 Bacteria 758
95 Ga0075364_10255660 3300006051 Bacteria 1191
96 Ga0070712_100451754 3300006175 Bacteria 1070
97 Ga0075362_10102300 3300006177 Unclassified 1341
98 Ga0075367_10088335 3300006178 Bacteria 1883
99 Ga0075427_10061520 3300006194 Bacteria 658
100 Ga0075366_10208265 3300006195 Bacteria 1190
101 Ga0068871_101627559 3300006358 Bacteria 612
102 Ga0075428_100002414 3300006844 Bacteria 20301
103 Ga0075428_100345400 3300006844 Bacteria 1597
104 Ga0075428_100503131 3300006844 Bacteria 1296
105 Ga0075428_101392610 3300006844 Unclassified 736
106 Ga0075428_101554959 3300006844 Unclassified 692
107 Ga0075428_102123454 3300006844 Unclassified 581
108 Ga0075428_102659440 3300006844 Unclassified 510
109 Ga0075428_102730763 3300006844 Bacteria 503
110 Ga0075430_100055669 3300006846 Bacteria 3326
111 Ga0075430_100359160 3300006846 Bacteria 1203
112 Ga0075430_100385708 3300006846 Unclassified 1156
113 Ga0075430_100918642 3300006846 Unclassified 721
114 Ga0075431_100014466 3300006847 Bacteria 7983
115 Ga0075431_100062752 3300006847 Bacteria 3834
116 Ga0075431_100089620 3300006847 Bacteria 3175
117 Ga0075431_100849479 3300006847 Archaea 884
118 Ga0075433_10040125 3300006852 Bacteria 4051
119 Ga0075433_10083229 3300006852 Bacteria 2824
120 Ga0075433_10117313 3300006852 Bacteria 2362
121 Ga0075433_10384910 3300006852 Bacteria 1238
122 Ga0075433_10472170 3300006852 Bacteria 1105
123 Ga0075434_100015338 3300006871 Bacteria 7343
124 Ga0075434_100296956 3300006871 Bacteria 1636
125 Ga0075434_100307362 3300006871 Bacteria 1606
126 Ga0075434_100728486 3300006871 Bacteria 1009
127 Ga0075434_102283511 3300006871 Bacteria 544
128 Ga0075429_100004168 3300006880 Bacteria 12374
129 Ga0075429_100007576 3300006880 Bacteria 9427
130 Ga0075429_100081954 3300006880 Bacteria 2813
131 Ga0075429_100207524 3300006880 Bacteria 1716
132 Ga0075429_100592300 3300006880 Bacteria 971
133 Ga0075429_101492487 3300006880 Bacteria 588
134 Ga0068865_100124497 3300006881 Bacteria 1922
135 Ga0075436_100000908 3300006914 Bacteria 19699
136 Ga0075436_100027295 3300006914 Bacteria 3930
137 Ga0097620_100239656 3300006931 Bacteria 1903
138 Ga0097620_100451794 3300006931 Bacteria 1381
139 Ga0097620_100578256 3300006931 Bacteria 1217
140 Ga0097620_100647449 3300006931 Bacteria 1149
141 Ga0097620_100716276 3300006931 Bacteria 1091
142 Ga0075435_100014359 3300007076 Bacteria 5916
143 Ga0075435_100116252 3300007076 Bacteria 2228
144 Ga0075435_100765381 3300007076 Bacteria 840
145 Ga0111539_10002069 3300009094 Bacteria 26819
146 Ga0111539_10077216 3300009094 Bacteria 3920
147 Ga0111539_10086316 3300009094 Unclassified 3688
148 Ga0111539_10092330 3300009094 Bacteria 3557
149 Ga0111539_10165215 3300009094 Bacteria 2588
150 Ga0111539_11825526 3300009094 Unclassified 705
151 Ga0111539_13332965 3300009094 Unclassified 517
152 Ga0105245_10667921 3300009098 Bacteria 1070
153 Ga0114129_10000627 3300009147 Bacteria 43987
154 Ga0114129_10001729 3300009147 Bacteria 29783
155 Ga0114129_10067019 3300009147 Bacteria 5006
156 Ga0114129_10081699 3300009147 Bacteria 4492
157 Ga0114129_10099828 3300009147 Bacteria 4017
158 Ga0114129_10362862 3300009147 Bacteria 1916
159 Ga0114129_10413469 3300009147 Bacteria 1776
160 Ga0114129_10987175 3300009147 Unclassified 1061
161 Ga0114129_11460441 3300009147 Archaea 842
162 Ga0114129_12911036 3300009147 Bacteria 566
163 Ga0105243_10304273 3300009148 Bacteria 1446
164 Ga0105242_10069676 3300009176 Bacteria 2914
165 Ga0105248_10006570 3300009177 Bacteria 12749
166 Ga0105248_10069458 3300009177 Bacteria 3955
167 Ga0105238_10607946 3300009551 Unclassified 1101
168 Ga0105249_10938099 3300009553 Unclassified 933
169 Ga0105249_12549372 3300009553 Unclassified 584
170 Ga0105239_10648357 3300010375 Bacteria 1206
171 Ga0157370_11177025 3300013104 Bacteria 692
172 Ga0157369_12608075 3300013105 Unclassified 511
173 Ga0163162_10061023 3300013306 Unclassified 3808
174 Ga0163162_10197890 3300013306 Bacteria 2138
175 Ga0157372_10248814 3300013307 Bacteria 2063
176 Ga0157375_10153354 3300013308 Bacteria 2441
177 Ga0157375_10198178 3300013308 Bacteria 2163
178 Ga0157375_10662548 3300013308 Bacteria 1199
179 Ga0157375_12586835 3300013308 Bacteria 606
180 Ga0157380_10137649 3300014326 Bacteria 2092
181 Ga0157380_10319675 3300014326 Unclassified 1438
182 Ga0157380_10482564 3300014326 Bacteria 1199
183 Ga0157380_11085387 3300014326 Bacteria 839
184 Ga0157377_10416554 3300014745 Unclassified 919
185 Ga0157379_10020889 3300014968 Bacteria 5794
186 Ga0157379_11535622 3300014968 Archaea 649
187 Ga0157376_11000457 3300014969 Bacteria 858
188 Ga0163161_10123000 3300017792 Bacteria 1951
189 Ga0213876_10020367 3300021384 Bacteria 3505
190 Ga0207697_10152688 3300025315 Bacteria 1005
191 Ga0207653_10050153 3300025885 Bacteria 1387
192 Ga0207688_10339479 3300025901 Unclassified 924
193 Ga0207705_10392793 3300025909 Bacteria 1072
194 Ga0207707_10084483 3300025912 Bacteria 2772
195 Ga0207693_10331644 3300025915 Bacteria 1191
196 Ga0207693_10952089 3300025915 Unclassified 657
197 Ga0207663_10011432 3300025916 Bacteria 4766
198 Ga0207663_11301687 3300025916 Unclassified 585
199 Ga0207660_10102376 3300025917 Bacteria 2141
200 Ga0207660_10140511 3300025917 Bacteria 1846
201 Ga0207657_10748151 3300025919 Bacteria 757
202 Ga0207652_10134108 3300025921 Bacteria 2210
203 Ga0207652_10183190 3300025921 Bacteria 1882
204 Ga0207681_10001191 3300025923 Bacteria 16744
205 Ga0207681_10417807 3300025923 Bacteria 1086
206 Ga0207681_10855113 3300025923 Bacteria 761
207 Ga0207650_10106963 3300025925 Bacteria 2161
208 Ga0207650_10841140 3300025925 Bacteria 778
209 Ga0207650_11294738 3300025925 Bacteria 620
210 Ga0207659_11080827 3300025926 Bacteria 690
211 Ga0207687_10440754 3300025927 Bacteria 1079
212 Ga0207690_10057634 3300025932 Bacteria 2625
213 Ga0207706_10251097 3300025933 Bacteria 1545
214 Ga0207686_10062031 3300025934 Bacteria 2372
215 Ga0207686_10137831 3300025934 Bacteria 1682
216 Ga0207709_11730723 3300025935 Unclassified 520
217 Ga0207670_10096484 3300025936 Bacteria 2103
218 Ga0207670_10253941 3300025936 Unclassified 1360
219 Ga0207670_10351144 3300025936 Bacteria 1168
220 Ga0207670_10367108 3300025936 Bacteria 1143
221 Ga0207669_10218195 3300025937 Bacteria 1398
222 Ga0207669_11281189 3300025937 Bacteria 622
223 Ga0207704_10576385 3300025938 Bacteria 918
224 Ga0207665_10114195 3300025939 Bacteria 1901
225 Ga0207691_10002115 3300025940 Bacteria 19420
226 Ga0207691_10240621 3300025940 Bacteria 1565
227 Ga0207691_10851341 3300025940 Unclassified 765
228 Ga0207711_10354188 3300025941 Unclassified 1359
229 Ga0207689_10221962 3300025942 Unclassified 1562
230 Ga0207679_11406205 3300025945 Unclassified 640
231 Ga0207679_11583342 3300025945 Unclassified 600
232 Ga0207712_10554627 3300025961 Unclassified 989
233 Ga0207668_11772558 3300025972 Bacteria 557
234 Ga0207640_11450993 3300025981 Bacteria 616
235 Ga0207658_10776575 3300025986 Bacteria 869
236 Ga0207677_11497000 3300026023 Bacteria 623
237 Ga0207703_10755079 3300026035 Bacteria 927
238 Ga0207678_10468474 3300026067 Bacteria 1096
239 Ga0207708_10201708 3300026075 Bacteria 1587
240 Ga0207641_10004473 3300026088 Bacteria 12100
241 Ga0207648_10019606 3300026089 Bacteria 6103
242 Ga0207648_10239342 3300026089 Bacteria 1616
243 Ga0207674_10239776 3300026116 Bacteria 1760
244 Ga0207674_10516951 3300026116 Unclassified 1153
245 Ga0207675_100056180 3300026118 Bacteria 3671
246 Ga0207683_10103988 3300026121 Bacteria 2537
247 Ga0207683_10288939 3300026121 Bacteria 1499
248 Ga0207683_10330586 3300026121 Bacteria 1397
249 Ga0207683_11779824 3300026121 Bacteria 565
250 Ga0207683_11818297 3300026121 Bacteria 558
251 Ga0207428_10001602 3300027907 Bacteria 23525
252 Ga0268266_10159488 3300028379 Bacteria 2040
253 Ga0268265_10344637 3300028380 Unclassified 1358
254 Ga0268264_10014303 3300028381 Bacteria 6525
255 Ga0268264_10474386 3300028381 Bacteria 1216
256 Ga0268264_12464746 3300028381 Bacteria 526
257 Ga0307408_100190832 3300031548 Bacteria 1650
258 Ga0307408_100487623 3300031548 Bacteria 1076
259 Ga0307405_10063929 3300031731 Bacteria 2336
260 Ga0307405_10323952 3300031731 Bacteria 1178
261 Ga0307405_10456330 3300031731 Bacteria 1014
262 Ga0307413_10326358 3300031824 Bacteria 1174
263 Ga0307410_10042853 3300031852 Bacteria 2994
264 Ga0307410_10335723 3300031852 Bacteria 1203
265 Ga0307410_10570036 3300031852 Bacteria 941
266 Ga0307410_11094912 3300031852 Bacteria 690
267 Ga0307406_10079475 3300031901 Bacteria 2175
268 Ga0307406_10109684 3300031901 Bacteria 1897
269 Ga0307406_10362864 3300031901 Bacteria 1136
270 Ga0307407_10331351 3300031903 Bacteria 1071
271 Ga0307407_10630979 3300031903 Bacteria 801
272 Ga0307412_10184729 3300031911 Bacteria 1571
273 Ga0307412_10235661 3300031911 Bacteria 1412
274 Ga0307412_11878928 3300031911 Bacteria 552
275 Ga0307409_100284383 3300031995 Bacteria 1530
276 Ga0307409_100831469 3300031995 Unclassified 933
277 Ga0307409_101941939 3300031995 Bacteria 618
278 Ga0307416_100025300 3300032002 Bacteria 4349
279 Ga0307416_100034119 3300032002 Unclassified 3868
280 Ga0307416_100034246 3300032002 Bacteria 3863
281 Ga0307416_100159320 3300032002 Bacteria 2083
282 Ga0307416_100399696 3300032002 Unclassified 1411
283 Ga0307416_101384204 3300032002 Bacteria 809
284 Ga0307414_10141115 3300032004 Bacteria 1886
285 Ga0307414_10152301 3300032004 Bacteria 1826
286 Ga0307411_10003896 3300032005 Bacteria 7036
287 Ga0307411_10253236 3300032005 Bacteria 1386
288 Ga0307411_10406798 3300032005 Bacteria 1126
289 Ga0307411_10423670 3300032005 Bacteria 1106
290 Ga0307415_100007398 3300032126 Bacteria 6004
291 Ga0307415_100070743 3300032126 Unclassified 2451
292 Ga0307415_100403930 3300032126 Bacteria 1167
293 Ga0307415_100542396 3300032126 Bacteria 1025
294 Ga0373960_0302809 3300035121 Unclassified 595
295 Ga0373931_0575903 3300035691 Unclassified 734
296 Ga0395899_0041320 3300037312 Bacteria 3446
297 Ga0395900_0039021 3300037418 Bacteria 4895
298 Ga0395905_0058469 3300037471 Bacteria 3605
299 Ga0395905_0177308 3300037471 Bacteria 2000
300 Ga0395901_0005315 3300038443 Bacteria 13012
301 Ga0395901_0080576 3300038443 Bacteria 3400
302 Ga0395901_1090053 3300038443 Bacteria 770
303 Ga0242419_014739 3300038698 Bacteria 625
304 Ga0242420_016549 3300038996 Bacteria 1285
305 Ga0436365_0448481 3300039437 Unclassified 519
306 Ga0436365_0986900 3300039437 Bacteria 7295
307 Ga0451853_0819878 3300041512 Unclassified 574
308 Ga0439433_0016802 3300041999 Bacteria 1622
309 Ga0439462_0228659 3300042015 Bacteria 533
310 Ga0439434_0282285 3300042435 Unclassified 572
311 Ga0439435_0160406 3300042436 Bacteria 726
312 Ga0439435_0343382 3300042436 Bacteria 517
313 Ga0439459_0005691 3300042438 Bacteria 2057
314 Ga0439464_0000364 3300042439 Bacteria 8810
315 Ga0439464_0172874 3300042439 Bacteria 682
316 Ga0439440_0172657 3300042993 Bacteria 629
317 Ga0466961_0098353 3300044693 Bacteria 1845
318 Ga0466971_0087481 3300044719 Bacteria 1425
319 Ga0466960_0253296 3300044901 Unclassified 979
320 Ga0466960_0925675 3300044901 Bacteria 533
321 Ga0466958_0539944 3300045836 Bacteria 757
322 Ga0495629_0425602 3300046459 Unclassified 901
323 Ga0495638_0003932 3300046460 Bacteria 11462
324 Ga0495638_0029408 3300046460 Bacteria 3543
325 Ga0495594_0017491 3300046499 Unclassified 3789
326 Ga0495669_0076425 3300046684 Bacteria 1533
327 Ga0495672_0084119 3300047320 Bacteria 1765
328 Ga0495615_0013606 3300048090 Bacteria 1703
329 Ga0496100_0947969 3300048903 Unclassified 676
330 Ga0496101_0421766 3300048904 Unclassified 1052
331 Ga0496101_0537364 3300048904 Bacteria 924
332 Ga0496103_0665542 3300048906 Archaea 661
333 Ga0496104_0354786 3300048907 Bacteria 1379
334 Ga0496106_0082591 3300048909 Bacteria 2470
335 Ga0496106_0434512 3300048909 Bacteria 1055
336 Ga0496107_0139096 3300048910 Bacteria 1795
337 Ga0496107_1296008 3300048910 Unclassified 521
338 Ga0496108_0124932 3300048911 Bacteria 2208
339 Ga0496108_1070051 3300048911 Unclassified 686
340 Ga0496109_0155493 3300048912 Bacteria 2142
341 Ga0496109_0305331 3300048912 Bacteria 1501
342 Ga0496109_0423404 3300048912 Bacteria 1258
343 Ga0496110_0162878 3300048913 Bacteria 2022
344 Ga0496111_0223460 3300048914 Bacteria 1399
345 Ga0496112_0349499 3300048915 Bacteria 1421
346 Ga0496112_0532127 3300048915 Bacteria 1109
347 Ga0496113_0059166 3300048916 Bacteria 2886
348 Ga0496115_0870595 3300048918 Unclassified 696
349 Ga0501291_005449 3300049514 Bacteria 1662
350 Ga0501291_018507 3300049514 Bacteria 1085
351 Ga0501292_003677 3300049515 Bacteria 2063
352 Ga0501034_0018148 3300049571 Bacteria 7218
353 Ga0501039_1141803 3300049575 Unclassified 603
354 Ga0501043_0236707 3300049579 Bacteria 1409
355 Ga0501047_0146419 3300049581 Bacteria 2239
356 Ga0501075_1050451 3300049591 Bacteria 619
357 Ga0501216_018352 3300049660 Bacteria 1204
358 Ga0501233_288002 3300049668 Unclassified 504
359 Ga0501235_156547 3300049669 Bacteria 593
360 Ga0501239_060159 3300049672 Unclassified 570
361 Ga0501251_019821 3300049681 Unclassified 884
362 Ga0501258_063412 3300049687 Unclassified 538
363 Ga0501225_0213577 3300049705 Bacteria 618
364 Ga0501225_0221923 3300049705 Unclassified 609
365 Ga0501079_0779181 3300049741 Bacteria 753
366 Ga0501081_1267321 3300049743 Bacteria 559
367 Ga0501268_041807 3300049765 Bacteria 865
368 Ga0501270_126299 3300049767 Bacteria 561
369 Ga0501273_015585 3300049770 Bacteria 988
370 Ga0501273_074836 3300049770 Bacteria 555
371 Ga0501283_020965 3300049779 Unclassified 1045
372 Ga0501044_0251078 3300049823 Bacteria 1710
373 Ga0501212_022367 3300049851 Unclassified 986
374 nmdc:mga06z11_611435_c1 3300050494 Bacteria 663
375 nmdc:mga05p37_1047144_c1 3300050507 Bacteria 861
376 nmdc:mga05p37_1680344_c1 3300050507 Unclassified 620
377 nmdc:mga05p37_30646_c1 3300050507 Bacteria 6563
378 nmdc:mga05p37_329987_c1 3300050507 Bacteria 1802
379 nmdc:mga05p37_479700_c1 3300050507 Bacteria 1433
380 nmdc:mga05p37_69593_c1 3300050507 Bacteria 4329
381 nmdc:mga05p37_728088_c1 3300050507 Bacteria 1097
382 nmdc:mga05p37_75439_c1 3300050507 Bacteria 3500
383 nmdc:mga09592_1322114_c1 3300050508 Unclassified 592
384 nmdc:mga09592_1569019_c1 3300050508 Bacteria 534
385 nmdc:mga09592_36769_c1 3300050508 Bacteria 4103
386 nmdc:mga09592_456252_c1 3300050508 Bacteria 1102
387 nmdc:mga09592_496674_c1 3300050508 Bacteria 1051
388 nmdc:mga09592_595132_c1 3300050508 Bacteria 948
389 nmdc:mga0qj67_2107_c1 3300050509 Bacteria 14176
390 nmdc:mga0qj67_322391_c1 3300050509 Bacteria 1251
391 nmdc:mga0qj67_394831_c1 3300050509 Unclassified 1116
392 nmdc:mga0qj67_49170_c1 3300050509 Bacteria 3333
393 nmdc:mga0qj67_8026_c1 3300050509 Bacteria 7810
394 nmdc:mga06r32_102832_c1 3300050510 Bacteria 2805
395 nmdc:mga06r32_316929_c1 3300050510 Bacteria 1545
396 nmdc:mga06r32_44772_c1 3300050510 Bacteria 4216
397 nmdc:mga06r32_771766_c1 3300050510 Archaea 923
398 nmdc:mga08y16_1042189_c1 3300050511 Unclassified 796
399 nmdc:mga08y16_1085408_c1 3300050511 Unclassified 776
400 nmdc:mga08y16_1864_c1 3300050511 Bacteria 21429
401 nmdc:mga08y16_1922603_c1 3300050511 Bacteria 542
402 nmdc:mga08y16_251635_c1 3300050511 Bacteria 1826
403 nmdc:mga08y16_255099_c1 3300050511 Bacteria 1812
404 nmdc:mga08y16_608560_c1 3300050511 Bacteria 1101
405 nmdc:mga08y16_98272_c1 3300050511 Unclassified 3048
406 nmdc:mga0n895_1347278_c1 3300050512 Unclassified 683
407 nmdc:mga0n895_186991_c1 3300050512 Unclassified 2102
408 nmdc:mga0n895_30889_c1 3300050512 Bacteria 5124
409 nmdc:mga0n895_371277_c1 3300050512 Bacteria 1448
410 nmdc:mga0n895_495382_c1 3300050512 Bacteria 1231
411 nmdc:mga0n895_679306_c1 3300050512 Bacteria 1027
412 nmdc:mga0rr50_105575_c1 3300050513 Bacteria 2221
413 nmdc:mga0rr50_493501_c1 3300050513 Bacteria 1041
414 nmdc:mga0rr50_664656_c1 3300050513 Bacteria 889
415 nmdc:mga0rr50_761145_c1 3300050513 Unclassified 826
416 nmdc:mga08x19_2494_c1 3300050514 Bacteria 11203
417 nmdc:mga08x19_35147_c1 3300050514 Bacteria 3170
418 nmdc:mga0a205_152234_c1 3300050515 Bacteria 2212
419 nmdc:mga0a205_203963_c1 3300050515 Unclassified 1867
420 nmdc:mga0a205_41857_c1 3300050515 Bacteria 4413
421 nmdc:mga0a205_539914_c1 3300050515 Bacteria 1022
422 nmdc:mga0a205_666431_c1 3300050515 Bacteria 891
423 Ga0500555_074685 3300053103 Bacteria 890
424 Ga0500568_0033651 3300053139 Bacteria 2101
425 Ga0590071_001774 3300059421 Bacteria 5571
426 Ga0590074_002082 3300059423 Bacteria 3273
427 Ga0590075_000359 3300059424 Bacteria 12620
428 Ga0590077_010293 3300059426 Bacteria 1923
429 Ga0530510_0941728 3300061734 Bacteria 660
430 Ga0530510_1089505 3300061734 Bacteria 612
431 Ga0436363_1602607
432 Ga0065712_10079596
433 Ga0065712_10106688
434 Ga0065712_10384426
435 Ga0065715_10316685
436 Ga0065715_10347856
437 Ga0065715_10439272
438 Ga0065715_10719170
439 Ga0065707_10061023
440 Ga0070683_101834225
441 Ga0070670_100224330
442 Ga0070670_100697739
443 Ga0070677_10187092
444 Ga0070677_10480895
445 Ga0070677_10811221
446 Ga0070666_10142385
447 Ga0070680_100082745
448 Ga0070680_100159881
449 Ga0068868_101767728
450 Ga0070660_101721773
451 Ga0070689_100244545
452 Ga0070689_100382849
453 Ga0070689_102221420
454 Ga0070687_100095769
455 Ga0070661_100158688
456 Ga0070661_101486479
457 Ga0070668_100039908
458 Ga0070668_101441986
459 Ga0070668_101568790
460 Ga0070669_100496312
461 Ga0070669_100757449
462 Ga0070669_101059293
463 Ga0070675_100073195
464 Ga0070675_100315483
465 Ga0070675_100330771
466 Ga0070671_100018344
467 Ga0070671_100291634
468 Ga0070674_100730820
469 Ga0070674_100948077
470 Ga0070673_100043710
471 Ga0070688_100190639
472 Ga0070688_100528041
473 Ga0070659_100025538
474 Ga0070659_101024595
475 Ga0070667_100005819
476 Ga0070667_100156662
477 Ga0070703_10270459
478 Ga0070711_100001564
479 Ga0070711_100089071
480 Ga0070705_100063141
481 Ga0070705_101024677
482 Ga0070708_101535058
483 Ga0070663_102092018
484 Ga0070678_100020573
485 Ga0070678_100343094
486 Ga0070678_100985397
487 Ga0070678_102253570
488 Ga0070662_100144926
489 Ga0070681_10080330
490 Ga0070681_10510155
491 Ga0068867_100188152
492 Ga0070685_10394145
493 Ga0070706_100942051
494 Ga0070707_100719949
495 Ga0070698_100475843
496 Ga0070699_101574538
497 Ga0070679_100138679
498 Ga0070679_100439385
499 Ga0070672_100004590
500 Ga0070672_100080550
501 Ga0070672_101678939
502 Ga0070686_100823689
503 Ga0070665_100171776
504 Ga0070664_101493862
505 Ga0068857_100100263
506 Ga0068854_100782685
507 Ga0068854_102283273
508 Ga0070702_100107148
509 Ga0068852_100654924
510 Ga0068859_100239652
511 Ga0068859_100451802
512 Ga0068859_100578264
513 Ga0068859_100647530
514 Ga0068859_100716298
515 Ga0068870_10628009
516 Ga0068863_100000533
517 Ga0068863_101249739
518 Ga0068858_100988971
519 Ga0068858_101733779
520 Ga0068860_102108395
521 Ga0068862_100869082
522 Ga0068862_101608079
523 Ga0068862_102202900
524 Ga0075368_10249603
525 Ga0075364_10255660
526 Ga0070712_100451754
527 Ga0075362_10102300
528 Ga0075367_10088335
529 Ga0075427_10061520
530 Ga0075366_10208265
531 Ga0068871_101627559
532 Ga0075428_100002414
533 Ga0075428_100345400
534 Ga0075428_100503131
535 Ga0075428_101392610
536 Ga0075428_101554959
537 Ga0075428_102123454
538 Ga0075428_102659440
539 Ga0075428_102730763
540 Ga0075430_100055669
541 Ga0075430_100359160
542 Ga0075430_100385708
543 Ga0075430_100918642
544 Ga0075431_100014466
545 Ga0075431_100062752
546 Ga0075431_100089620
547 Ga0075431_100849479
548 Ga0075433_10040125
549 Ga0075433_10083229
550 Ga0075433_10117313
551 Ga0075433_10384910
552 Ga0075433_10472170
553 Ga0075434_100015338
554 Ga0075434_100296956
555 Ga0075434_100307362
556 Ga0075434_100728486
557 Ga0075434_102283511
558 Ga0075429_100004168
559 Ga0075429_100007576
560 Ga0075429_100081954
561 Ga0075429_100207524
562 Ga0075429_100592300
563 Ga0075429_101492487
564 Ga0068865_100124497
565 Ga0075436_100000908
566 Ga0075436_100027295
567 Ga0097620_100239656
568 Ga0097620_100451794
569 Ga0097620_100578256
570 Ga0097620_100647449
571 Ga0097620_100716276
572 Ga0075435_100014359
573 Ga0075435_100116252
574 Ga0075435_100765381
575 Ga0111539_10002069
576 Ga0111539_10077216
577 Ga0111539_10086316
578 Ga0111539_10092330
579 Ga0111539_10165215
580 Ga0111539_11825526
581 Ga0111539_13332965
582 Ga0105245_10667921
583 Ga0114129_10000627
584 Ga0114129_10001729
585 Ga0114129_10067019
586 Ga0114129_10081699
587 Ga0114129_10099828
588 Ga0114129_10362862
589 Ga0114129_10413469
590 Ga0114129_10987175
591 Ga0114129_11460441
592 Ga0114129_12911036
593 Ga0105243_10304273
594 Ga0105242_10069676
595 Ga0105248_10006570
596 Ga0105248_10069458
597 Ga0105238_10607946
598 Ga0105249_10938099
599 Ga0105249_12549372
600 Ga0105239_10648357
601 Ga0157370_11177025
602 Ga0157369_12608075
603 Ga0163162_10061023
604 Ga0163162_10197890
605 Ga0157372_10248814
606 Ga0157375_10153354
607 Ga0157375_10198178
608 Ga0157375_10662548
609 Ga0157375_12586835
610 Ga0157380_10137649
611 Ga0157380_10319675
612 Ga0157380_10482564
613 Ga0157380_11085387
614 Ga0157377_10416554
615 Ga0157379_10020889
616 Ga0157379_11535622
617 Ga0157376_11000457
618 Ga0163161_10123000
619 Ga0213876_10020367
620 Ga0207697_10152688
621 Ga0207653_10050153
622 Ga0207688_10339479
623 Ga0207705_10392793
624 Ga0207707_10084483
625 Ga0207693_10331644
626 Ga0207693_10952089
627 Ga0207663_10011432
628 Ga0207663_11301687
629 Ga0207660_10102376
630 Ga0207660_10140511
631 Ga0207657_10748151
632 Ga0207652_10134108
633 Ga0207652_10183190
634 Ga0207681_10001191
635 Ga0207681_10417807
636 Ga0207681_10855113
637 Ga0207650_10106963
638 Ga0207650_10841140
639 Ga0207650_11294738
640 Ga0207659_11080827
641 Ga0207687_10440754
642 Ga0207690_10057634
643 Ga0207706_10251097
644 Ga0207686_10062031
645 Ga0207686_10137831
646 Ga0207709_11730723
647 Ga0207670_10096484
648 Ga0207670_10253941
649 Ga0207670_10351144
650 Ga0207670_10367108
651 Ga0207669_10218195
652 Ga0207669_11281189
653 Ga0207704_10576385
654 Ga0207665_10114195
655 Ga0207691_10002115
656 Ga0207691_10240621
657 Ga0207691_10851341
658 Ga0207711_10354188
659 Ga0207689_10221962
660 Ga0207679_11406205
661 Ga0207679_11583342
662 Ga0207712_10554627
663 Ga0207668_11772558
664 Ga0207640_11450993
665 Ga0207658_10776575
666 Ga0207677_11497000
667 Ga0207703_10755079
668 Ga0207678_10468474
669 Ga0207708_10201708
670 Ga0207641_10004473
671 Ga0207648_10019606
672 Ga0207648_10239342
673 Ga0207674_10239776
674 Ga0207674_10516951
675 Ga0207675_100056180
676 Ga0207683_10103988
677 Ga0207683_10288939
678 Ga0207683_10330586
679 Ga0207683_11779824
680 Ga0207683_11818297
681 Ga0207428_10001602
682 Ga0268266_10159488
683 Ga0268265_10344637
684 Ga0268264_10014303
685 Ga0268264_10474386
686 Ga0268264_12464746
687 Ga0307408_100190832
688 Ga0307408_100487623
689 Ga0307405_10063929
690 Ga0307405_10323952
691 Ga0307405_10456330
692 Ga0307413_10326358
693 Ga0307410_10042853
694 Ga0307410_10335723
695 Ga0307410_10570036
696 Ga0307410_11094912
697 Ga0307406_10079475
698 Ga0307406_10109684
699 Ga0307406_10362864
700 Ga0307407_10331351
701 Ga0307407_10630979
702 Ga0307412_10184729
703 Ga0307412_10235661
704 Ga0307412_11878928
705 Ga0307409_100284383
706 Ga0307409_100831469
707 Ga0307409_101941939
708 Ga0307416_100025300
709 Ga0307416_100034119
710 Ga0307416_100034246
711 Ga0307416_100159320
712 Ga0307416_100399696
713 Ga0307416_101384204
714 Ga0307414_10141115
715 Ga0307414_10152301
716 Ga0307411_10003896
717 Ga0307411_10253236
718 Ga0307411_10406798
719 Ga0307411_10423670
720 Ga0307415_100007398
721 Ga0307415_100070743
722 Ga0307415_100403930
723 Ga0307415_100542396
724 Ga0373960_0302809
725 Ga0373931_0575903
726 Ga0395899_0041320
727 Ga0395900_0039021
728 Ga0395905_0058469
729 Ga0395905_0177308
730 Ga0395901_0005315
731 Ga0395901_0080576
732 Ga0395901_1090053
733 Ga0242419_014739
734 Ga0242420_016549
735 Ga0436365_0448481
736 Ga0436365_0986900
737 Ga0451853_0819878
738 Ga0439433_0016802
739 Ga0439462_0228659
740 Ga0439434_0282285
741 Ga0439435_0160406
742 Ga0439435_0343382
743 Ga0439459_0005691
744 Ga0439464_0000364
745 Ga0439464_0172874
746 Ga0439440_0172657
747 Ga0466961_0098353
748 Ga0466971_0087481
749 Ga0466960_0253296
750 Ga0466960_0925675
751 Ga0466958_0539944
752 Ga0495629_0425602
753 Ga0495638_0003932
754 Ga0495638_0029408
755 Ga0495594_0017491
756 Ga0495669_0076425
757 Ga0495672_0084119
758 Ga0495615_0013606
759 Ga0496100_0947969
760 Ga0496101_0421766
761 Ga0496101_0537364
762 Ga0496103_0665542
763 Ga0496104_0354786
764 Ga0496106_0082591
765 Ga0496106_0434512
766 Ga0496107_0139096
767 Ga0496107_1296008
768 Ga0496108_0124932
769 Ga0496108_1070051
770 Ga0496109_0155493
771 Ga0496109_0305331
772 Ga0496109_0423404
773 Ga0496110_0162878
774 Ga0496111_0223460
775 Ga0496112_0349499
776 Ga0496112_0532127
777 Ga0496113_0059166
778 Ga0496115_0870595
779 Ga0501291_005449
780 Ga0501291_018507
781 Ga0501292_003677
782 Ga0501034_0018148
783 Ga0501039_1141803
784 Ga0501043_0236707
785 Ga0501047_0146419
786 Ga0501075_1050451
787 Ga0501216_018352
788 Ga0501233_288002
789 Ga0501235_156547
790 Ga0501239_060159
791 Ga0501251_019821
792 Ga0501258_063412
793 Ga0501225_0213577
794 Ga0501225_0221923
795 Ga0501079_0779181
796 Ga0501081_1267321
797 Ga0501268_041807
798 Ga0501270_126299
799 Ga0501273_015585
800 Ga0501273_074836
801 Ga0501283_020965
802 Ga0501044_0251078
803 Ga0501212_022367
804 nmdc:mga06z11_611435_c1
805 nmdc:mga05p37_1047144_c1
806 nmdc:mga05p37_1680344_c1
807 nmdc:mga05p37_30646_c1
808 nmdc:mga05p37_329987_c1
809 nmdc:mga05p37_479700_c1
810 nmdc:mga05p37_69593_c1
811 nmdc:mga05p37_728088_c1
812 nmdc:mga05p37_75439_c1
813 nmdc:mga09592_1322114_c1
814 nmdc:mga09592_1569019_c1
815 nmdc:mga09592_36769_c1
816 nmdc:mga09592_456252_c1
817 nmdc:mga09592_496674_c1
818 nmdc:mga09592_595132_c1
819 nmdc:mga0qj67_2107_c1
820 nmdc:mga0qj67_322391_c1
821 nmdc:mga0qj67_394831_c1
822 nmdc:mga0qj67_49170_c1
823 nmdc:mga0qj67_8026_c1
824 nmdc:mga06r32_102832_c1
825 nmdc:mga06r32_316929_c1
826 nmdc:mga06r32_44772_c1
827 nmdc:mga06r32_771766_c1
828 nmdc:mga08y16_1042189_c1
829 nmdc:mga08y16_1085408_c1
830 nmdc:mga08y16_1864_c1
831 nmdc:mga08y16_1922603_c1
832 nmdc:mga08y16_251635_c1
833 nmdc:mga08y16_255099_c1
834 nmdc:mga08y16_608560_c1
835 nmdc:mga08y16_98272_c1
836 nmdc:mga0n895_1347278_c1
837 nmdc:mga0n895_186991_c1
838 nmdc:mga0n895_30889_c1
839 nmdc:mga0n895_371277_c1
840 nmdc:mga0n895_495382_c1
841 nmdc:mga0n895_679306_c1
842 nmdc:mga0rr50_105575_c1
843 nmdc:mga0rr50_493501_c1
844 nmdc:mga0rr50_664656_c1
845 nmdc:mga0rr50_761145_c1
846 nmdc:mga08x19_2494_c1
847 nmdc:mga08x19_35147_c1
848 nmdc:mga0a205_152234_c1
849 nmdc:mga0a205_203963_c1
850 nmdc:mga0a205_41857_c1
851 nmdc:mga0a205_539914_c1
852 nmdc:mga0a205_666431_c1
853 Ga0500555_074685
854 Ga0500568_0033651
855 Ga0590071_001774
856 Ga0590074_002082
857 Ga0590075_000359
858 Ga0590077_010293
859 Ga0530510_0941728
860 Ga0530510_1089505

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

17

90

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7wjp-assembly1.cif.gz_A-2 structure of padr-like protein from listeria monocytogenes 0.9226 15 111
3l7w-assembly1.cif.gz_A-2 the crystal structure of smu.1704 from streptococcus mutans ua159 0.9164 11 111
1xma-assembly1.cif.gz_B-2 structure of a transcriptional regulator from clostridium thermocellum cth-833 0.9102 11 109
3hhh-assembly1.cif.gz_A crystal structure of transcriptional regulator, a member of padr family, from enterococcus faecalis v583 0.8991 9 110
1xma-assembly1.cif.gz_A structure of a transcriptional regulator from clostridium thermocellum cth-833 0.8979 11 109
ID Description Score Start End Superfamily
3l7wA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8991 11 110 1.10.10.10
1xmaA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8979 11 109 1.10.10.10
af_P71704_1_89_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8976 17 98 1.10.10.10
5x13A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8971 15 97 1.10.10.10
3f3xA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8875 16 109 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A2N9MU15-F1-model_v4 Transcriptional regulator, PadR family 0.9831 20 114
AF-A0A6J4S1B4-F1-model_v4 Transcriptional regulator, PadR family 0.9826 20 111
AF-E8V6A6-F1-model_v4 Transcriptional regulator, PadR-like family 0.9812 15 111
AF-W0RAW6-F1-model_v4 Transcriptional regulator, PadR-family 0.9807 15 111
AF-A0A7Y3MVI7-F1-model_v4 PadR family transcriptional regulator 0.9785 15 111

Map