F442177

General Info

Members Datasets Scaffolds Average Seq Length
430 211 860 109

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_100679764|Ga0307416_1006797642
Length 111
Sequence MDHPFVIRPSAHATYRPDKMGKTTIFESARLLVGLNAFEPGQSHALHAGMDKVYAVVEGEGVFLLEDRELPMRAGDLLVAPEGVPHGVRNTGAARLLVLAVLAPAPAAPAL

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
141 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
144 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
145 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
146 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
147 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
151 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
152 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
153 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
154 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
155 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
159 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
160 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
172 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
176 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
177 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
178 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
179 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
184 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
185 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
197 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
198 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
199 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
202 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
208 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
209 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
210 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.23
Nodule 0
Rhizoplane 0.93
Rhizosphere 98.14
Stem 0
Stem Tuber 0
Unclassified 31.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_100679764 3300032002 Unclassified 1117
2 rootH1_10089043 3300003316 Bacteria 1263
3 rootL2_10141245 3300003322 Unclassified 2318
4 Ga0065712_10001154 3300005290 Bacteria 10135
5 Ga0065715_10009542 3300005293 Bacteria 3183
6 Ga0065715_10130381 3300005293 Bacteria 2027
7 Ga0065715_10142271 3300005293 Bacteria 1836
8 Ga0065715_10297158 3300005293 Unclassified 1050
9 Ga0065707_10178470 3300005295 Bacteria 1434
10 Ga0070658_10531363 3300005327 Unclassified 1017
11 Ga0070676_10011181 3300005328 Bacteria 4877
12 Ga0070676_10264194 3300005328 Unclassified 1153
13 Ga0070683_100247582 3300005329 Bacteria 1695
14 Ga0070690_100073759 3300005330 Bacteria 2221
15 Ga0070690_100132067 3300005330 Bacteria 1687
16 Ga0070677_10350392 3300005333 Bacteria 765
17 Ga0068869_100661651 3300005334 Bacteria 887
18 Ga0070666_10447037 3300005335 Bacteria 933
19 Ga0070666_11003905 3300005335 Bacteria 619
20 Ga0070680_100628895 3300005336 Unclassified 922
21 Ga0070680_101098935 3300005336 Bacteria 687
22 Ga0070682_100883568 3300005337 Unclassified 733
23 Ga0068868_100412427 3300005338 Bacteria 1168
24 Ga0068868_100769664 3300005338 Unclassified 866
25 Ga0068868_102106448 3300005338 Unclassified 536
26 Ga0070689_100012892 3300005340 Bacteria 6035
27 Ga0070689_100029496 3300005340 Unclassified 4154
28 Ga0070689_100404603 3300005340 Unclassified 1154
29 Ga0070689_100481751 3300005340 Bacteria 1060
30 Ga0070691_10009464 3300005341 Bacteria 4446
31 Ga0070687_100007457 3300005343 Bacteria 4562
32 Ga0070687_100264096 3300005343 Bacteria 1076
33 Ga0070668_100279875 3300005347 Bacteria 1393
34 Ga0070669_100000853 3300005353 Bacteria 22122
35 Ga0070669_100354998 3300005353 Bacteria 1191
36 Ga0070675_100005829 3300005354 Bacteria 9435
37 Ga0070675_100025885 3300005354 Bacteria 4705
38 Ga0070675_100213832 3300005354 Bacteria 1677
39 Ga0070671_100002612 3300005355 Bacteria 13945
40 Ga0070671_100956961 3300005355 Unclassified 749
41 Ga0070673_100123743 3300005364 Bacteria 2161
42 Ga0070673_100431422 3300005364 Bacteria 1183
43 Ga0070673_101190670 3300005364 Unclassified 714
44 Ga0070688_100017269 3300005365 Bacteria 4139
45 Ga0070659_100317088 3300005366 Unclassified 1303
46 Ga0070659_101150521 3300005366 Bacteria 685
47 Ga0070659_102082981 3300005366 Unclassified 510
48 Ga0070667_100346253 3300005367 Bacteria 1345
49 Ga0070667_101265595 3300005367 Bacteria 691
50 Ga0070710_10098849 3300005437 Unclassified 1734
51 Ga0070701_10001146 3300005438 Bacteria 9687
52 Ga0070701_10345305 3300005438 Unclassified 928
53 Ga0070705_100000588 3300005440 Bacteria 21155
54 Ga0070705_100028506 3300005440 Bacteria 3059
55 Ga0070705_100030634 3300005440 Unclassified 2972
56 Ga0070700_100013177 3300005441 Unclassified 4639
57 Ga0070700_100084255 3300005441 Bacteria 2060
58 Ga0070700_100332597 3300005441 Bacteria 1120
59 Ga0070700_100487781 3300005441 Bacteria 945
60 Ga0070700_101742118 3300005441 Unclassified 535
61 Ga0070694_100012755 3300005444 Bacteria 5234
62 Ga0070694_100157261 3300005444 Bacteria 1665
63 Ga0070694_100444953 3300005444 Bacteria 1022
64 Ga0070694_100977034 3300005444 Bacteria 702
65 Ga0070694_101298645 3300005444 Unclassified 612
66 Ga0070708_101117195 3300005445 Bacteria 738
67 Ga0070678_100930738 3300005456 Unclassified 796
68 Ga0070662_100073228 3300005457 Unclassified 2531
69 Ga0070662_100427492 3300005457 Bacteria 1097
70 Ga0070681_10000864 3300005458 Bacteria 25499
71 Ga0070681_10389803 3300005458 Bacteria 1304
72 Ga0068867_100002100 3300005459 Bacteria 13956
73 Ga0068867_102005109 3300005459 Unclassified 547
74 Ga0070706_100596088 3300005467 Unclassified 1027
75 Ga0070707_100020933 3300005468 Bacteria 6176
76 Ga0070707_100153985 3300005468 Bacteria 2239
77 Ga0070707_100998706 3300005468 Bacteria 802
78 Ga0070698_100031968 3300005471 Bacteria 5454
79 Ga0070698_100428058 3300005471 Bacteria 1258
80 Ga0070698_100462412 3300005471 Bacteria 1205
81 Ga0070699_100025687 3300005518 Bacteria 5076
82 Ga0070699_100081647 3300005518 Bacteria 2818
83 Ga0070679_101407192 3300005530 Bacteria 644
84 Ga0070684_100657061 3300005535 Bacteria 976
85 Ga0070697_100495240 3300005536 Bacteria 1068
86 Ga0070697_101077128 3300005536 Bacteria 715
87 Ga0070672_100115961 3300005543 Bacteria 2188
88 Ga0070672_100117671 3300005543 Bacteria 2173
89 Ga0070672_101495834 3300005543 Unclassified 605
90 Ga0070672_101788927 3300005543 Unclassified 552
91 Ga0070686_100042909 3300005544 Bacteria 2835
92 Ga0070686_100089451 3300005544 Unclassified 2057
93 Ga0070695_100000246 3300005545 Bacteria 27003
94 Ga0070695_100050773 3300005545 Bacteria 2659
95 Ga0070695_100514183 3300005545 Bacteria 928
96 Ga0070695_101769585 3300005545 Unclassified 518
97 Ga0070696_100000481 3300005546 Bacteria 25041
98 Ga0070696_100196412 3300005546 Bacteria 1504
99 Ga0070696_101591424 3300005546 Unclassified 561
100 Ga0070704_100011735 3300005549 Bacteria 5384
101 Ga0070704_100044024 3300005549 Bacteria 3099
102 Ga0070704_100104344 3300005549 Bacteria 2143
103 Ga0070704_100364003 3300005549 Bacteria 1224
104 Ga0070704_101392067 3300005549 Unclassified 643
105 Ga0070704_101516693 3300005549 Bacteria 617
106 Ga0070664_100045039 3300005564 Bacteria 3726
107 Ga0070664_100878796 3300005564 Bacteria 840
108 Ga0068857_100128548 3300005577 Bacteria 2284
109 Ga0068857_100342765 3300005577 Bacteria 1383
110 Ga0070702_100163355 3300005615 Bacteria 1442
111 Ga0070702_100351478 3300005615 Unclassified 1038
112 Ga0070702_101223545 3300005615 Bacteria 606
113 Ga0068852_102779113 3300005616 Unclassified 508
114 Ga0068859_100011107 3300005617 Bacteria 9060
115 Ga0068859_100038873 3300005617 Unclassified 4772
116 Ga0068859_102800660 3300005617 Bacteria 535
117 Ga0068864_100009030 3300005618 Bacteria 8216
118 Ga0068864_100021084 3300005618 Bacteria 5456
119 Ga0068864_101096041 3300005618 Unclassified 792
120 Ga0068866_10605468 3300005718 Unclassified 740
121 Ga0068861_100026808 3300005719 Bacteria 4193
122 Ga0068870_10026617 3300005840 Unclassified 2884
123 Ga0068870_10039745 3300005840 Bacteria 2435
124 Ga0068863_100029361 3300005841 Bacteria 5249
125 Ga0068863_100119976 3300005841 Unclassified 2507
126 Ga0068863_100346071 3300005841 Bacteria 1447
127 Ga0068858_100019864 3300005842 Bacteria 6281
128 Ga0068860_100008746 3300005843 Bacteria 10083
129 Ga0068860_100404451 3300005843 Bacteria 1351
130 Ga0068862_100007498 3300005844 Bacteria 9040
131 Ga0068862_100323142 3300005844 Bacteria 1425
132 Ga0068862_100490689 3300005844 Unclassified 1164
133 Ga0075432_10166440 3300006058 Unclassified 855
134 Ga0097621_100043939 3300006237 Unclassified 3603
135 Ga0097621_100371852 3300006237 Bacteria 1275
136 Ga0097621_100393785 3300006237 Unclassified 1239
137 Ga0097621_100418782 3300006237 Unclassified 1202
138 Ga0097621_100430048 3300006237 Bacteria 1186
139 Ga0097621_101343312 3300006237 Unclassified 676
140 Ga0068871_100102657 3300006358 Bacteria 2397
141 Ga0068871_100208567 3300006358 Bacteria 1689
142 Ga0068871_100736409 3300006358 Unclassified 905
143 Ga0075428_100014989 3300006844 Bacteria 8615
144 Ga0075428_100112769 3300006844 Bacteria 2962
145 Ga0075428_101836361 3300006844 Unclassified 630
146 Ga0075431_100917637 3300006847 Unclassified 845
147 Ga0075433_10101187 3300006852 Bacteria 2552
148 Ga0075434_100655842 3300006871 Unclassified 1068
149 Ga0075434_100946206 3300006871 Bacteria 876
150 Ga0075434_102066484 3300006871 Bacteria 575
151 Ga0075429_100036055 3300006880 Bacteria 4302
152 Ga0075429_100275106 3300006880 Bacteria 1474
153 Ga0068865_100019305 3300006881 Bacteria 4411
154 Ga0068865_100253945 3300006881 Unclassified 1389
155 Ga0068865_101424470 3300006881 Bacteria 619
156 Ga0097620_100011107 3300006931 Bacteria 9060
157 Ga0097620_100038873 3300006931 Unclassified 4772
158 Ga0097620_102802675 3300006931 Bacteria 535
159 Ga0075435_100028116 3300007076 Bacteria 4407
160 Ga0075435_101129947 3300007076 Unclassified 685
161 Ga0111539_10006064 3300009094 Bacteria 15600
162 Ga0111539_10015938 3300009094 Bacteria 9337
163 Ga0111539_10118762 3300009094 Bacteria 3099
164 Ga0111539_10682194 3300009094 Unclassified 1196
165 Ga0111539_10806857 3300009094 Bacteria 1092
166 Ga0111539_11676053 3300009094 Bacteria 737
167 Ga0111539_11960254 3300009094 Bacteria 679
168 Ga0105245_11592830 3300009098 Unclassified 705
169 Ga0105247_10008452 3300009101 Bacteria 6271
170 Ga0114129_10011147 3300009147 Bacteria 12814
171 Ga0114129_10048669 3300009147 Bacteria 5957
172 Ga0114129_10412762 3300009147 Bacteria 1777
173 Ga0114129_10718775 3300009147 Bacteria 1282
174 Ga0114129_10746256 3300009147 Bacteria 1253
175 Ga0105243_12281920 3300009148 Unclassified 579
176 Ga0105241_12490181 3300009174 Unclassified 518
177 Ga0105242_10043509 3300009176 Bacteria 3633
178 Ga0105242_10170683 3300009176 Bacteria 1912
179 Ga0105242_11144066 3300009176 Bacteria 795
180 Ga0105248_10437941 3300009177 Unclassified 1472
181 Ga0105248_11364747 3300009177 Bacteria 802
182 Ga0105248_12005592 3300009177 Unclassified 657
183 Ga0105238_10597315 3300009551 Unclassified 1111
184 Ga0105249_10018926 3300009553 Bacteria 6138
185 Ga0105249_10427048 3300009553 Bacteria 1360
186 Ga0105249_10693471 3300009553 Unclassified 1078
187 Ga0105239_11508113 3300010375 Unclassified 777
188 Ga0105239_13073282 3300010375 Unclassified 544
189 Ga0157371_10437974 3300013102 Unclassified 960
190 Ga0157374_10329123 3300013296 Bacteria 1515
191 Ga0157378_10419197 3300013297 Bacteria 1323
192 Ga0157378_10595355 3300013297 Bacteria 1116
193 Ga0157378_10673330 3300013297 Bacteria 1052
194 Ga0157378_11794551 3300013297 Unclassified 661
195 Ga0157378_12298863 3300013297 Bacteria 591
196 Ga0163162_10543533 3300013306 Bacteria 1290
197 Ga0163162_10573229 3300013306 Unclassified 1256
198 Ga0157375_10009767 3300013308 Bacteria 8434
199 Ga0157375_10071204 3300013308 Bacteria 3489
200 Ga0157375_10498869 3300013308 Bacteria 1381
201 Ga0163163_10692794 3300014325 Unclassified 1082
202 Ga0157380_10035142 3300014326 Unclassified 3870
203 Ga0157380_10430972 3300014326 Unclassified 1260
204 Ga0157380_10686893 3300014326 Viruses 1026
205 Ga0157377_10020995 3300014745 Bacteria 3428
206 Ga0157377_10112306 3300014745 Bacteria 1640
207 Ga0157377_10161200 3300014745 Bacteria 1395
208 Ga0157377_11255417 3300014745 Bacteria 577
209 Ga0157379_10072529 3300014968 Bacteria 3081
210 Ga0157379_10227412 3300014968 Bacteria 1691
211 Ga0157379_11422859 3300014968 Unclassified 673
212 Ga0157379_12417254 3300014968 Bacteria 524
213 Ga0157376_10329791 3300014969 Bacteria 1454
214 Ga0157376_10634824 3300014969 Unclassified 1067
215 Ga0207666_1009613 3300025271 Bacteria 1310
216 Ga0207692_10025967 3300025898 Unclassified 2744
217 Ga0207710_10153585 3300025900 Unclassified 1118
218 Ga0207680_10119548 3300025903 Bacteria 1721
219 Ga0207647_10036689 3300025904 Bacteria 3113
220 Ga0207645_10038769 3300025907 Unclassified 3054
221 Ga0207643_10001296 3300025908 Bacteria 14571
222 Ga0207643_10007042 3300025908 Bacteria 6025
223 Ga0207705_10135141 3300025909 Bacteria 1838
224 Ga0207707_10003912 3300025912 Bacteria 13215
225 Ga0207660_10488956 3300025917 Unclassified 998
226 Ga0207660_10687841 3300025917 Bacteria 834
227 Ga0207660_11090228 3300025917 Unclassified 651
228 Ga0207662_10002140 3300025918 Bacteria 9830
229 Ga0207662_10016204 3300025918 Unclassified 4203
230 Ga0207649_11572413 3300025920 Unclassified 520
231 Ga0207652_10045361 3300025921 Bacteria 3748
232 Ga0207646_10019679 3300025922 Bacteria 6268
233 Ga0207646_10111381 3300025922 Bacteria 2456
234 Ga0207681_10005002 3300025923 Bacteria 8145
235 Ga0207681_10339577 3300025923 Bacteria 1199
236 Ga0207650_10006762 3300025925 Bacteria 7820
237 Ga0207659_10002679 3300025926 Bacteria 10610
238 Ga0207659_10041307 3300025926 Bacteria 3230
239 Ga0207659_10193361 3300025926 Bacteria 1620
240 Ga0207659_10979001 3300025926 Bacteria 728
241 Ga0207644_10005777 3300025931 Bacteria 8051
242 Ga0207690_10086912 3300025932 Unclassified 2198
243 Ga0207706_10012612 3300025933 Bacteria 7693
244 Ga0207706_10208360 3300025933 Bacteria 1714
245 Ga0207706_10305507 3300025933 Bacteria 1385
246 Ga0207686_10143024 3300025934 Bacteria 1656
247 Ga0207709_10087043 3300025935 Bacteria 2030
248 Ga0207709_10137780 3300025935 Bacteria 1673
249 Ga0207670_10051865 3300025936 Unclassified 2757
250 Ga0207670_10559633 3300025936 Bacteria 935
251 Ga0207670_10768866 3300025936 Bacteria 801
252 Ga0207670_11477005 3300025936 Unclassified 578
253 Ga0207704_10135167 3300025938 Bacteria 1715
254 Ga0207704_10994804 3300025938 Unclassified 709
255 Ga0207704_11190115 3300025938 Bacteria 650
256 Ga0207691_10039883 3300025940 Bacteria 4343
257 Ga0207691_10071643 3300025940 Unclassified 3127
258 Ga0207711_10299409 3300025941 Bacteria 1483
259 Ga0207711_11477836 3300025941 Bacteria 622
260 Ga0207711_11606738 3300025941 Bacteria 593
261 Ga0207679_10014925 3300025945 Bacteria 5118
262 Ga0207679_10088230 3300025945 Unclassified 2391
263 Ga0207651_10036028 3300025960 Bacteria 3225
264 Ga0207651_10136757 3300025960 Bacteria 1886
265 Ga0207651_10168035 3300025960 Bacteria 1727
266 Ga0207651_10771439 3300025960 Bacteria 851
267 Ga0207712_10099645 3300025961 Unclassified 2158
268 Ga0207712_10368971 3300025961 Bacteria 1198
269 Ga0207668_10273883 3300025972 Bacteria 1381
270 Ga0207640_10846231 3300025981 Unclassified 796
271 Ga0207658_10251905 3300025986 Bacteria 1501
272 Ga0207703_10012050 3300026035 Bacteria 6735
273 Ga0207703_10083541 3300026035 Bacteria 2668
274 Ga0207703_10377851 3300026035 Bacteria 1310
275 Ga0207708_10024118 3300026075 Unclassified 4600
276 Ga0207708_10450773 3300026075 Bacteria 1071
277 Ga0207708_10563056 3300026075 Unclassified 962
278 Ga0207641_10040352 3300026088 Bacteria 3908
279 Ga0207641_10547483 3300026088 Unclassified 1128
280 Ga0207641_11685293 3300026088 Unclassified 636
281 Ga0207648_10003078 3300026089 Bacteria 17622
282 Ga0207676_10009514 3300026095 Bacteria 6918
283 Ga0207676_10103846 3300026095 Unclassified 2362
284 Ga0207676_10119208 3300026095 Unclassified 2222
285 Ga0207676_10991382 3300026095 Bacteria 827
286 Ga0207676_11733743 3300026095 Unclassified 623
287 Ga0207674_10181146 3300026116 Bacteria 2058
288 Ga0207674_10304381 3300026116 Bacteria 1543
289 Ga0207674_10577535 3300026116 Bacteria 1086
290 Ga0207675_100005819 3300026118 Bacteria 11782
291 Ga0207675_100127211 3300026118 Bacteria 2414
292 Ga0207683_10110015 3300026121 Unclassified 2467
293 Ga0207698_11697307 3300026142 Bacteria 647
294 Ga0209974_10097928 3300027876 Bacteria 1023
295 Ga0207428_10002747 3300027907 Bacteria 17505
296 Ga0207428_10004602 3300027907 Bacteria 13075
297 Ga0207428_10586563 3300027907 Bacteria 804
298 Ga0207428_10602426 3300027907 Unclassified 791
299 Ga0207428_10621172 3300027907 Unclassified 777
300 Ga0268265_10000899 3300028380 Bacteria 27634
301 Ga0268264_10008837 3300028381 Bacteria 8350
302 Ga0268264_10350624 3300028381 Bacteria 1405
303 Ga0268264_10438092 3300028381 Bacteria 1264
304 Ga0316182_1173289 3300030745 Unclassified 675
305 Ga0265330_10048931 3300031235 Bacteria 1859
306 Ga0307408_100006357 3300031548 Bacteria 7838
307 Ga0307408_100011858 3300031548 Bacteria 5766
308 Ga0307405_10000991 3300031731 Bacteria 11422
309 Ga0307405_10105894 3300031731 Bacteria 1895
310 Ga0307405_10302416 3300031731 Bacteria 1214
311 Ga0307405_10476101 3300031731 Bacteria 996
312 Ga0307413_10033009 3300031824 Bacteria 2941
313 Ga0307413_10159959 3300031824 Bacteria 1581
314 Ga0307410_10077930 3300031852 Bacteria 2318
315 Ga0307410_10385045 3300031852 Bacteria 1129
316 Ga0307410_11506754 3300031852 Unclassified 592
317 Ga0307406_10032149 3300031901 Bacteria 3201
318 Ga0307406_10079615 3300031901 Bacteria 2173
319 Ga0307406_10358135 3300031901 Unclassified 1143
320 Ga0307407_10001988 3300031903 Bacteria 7779
321 Ga0307407_10195495 3300031903 Bacteria 1351
322 Ga0307407_10433483 3300031903 Bacteria 950
323 Ga0307407_10946498 3300031903 Unclassified 663
324 Ga0307412_10007478 3300031911 Bacteria 6199
325 Ga0307412_10023605 3300031911 Bacteria 3787
326 Ga0307412_10159093 3300031911 Unclassified 1676
327 Ga0307409_100006468 3300031995 Bacteria 6888
328 Ga0307409_100007468 3300031995 Bacteria 6542
329 Ga0307409_100046364 3300031995 Bacteria 3290
330 Ga0307409_100672366 3300031995 Unclassified 1032
331 Ga0307416_100011751 3300032002 Bacteria 5863
332 Ga0307416_100196996 3300032002 Bacteria 1907
333 Ga0307416_100600306 3300032002 Unclassified 1180
334 Ga0307416_101770878 3300032002 Bacteria 722
335 Ga0307414_10005004 3300032004 Bacteria 7253
336 Ga0307414_10253220 3300032004 Bacteria 1465
337 Ga0307414_10830290 3300032004 Unclassified 844
338 Ga0307411_10008432 3300032005 Bacteria 5339
339 Ga0307411_10081000 3300032005 Unclassified 2234
340 Ga0307411_10091787 3300032005 Bacteria 2122
341 Ga0307411_10409683 3300032005 Bacteria 1123
342 Ga0307411_10435009 3300032005 Bacteria 1093
343 Ga0307415_100073286 3300032126 Bacteria 2415
344 Ga0307415_101456514 3300032126 Unclassified 654
345 Ga0373948_0132183 3300034817 Unclassified 611
346 Ga0373958_0055200 3300034819 Unclassified 848
347 Ga0373938_0149267 3300034957 Unclassified 621
348 Ga0373934_0175444 3300035086 Bacteria 880
349 Ga0373923_0196334 3300035111 Bacteria 932
350 Ga0373960_0018067 3300035121 Unclassified 1834
351 Ga0373962_0152037 3300035242 Unclassified 758
352 Ga0373924_0417320 3300035410 Bacteria 600
353 Ga0373931_0254276 3300035691 Bacteria 1069
354 Ga0373937_0005157 3300036401 Bacteria 11139
355 Ga0373925_0496316 3300037068 Unclassified 1002
356 Ga0451853_2309711 3300041512 Unclassified 639
357 Ga0439446_0135595 3300042156 Unclassified 801
358 Ga0439434_0113870 3300042435 Bacteria 878
359 Ga0451577_0655583 3300042876 Unclassified 952
360 Ga0453683_0395987 3300044673 Unclassified 890
361 Ga0451576_0041468 3300045051 Bacteria 4866
362 Ga0451576_0077449 3300045051 Bacteria 3461
363 Ga0451576_0382861 3300045051 Unclassified 1474
364 Ga0451576_1961297 3300045051 Unclassified 603
365 Ga0451576_2186575 3300045051 Unclassified 568
366 Ga0495629_0385403 3300046459 Bacteria 954
367 Ga0495580_0352273 3300046472 Bacteria 997
368 Ga0495584_0254381 3300046491 Unclassified 893
369 Ga0495608_0456855 3300046511 Bacteria 777
370 Ga0495628_0454381 3300046516 Bacteria 930
371 Ga0495644_0049276 3300046523 Unclassified 1581
372 Ga0495665_0495169 3300046531 Bacteria 616
373 Ga0495598_0005881 3300046537 Bacteria 2743
374 Ga0495621_0034548 3300046539 Unclassified 1747
375 Ga0495621_0043626 3300046539 Bacteria 1582
376 Ga0495645_0281143 3300046543 Bacteria 1094
377 Ga0495633_0052943 3300046558 Bacteria 1911
378 Ga0495667_0313188 3300046559 Unclassified 994
379 Ga0495658_0231947 3300046683 Bacteria 1158
380 Ga0495669_0117811 3300046684 Unclassified 1243
381 Ga0495669_0330521 3300046684 Bacteria 736
382 Ga0495613_0133694 3300046689 Bacteria 1776
383 Ga0495670_0039404 3300046691 Bacteria 2357
384 Ga0495581_0328764 3300047315 Bacteria 893
385 Ga0495604_0819467 3300047317 Unclassified 585
386 Ga0495674_0544249 3300047319 Bacteria 925
387 Ga0495677_0210707 3300047445 Unclassified 756
388 Ga0496104_1421812 3300048907 Unclassified 597
389 Ga0496106_1465991 3300048909 Unclassified 526
390 Ga0496110_1628875 3300048913 Bacteria 555
391 Ga0496112_0429004 3300048915 Bacteria 1260
392 Ga0501299_057072 3300049522 Unclassified 819
393 Ga0501071_1262445 3300049587 Bacteria 571
394 Ga0501217_130783 3300049661 Unclassified 736
395 Ga0501243_042581 3300049675 Bacteria 801
396 Ga0501081_1192809 3300049743 Unclassified 577
397 nmdc:mga00v17_894923_c1 3300050491 Bacteria 562
398 nmdc:mga05p37_115913_c1 3300050507 Bacteria 3293
399 nmdc:mga05p37_18126_c1 3300050507 Bacteria 8505
400 nmdc:mga05p37_376810_c1 3300050507 Bacteria 1664
401 nmdc:mga05p37_392252_c1 3300050507 Bacteria 1623
402 nmdc:mga05p37_63971_c1 3300050507 Bacteria 4527
403 nmdc:mga05p37_72512_c1 3300050507 Bacteria 4237
404 nmdc:mga09592_141507_c1 3300050508 Bacteria 2074
405 nmdc:mga09592_268704_c1 3300050508 Bacteria 1479
406 nmdc:mga09592_894059_c1 3300050508 Bacteria 747
407 nmdc:mga0qj67_241487_c1 3300050509 Bacteria 1465
408 nmdc:mga08y16_1045439_c1 3300050511 Bacteria 794
409 nmdc:mga08y16_1481460_c1 3300050511 Bacteria 640
410 nmdc:mga08y16_1490235_c1 3300050511 Unclassified 637
411 nmdc:mga08y16_207217_c1 3300050511 Bacteria 2031
412 nmdc:mga08y16_4165_c1 3300050511 Bacteria 15104
413 nmdc:mga08y16_4518_c1 3300050511 Bacteria 14522
414 nmdc:mga08y16_493535_c1 3300050511 Unclassified 1245
415 nmdc:mga08y16_662167_c1 3300050511 Bacteria 1047
416 nmdc:mga0n895_1191299_c1 3300050512 Bacteria 736
417 nmdc:mga0n895_587413_c1 3300050512 Bacteria 1117
418 nmdc:mga0n895_743920_c1 3300050512 Unclassified 974
419 nmdc:mga0rr50_1061719_c1 3300050513 Archaea 689
420 nmdc:mga0a205_185075_c1 3300050515 Bacteria 1976
421 nmdc:mga0a205_289290_c1 3300050515 Bacteria 1513
422 nmdc:mga0a205_39704_c1 3300050515 Unclassified 4529
423 nmdc:mga0a205_99178_c1 3300050515 Bacteria 2811
424 Ga0590071_000015 3300059421 Bacteria 45213
425 Ga0590071_017392 3300059421 Bacteria 1689
426 Ga0590074_003054 3300059423 Bacteria 2763
427 Ga0590075_000385 3300059424 Bacteria 12127
428 Ga0590075_074159 3300059424 Unclassified 880
429 Ga0590077_002126 3300059426 Bacteria 4335
430 Ga0501082_1434511 3300060353 Unclassified 603
431 Ga0307416_100679764
432 rootH1_10089043
433 rootL2_10141245
434 Ga0065712_10001154
435 Ga0065715_10009542
436 Ga0065715_10130381
437 Ga0065715_10142271
438 Ga0065715_10297158
439 Ga0065707_10178470
440 Ga0070658_10531363
441 Ga0070676_10011181
442 Ga0070676_10264194
443 Ga0070683_100247582
444 Ga0070690_100073759
445 Ga0070690_100132067
446 Ga0070677_10350392
447 Ga0068869_100661651
448 Ga0070666_10447037
449 Ga0070666_11003905
450 Ga0070680_100628895
451 Ga0070680_101098935
452 Ga0070682_100883568
453 Ga0068868_100412427
454 Ga0068868_100769664
455 Ga0068868_102106448
456 Ga0070689_100012892
457 Ga0070689_100029496
458 Ga0070689_100404603
459 Ga0070689_100481751
460 Ga0070691_10009464
461 Ga0070687_100007457
462 Ga0070687_100264096
463 Ga0070668_100279875
464 Ga0070669_100000853
465 Ga0070669_100354998
466 Ga0070675_100005829
467 Ga0070675_100025885
468 Ga0070675_100213832
469 Ga0070671_100002612
470 Ga0070671_100956961
471 Ga0070673_100123743
472 Ga0070673_100431422
473 Ga0070673_101190670
474 Ga0070688_100017269
475 Ga0070659_100317088
476 Ga0070659_101150521
477 Ga0070659_102082981
478 Ga0070667_100346253
479 Ga0070667_101265595
480 Ga0070710_10098849
481 Ga0070701_10001146
482 Ga0070701_10345305
483 Ga0070705_100000588
484 Ga0070705_100028506
485 Ga0070705_100030634
486 Ga0070700_100013177
487 Ga0070700_100084255
488 Ga0070700_100332597
489 Ga0070700_100487781
490 Ga0070700_101742118
491 Ga0070694_100012755
492 Ga0070694_100157261
493 Ga0070694_100444953
494 Ga0070694_100977034
495 Ga0070694_101298645
496 Ga0070708_101117195
497 Ga0070678_100930738
498 Ga0070662_100073228
499 Ga0070662_100427492
500 Ga0070681_10000864
501 Ga0070681_10389803
502 Ga0068867_100002100
503 Ga0068867_102005109
504 Ga0070706_100596088
505 Ga0070707_100020933
506 Ga0070707_100153985
507 Ga0070707_100998706
508 Ga0070698_100031968
509 Ga0070698_100428058
510 Ga0070698_100462412
511 Ga0070699_100025687
512 Ga0070699_100081647
513 Ga0070679_101407192
514 Ga0070684_100657061
515 Ga0070697_100495240
516 Ga0070697_101077128
517 Ga0070672_100115961
518 Ga0070672_100117671
519 Ga0070672_101495834
520 Ga0070672_101788927
521 Ga0070686_100042909
522 Ga0070686_100089451
523 Ga0070695_100000246
524 Ga0070695_100050773
525 Ga0070695_100514183
526 Ga0070695_101769585
527 Ga0070696_100000481
528 Ga0070696_100196412
529 Ga0070696_101591424
530 Ga0070704_100011735
531 Ga0070704_100044024
532 Ga0070704_100104344
533 Ga0070704_100364003
534 Ga0070704_101392067
535 Ga0070704_101516693
536 Ga0070664_100045039
537 Ga0070664_100878796
538 Ga0068857_100128548
539 Ga0068857_100342765
540 Ga0070702_100163355
541 Ga0070702_100351478
542 Ga0070702_101223545
543 Ga0068852_102779113
544 Ga0068859_100011107
545 Ga0068859_100038873
546 Ga0068859_102800660
547 Ga0068864_100009030
548 Ga0068864_100021084
549 Ga0068864_101096041
550 Ga0068866_10605468
551 Ga0068861_100026808
552 Ga0068870_10026617
553 Ga0068870_10039745
554 Ga0068863_100029361
555 Ga0068863_100119976
556 Ga0068863_100346071
557 Ga0068858_100019864
558 Ga0068860_100008746
559 Ga0068860_100404451
560 Ga0068862_100007498
561 Ga0068862_100323142
562 Ga0068862_100490689
563 Ga0075432_10166440
564 Ga0097621_100043939
565 Ga0097621_100371852
566 Ga0097621_100393785
567 Ga0097621_100418782
568 Ga0097621_100430048
569 Ga0097621_101343312
570 Ga0068871_100102657
571 Ga0068871_100208567
572 Ga0068871_100736409
573 Ga0075428_100014989
574 Ga0075428_100112769
575 Ga0075428_101836361
576 Ga0075431_100917637
577 Ga0075433_10101187
578 Ga0075434_100655842
579 Ga0075434_100946206
580 Ga0075434_102066484
581 Ga0075429_100036055
582 Ga0075429_100275106
583 Ga0068865_100019305
584 Ga0068865_100253945
585 Ga0068865_101424470
586 Ga0097620_100011107
587 Ga0097620_100038873
588 Ga0097620_102802675
589 Ga0075435_100028116
590 Ga0075435_101129947
591 Ga0111539_10006064
592 Ga0111539_10015938
593 Ga0111539_10118762
594 Ga0111539_10682194
595 Ga0111539_10806857
596 Ga0111539_11676053
597 Ga0111539_11960254
598 Ga0105245_11592830
599 Ga0105247_10008452
600 Ga0114129_10011147
601 Ga0114129_10048669
602 Ga0114129_10412762
603 Ga0114129_10718775
604 Ga0114129_10746256
605 Ga0105243_12281920
606 Ga0105241_12490181
607 Ga0105242_10043509
608 Ga0105242_10170683
609 Ga0105242_11144066
610 Ga0105248_10437941
611 Ga0105248_11364747
612 Ga0105248_12005592
613 Ga0105238_10597315
614 Ga0105249_10018926
615 Ga0105249_10427048
616 Ga0105249_10693471
617 Ga0105239_11508113
618 Ga0105239_13073282
619 Ga0157371_10437974
620 Ga0157374_10329123
621 Ga0157378_10419197
622 Ga0157378_10595355
623 Ga0157378_10673330
624 Ga0157378_11794551
625 Ga0157378_12298863
626 Ga0163162_10543533
627 Ga0163162_10573229
628 Ga0157375_10009767
629 Ga0157375_10071204
630 Ga0157375_10498869
631 Ga0163163_10692794
632 Ga0157380_10035142
633 Ga0157380_10430972
634 Ga0157380_10686893
635 Ga0157377_10020995
636 Ga0157377_10112306
637 Ga0157377_10161200
638 Ga0157377_11255417
639 Ga0157379_10072529
640 Ga0157379_10227412
641 Ga0157379_11422859
642 Ga0157379_12417254
643 Ga0157376_10329791
644 Ga0157376_10634824
645 Ga0207666_1009613
646 Ga0207692_10025967
647 Ga0207710_10153585
648 Ga0207680_10119548
649 Ga0207647_10036689
650 Ga0207645_10038769
651 Ga0207643_10001296
652 Ga0207643_10007042
653 Ga0207705_10135141
654 Ga0207707_10003912
655 Ga0207660_10488956
656 Ga0207660_10687841
657 Ga0207660_11090228
658 Ga0207662_10002140
659 Ga0207662_10016204
660 Ga0207649_11572413
661 Ga0207652_10045361
662 Ga0207646_10019679
663 Ga0207646_10111381
664 Ga0207681_10005002
665 Ga0207681_10339577
666 Ga0207650_10006762
667 Ga0207659_10002679
668 Ga0207659_10041307
669 Ga0207659_10193361
670 Ga0207659_10979001
671 Ga0207644_10005777
672 Ga0207690_10086912
673 Ga0207706_10012612
674 Ga0207706_10208360
675 Ga0207706_10305507
676 Ga0207686_10143024
677 Ga0207709_10087043
678 Ga0207709_10137780
679 Ga0207670_10051865
680 Ga0207670_10559633
681 Ga0207670_10768866
682 Ga0207670_11477005
683 Ga0207704_10135167
684 Ga0207704_10994804
685 Ga0207704_11190115
686 Ga0207691_10039883
687 Ga0207691_10071643
688 Ga0207711_10299409
689 Ga0207711_11477836
690 Ga0207711_11606738
691 Ga0207679_10014925
692 Ga0207679_10088230
693 Ga0207651_10036028
694 Ga0207651_10136757
695 Ga0207651_10168035
696 Ga0207651_10771439
697 Ga0207712_10099645
698 Ga0207712_10368971
699 Ga0207668_10273883
700 Ga0207640_10846231
701 Ga0207658_10251905
702 Ga0207703_10012050
703 Ga0207703_10083541
704 Ga0207703_10377851
705 Ga0207708_10024118
706 Ga0207708_10450773
707 Ga0207708_10563056
708 Ga0207641_10040352
709 Ga0207641_10547483
710 Ga0207641_11685293
711 Ga0207648_10003078
712 Ga0207676_10009514
713 Ga0207676_10103846
714 Ga0207676_10119208
715 Ga0207676_10991382
716 Ga0207676_11733743
717 Ga0207674_10181146
718 Ga0207674_10304381
719 Ga0207674_10577535
720 Ga0207675_100005819
721 Ga0207675_100127211
722 Ga0207683_10110015
723 Ga0207698_11697307
724 Ga0209974_10097928
725 Ga0207428_10002747
726 Ga0207428_10004602
727 Ga0207428_10586563
728 Ga0207428_10602426
729 Ga0207428_10621172
730 Ga0268265_10000899
731 Ga0268264_10008837
732 Ga0268264_10350624
733 Ga0268264_10438092
734 Ga0316182_1173289
735 Ga0265330_10048931
736 Ga0307408_100006357
737 Ga0307408_100011858
738 Ga0307405_10000991
739 Ga0307405_10105894
740 Ga0307405_10302416
741 Ga0307405_10476101
742 Ga0307413_10033009
743 Ga0307413_10159959
744 Ga0307410_10077930
745 Ga0307410_10385045
746 Ga0307410_11506754
747 Ga0307406_10032149
748 Ga0307406_10079615
749 Ga0307406_10358135
750 Ga0307407_10001988
751 Ga0307407_10195495
752 Ga0307407_10433483
753 Ga0307407_10946498
754 Ga0307412_10007478
755 Ga0307412_10023605
756 Ga0307412_10159093
757 Ga0307409_100006468
758 Ga0307409_100007468
759 Ga0307409_100046364
760 Ga0307409_100672366
761 Ga0307416_100011751
762 Ga0307416_100196996
763 Ga0307416_100600306
764 Ga0307416_101770878
765 Ga0307414_10005004
766 Ga0307414_10253220
767 Ga0307414_10830290
768 Ga0307411_10008432
769 Ga0307411_10081000
770 Ga0307411_10091787
771 Ga0307411_10409683
772 Ga0307411_10435009
773 Ga0307415_100073286
774 Ga0307415_101456514
775 Ga0373948_0132183
776 Ga0373958_0055200
777 Ga0373938_0149267
778 Ga0373934_0175444
779 Ga0373923_0196334
780 Ga0373960_0018067
781 Ga0373962_0152037
782 Ga0373924_0417320
783 Ga0373931_0254276
784 Ga0373937_0005157
785 Ga0373925_0496316
786 Ga0451853_2309711
787 Ga0439446_0135595
788 Ga0439434_0113870
789 Ga0451577_0655583
790 Ga0453683_0395987
791 Ga0451576_0041468
792 Ga0451576_0077449
793 Ga0451576_0382861
794 Ga0451576_1961297
795 Ga0451576_2186575
796 Ga0495629_0385403
797 Ga0495580_0352273
798 Ga0495584_0254381
799 Ga0495608_0456855
800 Ga0495628_0454381
801 Ga0495644_0049276
802 Ga0495665_0495169
803 Ga0495598_0005881
804 Ga0495621_0034548
805 Ga0495621_0043626
806 Ga0495645_0281143
807 Ga0495633_0052943
808 Ga0495667_0313188
809 Ga0495658_0231947
810 Ga0495669_0117811
811 Ga0495669_0330521
812 Ga0495613_0133694
813 Ga0495670_0039404
814 Ga0495581_0328764
815 Ga0495604_0819467
816 Ga0495674_0544249
817 Ga0495677_0210707
818 Ga0496104_1421812
819 Ga0496106_1465991
820 Ga0496110_1628875
821 Ga0496112_0429004
822 Ga0501299_057072
823 Ga0501071_1262445
824 Ga0501217_130783
825 Ga0501243_042581
826 Ga0501081_1192809
827 nmdc:mga00v17_894923_c1
828 nmdc:mga05p37_115913_c1
829 nmdc:mga05p37_18126_c1
830 nmdc:mga05p37_376810_c1
831 nmdc:mga05p37_392252_c1
832 nmdc:mga05p37_63971_c1
833 nmdc:mga05p37_72512_c1
834 nmdc:mga09592_141507_c1
835 nmdc:mga09592_268704_c1
836 nmdc:mga09592_894059_c1
837 nmdc:mga0qj67_241487_c1
838 nmdc:mga08y16_1045439_c1
839 nmdc:mga08y16_1481460_c1
840 nmdc:mga08y16_1490235_c1
841 nmdc:mga08y16_207217_c1
842 nmdc:mga08y16_4165_c1
843 nmdc:mga08y16_4518_c1
844 nmdc:mga08y16_493535_c1
845 nmdc:mga08y16_662167_c1
846 nmdc:mga0n895_1191299_c1
847 nmdc:mga0n895_587413_c1
848 nmdc:mga0n895_743920_c1
849 nmdc:mga0rr50_1061719_c1
850 nmdc:mga0a205_185075_c1
851 nmdc:mga0a205_289290_c1
852 nmdc:mga0a205_39704_c1
853 nmdc:mga0a205_99178_c1
854 Ga0590071_000015
855 Ga0590071_017392
856 Ga0590074_003054
857 Ga0590075_000385
858 Ga0590075_074159
859 Ga0590077_002126
860 Ga0501082_1434511

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07883

Cupin_2

Cupin domain

34

102

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6o2d-assembly1.cif.gz_B schizosaccharomyces pombe cnp3 cupin domain 0.9394 20 106
6u4v-assembly1.cif.gz_A non-crosslinked wild type cysteine dioxygenase 0.9276 10 106
3l2h-assembly1.cif.gz_D crystal structure of putative sugar phosphate isomerase (afe_0303) from acidithiobacillus ferrooxidans atcc 23270 at 1.85 a resolution 0.9269 30 105
2dct-assembly1.cif.gz_A crystal structure of the tt1209 from thermus thermophilus hb8 0.9226 6 108
8hfb-assembly1.cif.gz_B evolved variant of quercetin 2,4-dioxygenase from bacillus subtilis 0.922 30 107
ID Description Score Start End Superfamily
af_A0A1D8PPZ7_421_512_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9384 18 106 2.60.120.10
2h0vB02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.931 31 104 2.60.120.10
af_F1LVA4_66_267_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9307 31 106 2.60.120.10
af_E7FAC3_1039_1126_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9297 20 105 2.60.120.10
af_Q9USR9_537_626_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.929 18 105 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A381VAW8-F1-model_v4 Cupin type-2 domain-containing protein 0.9755 20 108
AF-A0A381VAW8-F1-model_v4 Cupin type-2 domain-containing protein 0.9647 20 108
AF-A0A651GFP2-F1-model_v4 Cupin domain-containing protein 0.9634 22 112
AF-A0A6L8DZW5-F1-model_v4 Cupin domain-containing protein 0.962 1 109
AF-A0A419UX21-F1-model_v4 Cupin domain-containing protein 0.962 4 106

Map