F442170
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 430 | 247 | 427 | 180 |
Family's Representative Sequence
| Representative Sequence | 3300028380|Ga0268265_10011849|Ga0268265_100118494 |
| Length | 216 |
| Sequence | VTGCPAYRARDIAAGLVQNAGPINAPNHPRETRMSRSLYDIPVSRIDGEKTSLAAYRGKVLLVVNVASECGLTPQYEGLQDLYAEKRAQGLEILGFPANNFGAQEPGTEAEIAAFCTGKFGVEFPMFEKISVLGADRHPLYDALVAAQPKAEGTDAMRKSLIEYGEKPAAETDVLWNFEKFVIGRDGTVLARFSPDITPDDPRLGKVLDRALAAKV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 2 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 3 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 4 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 5 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 6 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 7 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 8 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 9 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 10 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 11 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 12 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 13 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 14 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 15 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 16 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 17 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 18 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 19 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 20 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 56 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 57 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 58 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 59 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 60 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 61 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 62 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 63 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 64 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 65 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 72 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 74 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 96 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 97 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 142 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 143 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 147 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 148 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 149 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 150 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 151 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 152 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 153 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 155 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 156 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 157 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 158 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 159 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 161 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 162 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 163 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 164 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 166 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 167 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 168 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 169 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 170 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 171 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 172 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 173 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 174 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 175 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 176 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 177 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 178 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 197 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 198 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 199 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 200 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 201 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 202 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 203 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 204 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 205 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 206 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 207 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 208 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 209 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 210 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 211 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 216 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 218 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 220 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 222 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 223 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 224 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 225 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 226 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 227 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 228 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 229 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 230 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 231 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 232 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 233 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 234 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 235 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 236 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 237 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 238 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 239 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 240 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 241 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 242 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 243 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 244 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 245 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 246 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 247 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.07 |
| Metatranscriptomes | 0.23 |
| Isolates | 0.7 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0.23 |
| Endosphere | 11.16 |
| Nodule | 0 |
| Rhizoplane | 3.02 |
| Rhizosphere | 80.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1000024 | 3300001904 | Bacteria | 25524 |
| 2 | JGI24741J21665_1006453 | 3300001915 | Bacteria | 2354 |
| 3 | JGI24752J21851_1000048 | 3300001976 | Bacteria | 14796 |
| 4 | JGI24752J21851_1000436 | 3300001976 | Bacteria | 5654 |
| 5 | JGI24740J21852_10004963 | 3300001979 | Bacteria | 5657 |
| 6 | JGI24740J21852_10092384 | 3300001979 | Bacteria | 779 |
| 7 | JGI24739J22299_10024328 | 3300001989 | Bacteria | 2136 |
| 8 | JGI24737J22298_10005153 | 3300001990 | Bacteria | 4525 |
| 9 | JGI24735J21928_10003032 | 3300002067 | Bacteria | 5764 |
| 10 | JGI24750J21931_1000042 | 3300002070 | Bacteria | 16868 |
| 11 | JGI24748J21848_1000063 | 3300002074 | Bacteria | 40664 |
| 12 | JGI24738J21930_10001487 | 3300002075 | Bacteria | 6511 |
| 13 | JGI24749J21850_1000472 | 3300002076 | Bacteria | 5977 |
| 14 | JGI24034J26672_10000007 | 3300002239 | Bacteria | 224370 |
| 15 | JGI24742J22300_10002810 | 3300002244 | Bacteria | 2809 |
| 16 | JGI25153J46596_10000022 | 3300003215 | Bacteria | 251919 |
| 17 | Ga0065704_10102072 | 3300005289 | Bacteria | 2216 |
| 18 | Ga0065704_10123648 | 3300005289 | Bacteria | 1730 |
| 19 | Ga0065704_10160255 | 3300005289 | Bacteria | 1360 |
| 20 | Ga0065704_10325031 | 3300005289 | Bacteria | 847 |
| 21 | Ga0065707_10082105 | 3300005295 | Bacteria | 21836 |
| 22 | Ga0065707_10085380 | 3300005295 | Bacteria | 6198 |
| 23 | Ga0070658_10109171 | 3300005327 | Bacteria | 2291 |
| 24 | Ga0070690_100000110 | 3300005330 | Bacteria | 42574 |
| 25 | Ga0070670_100000068 | 3300005331 | Bacteria | 106494 |
| 26 | Ga0070670_100054238 | 3300005331 | Bacteria | 3441 |
| 27 | Ga0070670_100055168 | 3300005331 | Bacteria | 3411 |
| 28 | Ga0070666_10000417 | 3300005335 | Bacteria | 26409 |
| 29 | Ga0070666_10140055 | 3300005335 | Bacteria | 1685 |
| 30 | Ga0070666_10364932 | 3300005335 | Bacteria | 1035 |
| 31 | Ga0070680_100397693 | 3300005336 | Bacteria | 1174 |
| 32 | Ga0070682_100246689 | 3300005337 | Bacteria | 1285 |
| 33 | Ga0070660_100201009 | 3300005339 | Bacteria | 1616 |
| 34 | Ga0070689_100040808 | 3300005340 | Bacteria | 3559 |
| 35 | Ga0070691_10000365 | 3300005341 | Bacteria | 16356 |
| 36 | Ga0070661_100332032 | 3300005344 | Bacteria | 1189 |
| 37 | Ga0070668_100010990 | 3300005347 | Bacteria | 6739 |
| 38 | Ga0070668_100012847 | 3300005347 | Bacteria | 6234 |
| 39 | Ga0070668_100051630 | 3300005347 | Bacteria | 3169 |
| 40 | Ga0070669_100000332 | 3300005353 | Bacteria | 36750 |
| 41 | Ga0070671_100020174 | 3300005355 | Bacteria | 5432 |
| 42 | Ga0070671_100133994 | 3300005355 | Bacteria | 2088 |
| 43 | Ga0070671_100699680 | 3300005355 | Bacteria | 879 |
| 44 | Ga0070688_100002132 | 3300005365 | Bacteria | 9972 |
| 45 | Ga0070659_100179815 | 3300005366 | Bacteria | 1735 |
| 46 | Ga0070659_100426546 | 3300005366 | Bacteria | 1122 |
| 47 | Ga0070667_100001002 | 3300005367 | Bacteria | 25860 |
| 48 | Ga0070667_100004567 | 3300005367 | Bacteria | 11631 |
| 49 | Ga0070667_100140450 | 3300005367 | Bacteria | 2115 |
| 50 | Ga0070667_100294187 | 3300005367 | Bacteria | 1461 |
| 51 | Ga0070709_10029060 | 3300005434 | Bacteria | 3303 |
| 52 | Ga0070714_100008568 | 3300005435 | Bacteria | 7997 |
| 53 | Ga0070714_100245500 | 3300005435 | Bacteria | 1654 |
| 54 | Ga0070713_100000001 | 3300005436 | Bacteria | 257984 |
| 55 | Ga0070694_100661432 | 3300005444 | Bacteria | 846 |
| 56 | Ga0070678_101185034 | 3300005456 | Bacteria | 708 |
| 57 | Ga0070662_100022201 | 3300005457 | Bacteria | 4341 |
| 58 | Ga0070662_100090184 | 3300005457 | Bacteria | 2300 |
| 59 | Ga0070681_10820922 | 3300005458 | Bacteria | 847 |
| 60 | Ga0070685_10000036 | 3300005466 | Bacteria | 80641 |
| 61 | Ga0070679_101008191 | 3300005530 | Bacteria | 777 |
| 62 | Ga0070684_100179811 | 3300005535 | Bacteria | 1923 |
| 63 | Ga0070684_101118784 | 3300005535 | Bacteria | 740 |
| 64 | Ga0068853_100007961 | 3300005539 | Bacteria | 8499 |
| 65 | Ga0068853_100159077 | 3300005539 | Bacteria | 2037 |
| 66 | Ga0068853_100323253 | 3300005539 | Bacteria | 1431 |
| 67 | Ga0068853_100412531 | 3300005539 | Bacteria | 1265 |
| 68 | Ga0070686_100000045 | 3300005544 | Bacteria | 101988 |
| 69 | Ga0070695_100027185 | 3300005545 | Bacteria | 3543 |
| 70 | Ga0070665_100000042 | 3300005548 | Bacteria | 292582 |
| 71 | Ga0070665_100064289 | 3300005548 | Bacteria | 3679 |
| 72 | Ga0068855_100093068 | 3300005563 | Bacteria | 3476 |
| 73 | Ga0070664_100136766 | 3300005564 | Bacteria | 2155 |
| 74 | Ga0070664_100205330 | 3300005564 | Bacteria | 1759 |
| 75 | Ga0068857_100000759 | 3300005577 | Bacteria | 23985 |
| 76 | Ga0068857_100089178 | 3300005577 | Bacteria | 2759 |
| 77 | Ga0068857_100189435 | 3300005577 | Bacteria | 1873 |
| 78 | Ga0068857_100287823 | 3300005577 | Bacteria | 1512 |
| 79 | Ga0068854_100237589 | 3300005578 | Bacteria | 1449 |
| 80 | Ga0068856_100001359 | 3300005614 | Bacteria | 25713 |
| 81 | Ga0068856_100030985 | 3300005614 | Bacteria | 5232 |
| 82 | Ga0068852_100082637 | 3300005616 | Bacteria | 2855 |
| 83 | Ga0068859_100010776 | 3300005617 | Bacteria | 9202 |
| 84 | Ga0068859_100039829 | 3300005617 | Bacteria | 4716 |
| 85 | Ga0068859_100129578 | 3300005617 | Bacteria | 2594 |
| 86 | Ga0068859_100147706 | 3300005617 | Bacteria | 2426 |
| 87 | Ga0068864_100000019 | 3300005618 | Bacteria | 271650 |
| 88 | Ga0068864_100002289 | 3300005618 | Bacteria | 15834 |
| 89 | Ga0068864_100021332 | 3300005618 | Bacteria | 5427 |
| 90 | Ga0068861_100267663 | 3300005719 | Bacteria | 1466 |
| 91 | Ga0068851_10101458 | 3300005834 | Bacteria | 1527 |
| 92 | Ga0068863_100000015 | 3300005841 | Bacteria | 214824 |
| 93 | Ga0068863_100000280 | 3300005841 | Bacteria | 52729 |
| 94 | Ga0068863_100026005 | 3300005841 | Bacteria | 5585 |
| 95 | Ga0068858_100000884 | 3300005842 | Bacteria | 31099 |
| 96 | Ga0068858_100007900 | 3300005842 | Bacteria | 10254 |
| 97 | Ga0068860_100000104 | 3300005843 | Bacteria | 138111 |
| 98 | Ga0068860_100000182 | 3300005843 | Bacteria | 100888 |
| 99 | Ga0068860_100008984 | 3300005843 | Bacteria | 9954 |
| 100 | Ga0068862_100000094 | 3300005844 | Bacteria | 106159 |
| 101 | Ga0068862_100000308 | 3300005844 | Bacteria | 53687 |
| 102 | Ga0068862_100007221 | 3300005844 | Bacteria | 9224 |
| 103 | Ga0068862_100007469 | 3300005844 | Bacteria | 9060 |
| 104 | Ga0068862_100031122 | 3300005844 | Bacteria | 4501 |
| 105 | Ga0068862_100092289 | 3300005844 | Bacteria | 2639 |
| 106 | Ga0075363_100242074 | 3300006048 | Bacteria | 1037 |
| 107 | Ga0070712_100000761 | 3300006175 | Bacteria | 18982 |
| 108 | Ga0097621_100709310 | 3300006237 | Bacteria | 927 |
| 109 | Ga0068871_100591137 | 3300006358 | Bacteria | 1009 |
| 110 | Ga0075428_100014648 | 3300006844 | Bacteria | 8708 |
| 111 | Ga0075431_100100787 | 3300006847 | Bacteria | 2980 |
| 112 | Ga0075431_100804322 | 3300006847 | Bacteria | 913 |
| 113 | Ga0075434_100076681 | 3300006871 | Bacteria | 3338 |
| 114 | Ga0075436_100002535 | 3300006914 | Bacteria | 12571 |
| 115 | Ga0075436_100016286 | 3300006914 | Bacteria | 5089 |
| 116 | Ga0097620_100010776 | 3300006931 | Bacteria | 9202 |
| 117 | Ga0097620_100039829 | 3300006931 | Bacteria | 4716 |
| 118 | Ga0097620_100129575 | 3300006931 | Bacteria | 2594 |
| 119 | Ga0097620_100147711 | 3300006931 | Bacteria | 2426 |
| 120 | Ga0075435_100083948 | 3300007076 | Bacteria | 2620 |
| 121 | Ga0105251_10000853 | 3300009011 | Bacteria | 27320 |
| 122 | Ga0105251_10112231 | 3300009011 | Bacteria | 1241 |
| 123 | Ga0105240_10002294 | 3300009093 | Bacteria | 30970 |
| 124 | Ga0105240_10015794 | 3300009093 | Bacteria | 10244 |
| 125 | Ga0105240_10032211 | 3300009093 | Bacteria | 6789 |
| 126 | Ga0105240_10511552 | 3300009093 | Bacteria | 1334 |
| 127 | Ga0111539_10703093 | 3300009094 | Bacteria | 1177 |
| 128 | Ga0105247_10003627 | 3300009101 | Bacteria | 10024 |
| 129 | Ga0105247_10131270 | 3300009101 | Bacteria | 1633 |
| 130 | Ga0105241_10100637 | 3300009174 | Bacteria | 2297 |
| 131 | Ga0105241_10573249 | 3300009174 | Bacteria | 1016 |
| 132 | Ga0105241_10620290 | 3300009174 | Bacteria | 979 |
| 133 | Ga0105248_10000311 | 3300009177 | Bacteria | 57870 |
| 134 | Ga0105248_10171244 | 3300009177 | Bacteria | 2447 |
| 135 | Ga0105248_10202280 | 3300009177 | Bacteria | 2238 |
| 136 | Ga0105237_10106567 | 3300009545 | Bacteria | 2795 |
| 137 | Ga0105238_10000045 | 3300009551 | Bacteria | 148069 |
| 138 | Ga0105238_10002544 | 3300009551 | Bacteria | 18220 |
| 139 | Ga0105238_10101524 | 3300009551 | Bacteria | 2859 |
| 140 | Ga0105238_10128822 | 3300009551 | Bacteria | 2509 |
| 141 | Ga0105238_10152585 | 3300009551 | Bacteria | 2285 |
| 142 | Ga0105238_10515016 | 3300009551 | Bacteria | 1198 |
| 143 | Ga0105238_11450410 | 3300009551 | Bacteria | 714 |
| 144 | Ga0105249_10000012 | 3300009553 | Bacteria | 292640 |
| 145 | Ga0105249_10000568 | 3300009553 | Bacteria | 33920 |
| 146 | Ga0105249_10007607 | 3300009553 | Bacteria | 9452 |
| 147 | Ga0105249_10315483 | 3300009553 | Bacteria | 1573 |
| 148 | Ga0105239_10010826 | 3300010375 | Bacteria | 10192 |
| 149 | Ga0105239_10910658 | 3300010375 | Bacteria | 1009 |
| 150 | Ga0157373_10019637 | 3300013100 | Bacteria | 4915 |
| 151 | Ga0157370_10024209 | 3300013104 | Bacteria | 6016 |
| 152 | Ga0157370_10035418 | 3300013104 | Bacteria | 4851 |
| 153 | Ga0157369_10004483 | 3300013105 | Bacteria | 16454 |
| 154 | Ga0157369_10004714 | 3300013105 | Bacteria | 16032 |
| 155 | Ga0157369_10031631 | 3300013105 | Bacteria | 5825 |
| 156 | Ga0157374_10141842 | 3300013296 | Bacteria | 2333 |
| 157 | Ga0157374_10265574 | 3300013296 | Bacteria | 1691 |
| 158 | Ga0163162_10045923 | 3300013306 | Bacteria | 4378 |
| 159 | Ga0163162_10058375 | 3300013306 | Bacteria | 3887 |
| 160 | Ga0163162_10184997 | 3300013306 | Bacteria | 2210 |
| 161 | Ga0163162_10298086 | 3300013306 | Bacteria | 1744 |
| 162 | Ga0157372_10321824 | 3300013307 | Bacteria | 1800 |
| 163 | Ga0157375_11729340 | 3300013308 | Bacteria | 741 |
| 164 | Ga0163163_10067350 | 3300014325 | Bacteria | 3560 |
| 165 | Ga0163163_10177594 | 3300014325 | Bacteria | 2176 |
| 166 | Ga0163163_10230076 | 3300014325 | Bacteria | 1903 |
| 167 | Ga0163163_10317700 | 3300014325 | Bacteria | 1611 |
| 168 | Ga0163163_10369885 | 3300014325 | Bacteria | 1490 |
| 169 | Ga0157380_10000151 | 3300014326 | Bacteria | 39765 |
| 170 | Ga0157380_10003723 | 3300014326 | Bacteria | 10487 |
| 171 | Ga0157380_10154540 | 3300014326 | Bacteria | 1987 |
| 172 | Ga0157379_10026550 | 3300014968 | Bacteria | 5155 |
| 173 | Ga0157379_10166992 | 3300014968 | Bacteria | 1987 |
| 174 | Ga0157379_10607493 | 3300014968 | Bacteria | 1021 |
| 175 | Ga0163161_10000202 | 3300017792 | Bacteria | 54518 |
| 176 | Ga0163161_10166644 | 3300017792 | Bacteria | 1682 |
| 177 | Ga0213872_10105236 | 3300021361 | Bacteria | 1256 |
| 178 | Ga0213871_10042092 | 3300021441 | Bacteria | 1229 |
| 179 | Ga0209758_1000005 | 3300025297 | Bacteria | 1368918 |
| 180 | Ga0209758_1026400 | 3300025297 | Bacteria | 2514 |
| 181 | Ga0209257_1024848 | 3300025304 | Bacteria | 2062 |
| 182 | Ga0207656_10025940 | 3300025321 | Bacteria | 2384 |
| 183 | Ga0207713_1015664 | 3300025735 | Bacteria | 3879 |
| 184 | Ga0207710_10003244 | 3300025900 | Bacteria | 7267 |
| 185 | Ga0207710_10081772 | 3300025900 | Bacteria | 1500 |
| 186 | Ga0207680_10000012 | 3300025903 | Bacteria | 293810 |
| 187 | Ga0207680_10089654 | 3300025903 | Bacteria | 1953 |
| 188 | Ga0207647_10015957 | 3300025904 | Bacteria | 5135 |
| 189 | Ga0207699_10000445 | 3300025906 | Bacteria | 21151 |
| 190 | Ga0207699_10026341 | 3300025906 | Bacteria | 3203 |
| 191 | Ga0207705_10071923 | 3300025909 | Bacteria | 2508 |
| 192 | Ga0207654_10001661 | 3300025911 | Bacteria | 11622 |
| 193 | Ga0207654_10438945 | 3300025911 | Bacteria | 914 |
| 194 | Ga0207695_10000641 | 3300025913 | Bacteria | 69705 |
| 195 | Ga0207695_10024262 | 3300025913 | Bacteria | 6829 |
| 196 | Ga0207695_10040856 | 3300025913 | Bacteria | 4968 |
| 197 | Ga0207695_10385116 | 3300025913 | Bacteria | 1287 |
| 198 | Ga0207671_10002738 | 3300025914 | Bacteria | 18433 |
| 199 | Ga0207671_10125640 | 3300025914 | Bacteria | 1964 |
| 200 | Ga0207693_10000456 | 3300025915 | Bacteria | 37291 |
| 201 | Ga0207649_10543355 | 3300025920 | Bacteria | 888 |
| 202 | Ga0207681_10000076 | 3300025923 | Bacteria | 89353 |
| 203 | Ga0207681_10026005 | 3300025923 | Bacteria | 3772 |
| 204 | Ga0207694_10001350 | 3300025924 | Bacteria | 21139 |
| 205 | Ga0207694_10001461 | 3300025924 | Bacteria | 20212 |
| 206 | Ga0207694_10105273 | 3300025924 | Bacteria | 2239 |
| 207 | Ga0207694_10118885 | 3300025924 | Bacteria | 2109 |
| 208 | Ga0207694_10240619 | 3300025924 | Bacteria | 1479 |
| 209 | Ga0207650_10000054 | 3300025925 | Bacteria | 162602 |
| 210 | Ga0207650_10012613 | 3300025925 | Bacteria | 5833 |
| 211 | Ga0207650_10071137 | 3300025925 | Bacteria | 2616 |
| 212 | Ga0207700_10000015 | 3300025928 | Bacteria | 224772 |
| 213 | Ga0207664_10020189 | 3300025929 | Bacteria | 4935 |
| 214 | Ga0207664_10191333 | 3300025929 | Bacteria | 1761 |
| 215 | Ga0207644_10618185 | 3300025931 | Bacteria | 900 |
| 216 | Ga0207690_10040990 | 3300025932 | Bacteria | 3031 |
| 217 | Ga0207706_10018187 | 3300025933 | Bacteria | 6322 |
| 218 | Ga0207706_10115904 | 3300025933 | Bacteria | 2356 |
| 219 | Ga0207706_10394424 | 3300025933 | Bacteria | 1200 |
| 220 | Ga0207670_10028238 | 3300025936 | Bacteria | 3559 |
| 221 | Ga0207665_10139190 | 3300025939 | Bacteria | 1729 |
| 222 | Ga0207711_10000017 | 3300025941 | Bacteria | 441730 |
| 223 | Ga0207711_10030705 | 3300025941 | Bacteria | 4533 |
| 224 | Ga0207711_10401952 | 3300025941 | Bacteria | 1273 |
| 225 | Ga0207661_10955406 | 3300025944 | Bacteria | 789 |
| 226 | Ga0207679_10079428 | 3300025945 | Bacteria | 2502 |
| 227 | Ga0207667_10004663 | 3300025949 | Bacteria | 16793 |
| 228 | Ga0207667_10005157 | 3300025949 | Bacteria | 15956 |
| 229 | Ga0207667_10044332 | 3300025949 | Bacteria | 4714 |
| 230 | Ga0207712_10000002 | 3300025961 | Bacteria | 706628 |
| 231 | Ga0207712_10000021 | 3300025961 | Bacteria | 292649 |
| 232 | Ga0207712_10000163 | 3300025961 | Bacteria | 68522 |
| 233 | Ga0207712_10444070 | 3300025961 | Bacteria | 1099 |
| 234 | Ga0207668_10007043 | 3300025972 | Bacteria | 6670 |
| 235 | Ga0207668_10016352 | 3300025972 | Bacteria | 4628 |
| 236 | Ga0207668_10052683 | 3300025972 | Bacteria | 2816 |
| 237 | Ga0207640_10292715 | 3300025981 | Bacteria | 1284 |
| 238 | Ga0207658_10000223 | 3300025986 | Bacteria | 59510 |
| 239 | Ga0207658_10001629 | 3300025986 | Bacteria | 17221 |
| 240 | Ga0207658_10018834 | 3300025986 | Bacteria | 4774 |
| 241 | Ga0207658_10308407 | 3300025986 | Bacteria | 1366 |
| 242 | Ga0207658_10403217 | 3300025986 | Bacteria | 1202 |
| 243 | Ga0207703_10000593 | 3300026035 | Bacteria | 36861 |
| 244 | Ga0207703_10098271 | 3300026035 | Bacteria | 2475 |
| 245 | Ga0207639_10000300 | 3300026041 | Bacteria | 35006 |
| 246 | Ga0207639_10015953 | 3300026041 | Bacteria | 5305 |
| 247 | Ga0207639_10058399 | 3300026041 | Bacteria | 2968 |
| 248 | Ga0207639_10383793 | 3300026041 | Bacteria | 1262 |
| 249 | Ga0207639_10437558 | 3300026041 | Bacteria | 1185 |
| 250 | Ga0207678_10003417 | 3300026067 | Bacteria | 14294 |
| 251 | Ga0207702_10000011 | 3300026078 | Bacteria | 284514 |
| 252 | Ga0207702_10008254 | 3300026078 | Bacteria | 8801 |
| 253 | Ga0207702_10027197 | 3300026078 | Bacteria | 4750 |
| 254 | Ga0207641_10000008 | 3300026088 | Bacteria | 424415 |
| 255 | Ga0207641_10000414 | 3300026088 | Bacteria | 49835 |
| 256 | Ga0207641_10019187 | 3300026088 | Bacteria | 5610 |
| 257 | Ga0207676_10000019 | 3300026095 | Bacteria | 305653 |
| 258 | Ga0207676_10001758 | 3300026095 | Bacteria | 15884 |
| 259 | Ga0207676_10009609 | 3300026095 | Bacteria | 6885 |
| 260 | Ga0207674_10000002 | 3300026116 | Bacteria | 279738 |
| 261 | Ga0207674_10019146 | 3300026116 | Bacteria | 7421 |
| 262 | Ga0207674_10041562 | 3300026116 | Bacteria | 4753 |
| 263 | Ga0207674_10197203 | 3300026116 | Bacteria | 1963 |
| 264 | Ga0207675_100000227 | 3300026118 | Bacteria | 53090 |
| 265 | Ga0207675_100014364 | 3300026118 | Bacteria | 7384 |
| 266 | Ga0207675_100837255 | 3300026118 | Bacteria | 934 |
| 267 | Ga0207683_10657017 | 3300026121 | Unclassified | 971 |
| 268 | Ga0207683_11018422 | 3300026121 | Bacteria | 769 |
| 269 | Ga0268266_10000054 | 3300028379 | Bacteria | 292717 |
| 270 | Ga0268266_10066557 | 3300028379 | Bacteria | 3116 |
| 271 | Ga0268265_10000011 | 3300028380 | Bacteria | 343832 |
| 272 | Ga0268265_10000104 | 3300028380 | Bacteria | 105776 |
| 273 | Ga0268265_10001421 | 3300028380 | Bacteria | 20258 |
| 274 | Ga0268265_10004916 | 3300028380 | Bacteria | 9189 |
| 275 | Ga0268265_10005318 | 3300028380 | Bacteria | 8827 |
| 276 | Ga0268265_10011849 | 3300028380 | Bacteria | 5894 |
| 277 | Ga0268265_10050795 | 3300028380 | Bacteria | 3126 |
| 278 | Ga0268265_10344499 | 3300028380 | Unclassified | 1358 |
| 279 | Ga0268265_10354153 | 3300028380 | Bacteria | 1341 |
| 280 | Ga0268265_10365075 | 3300028380 | Bacteria | 1323 |
| 281 | Ga0268264_10000008 | 3300028381 | Bacteria | 773387 |
| 282 | Ga0268264_10000074 | 3300028381 | Bacteria | 259555 |
| 283 | Ga0268264_10045406 | 3300028381 | Bacteria | 3647 |
| 284 | Ga0307517_10407881 | 3300028786 | Bacteria | 717 |
| 285 | Ga0307515_10033612 | 3300028794 | Bacteria | 8432 |
| 286 | Ga0265338_10005677 | 3300028800 | Bacteria | 16159 |
| 287 | Ga0265338_10134720 | 3300028800 | Bacteria | 1944 |
| 288 | Ga0265332_10011981 | 3300031238 | Bacteria | 3849 |
| 289 | Ga0265327_10000952 | 3300031251 | Bacteria | 41843 |
| 290 | Ga0307513_10015734 | 3300031456 | Bacteria | 9157 |
| 291 | Ga0307508_10135290 | 3300031616 | Bacteria | 2068 |
| 292 | Ga0316576_10471369 | 3300031727 | Bacteria | 926 |
| 293 | Ga0316578_10123241 | 3300031728 | Bacteria | 1559 |
| 294 | Ga0316578_10205206 | 3300031728 | Bacteria | 1186 |
| 295 | Ga0307516_10000820 | 3300031730 | Bacteria | 42605 |
| 296 | Ga0307516_10142349 | 3300031730 | Bacteria | 2166 |
| 297 | Ga0307405_10151422 | 3300031731 | Bacteria | 1631 |
| 298 | Ga0307405_10542519 | 3300031731 | Bacteria | 939 |
| 299 | Ga0307406_10315386 | 3300031901 | Bacteria | 1207 |
| 300 | Ga0307412_10171295 | 3300031911 | Bacteria | 1623 |
| 301 | Ga0307409_100062284 | 3300031995 | Bacteria | 2920 |
| 302 | Ga0307409_101094707 | 3300031995 | Bacteria | 818 |
| 303 | Ga0307409_102374967 | 3300031995 | Bacteria | 559 |
| 304 | Ga0307411_11375358 | 3300032005 | Bacteria | 645 |
| 305 | Ga0307510_10000001 | 3300033180 | Bacteria | 1172244 |
| 306 | Ga0307510_10006416 | 3300033180 | Bacteria | 14025 |
| 307 | Ga0373923_0194686 | 3300035111 | Bacteria | 935 |
| 308 | Ga0373936_0023372 | 3300035113 | Bacteria | 2409 |
| 309 | Ga0373956_0129000 | 3300035119 | Bacteria | 1183 |
| 310 | Ga0373957_0050987 | 3300035120 | Bacteria | 1583 |
| 311 | Ga0373955_0004309 | 3300035172 | Bacteria | 6287 |
| 312 | Ga0316574_0234706 | 3300035398 | Bacteria | 1173 |
| 313 | Ga0373933_0029509 | 3300035724 | Bacteria | 3172 |
| 314 | Ga0373937_0214699 | 3300036401 | Bacteria | 1810 |
| 315 | Ga0316584_0057679 | 3300036712 | Bacteria | 2907 |
| 316 | Ga0436364_0013276 | 3300037853 | Bacteria | 5331 |
| 317 | Ga0237819_00546 | 3300038705 | Bacteria | 12675 |
| 318 | Ga0436365_1797099 | 3300039437 | Bacteria | 84930 |
| 319 | Ga0436360_1168634 | 3300039438 | Bacteria | 10578 |
| 320 | Ga0436360_1227163 | 3300039438 | Bacteria | 575 |
| 321 | Ga0436361_0493436 | 3300039447 | Bacteria | 15670 |
| 322 | Ga0436362_0770601 | 3300039453 | Bacteria | 1516 |
| 323 | Ga0451853_2791993 | 3300041512 | Bacteria | 888 |
| 324 | Ga0439449_0085640 | 3300042007 | Bacteria | 1163 |
| 325 | Ga0466965_0112846 | 3300044683 | Bacteria | 1398 |
| 326 | Ga0453684_0647825 | 3300044712 | Bacteria | 1153 |
| 327 | Ga0466957_0052546 | 3300044842 | Bacteria | 2481 |
| 328 | Ga0451576_0706404 | 3300045051 | Bacteria | 1059 |
| 329 | Ga0495638_0310737 | 3300046460 | Bacteria | 846 |
| 330 | Ga0495616_0319413 | 3300046513 | Bacteria | 652 |
| 331 | Ga0495663_0008887 | 3300046525 | Bacteria | 2787 |
| 332 | Ga0495654_0006012 | 3300046530 | Bacteria | 6967 |
| 333 | Ga0495654_0015546 | 3300046530 | Bacteria | 4040 |
| 334 | Ga0495587_0242948 | 3300046536 | Bacteria | 1013 |
| 335 | Ga0495622_0059439 | 3300046557 | Bacteria | 1770 |
| 336 | Ga0495668_0010907 | 3300046616 | Bacteria | 5472 |
| 337 | Ga0495668_0016018 | 3300046616 | Bacteria | 4366 |
| 338 | Ga0495625_0097051 | 3300046660 | Bacteria | 2029 |
| 339 | Ga0495657_0186300 | 3300046675 | Bacteria | 1270 |
| 340 | Ga0495669_0036518 | 3300046684 | Bacteria | 2172 |
| 341 | Ga0495589_0123485 | 3300046794 | Bacteria | 1246 |
| 342 | Ga0495604_0688441 | 3300047317 | Bacteria | 650 |
| 343 | Ga0495672_0049418 | 3300047320 | Bacteria | 2489 |
| 344 | Ga0495672_0190972 | 3300047320 | Bacteria | 1030 |
| 345 | Ga0495677_0005540 | 3300047445 | Bacteria | 4782 |
| 346 | Ga0495686_0003725 | 3300047472 | Bacteria | 13010 |
| 347 | Ga0495686_0015352 | 3300047472 | Bacteria | 5232 |
| 348 | Ga0495686_0137875 | 3300047472 | Bacteria | 1442 |
| 349 | Ga0495602_0159679 | 3300048088 | Bacteria | 1762 |
| 350 | Ga0496100_0029233 | 3300048903 | Bacteria | 3407 |
| 351 | Ga0496101_0187333 | 3300048904 | Bacteria | 1596 |
| 352 | Ga0496101_0539426 | 3300048904 | Bacteria | 922 |
| 353 | Ga0496102_0067110 | 3300048905 | Bacteria | 3289 |
| 354 | Ga0496103_0001901 | 3300048906 | Bacteria | 13580 |
| 355 | Ga0496103_0086609 | 3300048906 | Bacteria | 1975 |
| 356 | Ga0496104_0073721 | 3300048907 | Bacteria | 3248 |
| 357 | Ga0496105_0069283 | 3300048908 | Bacteria | 2915 |
| 358 | Ga0496106_0183233 | 3300048909 | Bacteria | 1663 |
| 359 | Ga0496111_0345760 | 3300048914 | Bacteria | 1101 |
| 360 | Ga0496112_0115455 | 3300048915 | Bacteria | 2655 |
| 361 | Ga0496112_1240881 | 3300048915 | Unclassified | 662 |
| 362 | Ga0496114_0777858 | 3300048917 | Bacteria | 835 |
| 363 | Ga0496117_0003796 | 3300048920 | Bacteria | 17237 |
| 364 | Ga0496117_0006080 | 3300048920 | Bacteria | 12379 |
| 365 | Ga0496118_0000870 | 3300048921 | Bacteria | 47798 |
| 366 | Ga0496118_0027199 | 3300048921 | Bacteria | 4847 |
| 367 | Ga0496120_0342170 | 3300048923 | Bacteria | 674 |
| 368 | Ga0496122_0000879 | 3300048925 | Bacteria | 56300 |
| 369 | Ga0496123_0000676 | 3300048926 | Bacteria | 56312 |
| 370 | Ga0496125_0173209 | 3300048928 | Bacteria | 1448 |
| 371 | Ga0496126_0003032 | 3300048929 | Bacteria | 21769 |
| 372 | Ga0495678_101596 | 3300049459 | Bacteria | 995 |
| 373 | Ga0501034_0152702 | 3300049571 | Bacteria | 2284 |
| 374 | Ga0501046_0269042 | 3300049580 | Bacteria | 1250 |
| 375 | Ga0501047_0003777 | 3300049581 | Bacteria | 14254 |
| 376 | Ga0501257_004737 | 3300049686 | Bacteria | 2976 |
| 377 | Ga0501044_0240198 | 3300049823 | Bacteria | 1756 |
| 378 | nmdc:mga06r32_377195_c1 | 3300050510 | Bacteria | 1401 |
| 379 | nmdc:mga06r32_748034_c1 | 3300050510 | Bacteria | 941 |
| 380 | nmdc:mga0n895_75397_c1 | 3300050512 | Bacteria | 3353 |
| 381 | nmdc:mga0rr50_32063_c1 | 3300050513 | Bacteria | 3739 |
| 382 | nmdc:mga08x19_1603_c1 | 3300050514 | Bacteria | 14031 |
| 383 | nmdc:mga08x19_37023_c1 | 3300050514 | Bacteria | 3094 |
| 384 | Ga0500578_0030847 | 3300053086 | Bacteria | 3444 |
| 385 | Ga0500643_000474 | 3300053087 | Bacteria | 29409 |
| 386 | Ga0500643_002858 | 3300053087 | Bacteria | 8604 |
| 387 | Ga0500643_005342 | 3300053087 | Bacteria | 5554 |
| 388 | Ga0500643_008934 | 3300053087 | Bacteria | 3878 |
| 389 | Ga0500644_0195020 | 3300053088 | Bacteria | 835 |
| 390 | Ga0500644_0302329 | 3300053088 | Bacteria | 685 |
| 391 | Ga0500646_0022921 | 3300053090 | Bacteria | 1672 |
| 392 | Ga0500646_0093214 | 3300053090 | Bacteria | 935 |
| 393 | Ga0500583_0195322 | 3300053092 | Bacteria | 1006 |
| 394 | Ga0500651_0157838 | 3300053093 | Bacteria | 1358 |
| 395 | Ga0500651_0159232 | 3300053093 | Bacteria | 1351 |
| 396 | Ga0500566_0024737 | 3300053094 | Bacteria | 3523 |
| 397 | Ga0500641_0020427 | 3300053096 | Bacteria | 2514 |
| 398 | Ga0500654_151078 | 3300053099 | Bacteria | 816 |
| 399 | Ga0500592_000243 | 3300053116 | Bacteria | 9903 |
| 400 | Ga0500592_002917 | 3300053116 | Bacteria | 2744 |
| 401 | Ga0500594_0096107 | 3300053118 | Bacteria | 906 |
| 402 | Ga0500595_000113 | 3300053119 | Bacteria | 53829 |
| 403 | Ga0500642_0000307 | 3300053130 | Bacteria | 17520 |
| 404 | Ga0500642_0359719 | 3300053130 | Bacteria | 644 |
| 405 | Ga0500652_215996 | 3300053131 | Bacteria | 773 |
| 406 | Ga0500655_042941 | 3300053133 | Bacteria | 890 |
| 407 | Ga0500658_0042703 | 3300053134 | Bacteria | 1823 |
| 408 | Ga0500658_0274251 | 3300053134 | Bacteria | 775 |
| 409 | Ga0500559_0009362 | 3300053136 | Bacteria | 4245 |
| 410 | Ga0500559_0473438 | 3300053136 | Bacteria | 577 |
| 411 | Ga0500568_0009693 | 3300053139 | Bacteria | 4560 |
| 412 | Ga0500568_0031758 | 3300053139 | Bacteria | 2176 |
| 413 | Ga0500568_0049335 | 3300053139 | Bacteria | 1662 |
| 414 | Ga0500577_0015605 | 3300053142 | Bacteria | 2376 |
| 415 | Ga0500577_0178460 | 3300053142 | Bacteria | 911 |
| 416 | Ga0500577_0214656 | 3300053142 | Bacteria | 832 |
| 417 | Ga0500588_0004071 | 3300053146 | Bacteria | 3137 |
| 418 | Ga0500588_0129788 | 3300053146 | Bacteria | 896 |
| 419 | Ga0500604_0001648 | 3300053151 | Bacteria | 6272 |
| 420 | Ga0500616_0001170 | 3300053153 | Bacteria | 26722 |
| 421 | Ga0500622_0164163 | 3300053156 | Bacteria | 1039 |
| 422 | Ga0500627_0000329 | 3300053158 | Bacteria | 12969 |
| 423 | Ga0500627_0000347 | 3300053158 | Bacteria | 12569 |
| 424 | Ga0500627_0072521 | 3300053158 | Bacteria | 1527 |
| 425 | Ga0500611_048924 | 3300053727 | Bacteria | 960 |
| 426 | Ga0500609_000193 | 3300053731 | Bacteria | 8665 |
| 427 | Ga0587085_093888 | 3300059506 | Bacteria | 624 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300039438 | Ga0436360_1227163 | Ga0436360_1227163_14_484 | 156 |
| 2 | 3300005347 | Ga0070668_100012847 | Ga0070668_1000128476 | 157 |
| 3 | 3300009545 | Ga0105237_10106567 | Ga0105237_101065673 | 158 |
| 4 | 3300025914 | Ga0207671_10125640 | Ga0207671_101256402 | 158 |
| 5 | 3300031995 | Ga0307409_102374967 | Ga0307409_1023749671 | 158 |
| 6 | 3300053090 | Ga0500646_0022921 | Ga0500646_0022921_235_711 | 158 |
| 7 | 3300053139 | Ga0500568_0031758 | Ga0500568_0031758_97_573 | 158 |
| 8 | 3300005336 | Ga0070680_100397693 | Ga0070680_1003976932 | 159 |
| 9 | 3300005341 | Ga0070691_10000365 | Ga0070691_100003659 | 159 |
| 10 | 3300005434 | Ga0070709_10029060 | Ga0070709_100290602 | 159 |
| 11 | 3300005435 | Ga0070714_100008568 | Ga0070714_10000856810 | 159 |
| 12 | 3300005435 | Ga0070714_100245500 | Ga0070714_1002455002 | 159 |
| 13 | 3300005436 | Ga0070713_100000001 | Ga0070713_100000001221 | 159 |
| 14 | 3300005444 | Ga0070694_100661432 | Ga0070694_1006614322 | 159 |
| 15 | 3300005458 | Ga0070681_10820922 | Ga0070681_108209222 | 159 |
| 16 | 3300005535 | Ga0070684_101118784 | Ga0070684_1011187841 | 159 |
| 17 | 3300005539 | Ga0068853_100007961 | Ga0068853_1000079614 | 159 |
| 18 | 3300005539 | Ga0068853_100159077 | Ga0068853_1001590772 | 159 |
| 19 | 3300005545 | Ga0070695_100027185 | Ga0070695_1000271853 | 159 |
| 20 | 3300005563 | Ga0068855_100093068 | Ga0068855_1000930683 | 159 |
| 21 | 3300005564 | Ga0070664_100136766 | Ga0070664_1001367663 | 159 |
| 22 | 3300005577 | Ga0068857_100000759 | Ga0068857_1000007594 | 159 |
| 23 | 3300005614 | Ga0068856_100001359 | Ga0068856_10000135921 | 159 |
| 24 | 3300005614 | Ga0068856_100030985 | Ga0068856_1000309854 | 159 |
| 25 | 3300005616 | Ga0068852_100082637 | Ga0068852_1000826372 | 159 |
| 26 | 3300005844 | Ga0068862_100007469 | Ga0068862_1000074693 | 159 |
| 27 | 3300006175 | Ga0070712_100000761 | Ga0070712_10000076113 | 159 |
| 28 | 3300006237 | Ga0097621_100709310 | Ga0097621_1007093102 | 159 |
| 29 | 3300006358 | Ga0068871_100591137 | Ga0068871_1005911372 | 159 |
| 30 | 3300006871 | Ga0075434_100076681 | Ga0075434_1000766815 | 159 |
| 31 | 3300006914 | Ga0075436_100002535 | Ga0075436_10000253513 | 159 |
| 32 | 3300006914 | Ga0075436_100016286 | Ga0075436_1000162862 | 159 |
| 33 | 3300007076 | Ga0075435_100083948 | Ga0075435_1000839482 | 159 |
| 34 | 3300009093 | Ga0105240_10032211 | Ga0105240_100322115 | 159 |
| 35 | 3300009174 | Ga0105241_10100637 | Ga0105241_101006373 | 159 |
| 36 | 3300009551 | Ga0105238_10002544 | Ga0105238_100025443 | 159 |
| 37 | 3300010375 | Ga0105239_10010826 | Ga0105239_100108262 | 159 |
| 38 | 3300013100 | Ga0157373_10019637 | Ga0157373_100196375 | 159 |
| 39 | 3300013104 | Ga0157370_10035418 | Ga0157370_100354185 | 159 |
| 40 | 3300013105 | Ga0157369_10004483 | Ga0157369_1000448316 | 159 |
| 41 | 3300013296 | Ga0157374_10141842 | Ga0157374_101418422 | 159 |
| 42 | 3300013306 | Ga0163162_10184997 | Ga0163162_101849972 | 159 |
| 43 | 3300014325 | Ga0163163_10177594 | Ga0163163_101775943 | 159 |
| 44 | 3300014325 | Ga0163163_10317700 | Ga0163163_103177002 | 159 |
| 45 | 3300014325 | Ga0163163_10369885 | Ga0163163_103698852 | 159 |
| 46 | 3300014968 | Ga0157379_10026550 | Ga0157379_100265502 | 159 |
| 47 | 3300025906 | Ga0207699_10000445 | Ga0207699_1000044515 | 159 |
| 48 | 3300025906 | Ga0207699_10026341 | Ga0207699_100263412 | 159 |
| 49 | 3300025913 | Ga0207695_10040856 | Ga0207695_100408564 | 159 |
| 50 | 3300025915 | Ga0207693_10000456 | Ga0207693_1000045628 | 159 |
| 51 | 3300025928 | Ga0207700_10000015 | Ga0207700_1000001545 | 159 |
| 52 | 3300025929 | Ga0207664_10020189 | Ga0207664_100201896 | 159 |
| 53 | 3300025929 | Ga0207664_10191333 | Ga0207664_101913333 | 159 |
| 54 | 3300025939 | Ga0207665_10139190 | Ga0207665_101391902 | 159 |
| 55 | 3300025945 | Ga0207679_10079428 | Ga0207679_100794283 | 159 |
| 56 | 3300025949 | Ga0207667_10005157 | Ga0207667_100051578 | 159 |
| 57 | 3300025972 | Ga0207668_10007043 | Ga0207668_100070432 | 159 |
| 58 | 3300026041 | Ga0207639_10000300 | Ga0207639_1000030033 | 159 |
| 59 | 3300026041 | Ga0207639_10015953 | Ga0207639_100159533 | 159 |
| 60 | 3300026078 | Ga0207702_10000011 | Ga0207702_1000001140 | 159 |
| 61 | 3300026078 | Ga0207702_10027197 | Ga0207702_100271972 | 159 |
| 62 | 3300026116 | Ga0207674_10000002 | Ga0207674_1000000242 | 159 |
| 63 | 3300028380 | Ga0268265_10001421 | Ga0268265_1000142121 | 159 |
| 64 | 3300028380 | Ga0268265_10354153 | Ga0268265_103541532 | 159 |
| 65 | 3300035111 | Ga0373923_0194686 | Ga0373923_0194686_288_767 | 159 |
| 66 | 3300035119 | Ga0373956_0129000 | Ga0373956_0129000_513_992 | 159 |
| 67 | 3300035120 | Ga0373957_0050987 | Ga0373957_0050987_559_1038 | 159 |
| 68 | 3300035172 | Ga0373955_0004309 | Ga0373955_0004309_3816_4295 | 159 |
| 69 | 3300035724 | Ga0373933_0029509 | Ga0373933_0029509_2017_2496 | 159 |
| 70 | 3300036401 | Ga0373937_0214699 | Ga0373937_0214699_576_1055 | 159 |
| 71 | 3300042007 | Ga0439449_0085640 | Ga0439449_0085640_368_847 | 159 |
| 72 | 3300044683 | Ga0466965_0112846 | Ga0466965_0112846_862_1341 | 159 |
| 73 | 3300046530 | Ga0495654_0015546 | Ga0495654_0015546_1441_1920 | 159 |
| 74 | 3300046536 | Ga0495587_0242948 | Ga0495587_0242948_77_556 | 159 |
| 75 | 3300046675 | Ga0495657_0186300 | Ga0495657_0186300_570_1049 | 159 |
| 76 | 3300048088 | Ga0495602_0159679 | Ga0495602_0159679_582_1061 | 159 |
| 77 | 3300048909 | Ga0496106_0183233 | Ga0496106_0183233_241_720 | 159 |
| 78 | 3300049580 | Ga0501046_0269042 | Ga0501046_0269042_31_510 | 159 |
| 79 | 3300050512 | nmdc:mga0n895_75397_c1 | nmdc:mga0n895_75397_c1_609_1088 | 159 |
| 80 | 3300050513 | nmdc:mga0rr50_32063_c1 | nmdc:mga0rr50_32063_c1_627_1106 | 159 |
| 81 | 3300050514 | nmdc:mga08x19_1603_c1 | nmdc:mga08x19_1603_c1_1477_1956 | 159 |
| 82 | 3300050514 | nmdc:mga08x19_37023_c1 | nmdc:mga08x19_37023_c1_1784_2263 | 159 |
| 83 | 3300053116 | Ga0500592_002917 | Ga0500592_002917_1709_2188 | 159 |
| 84 | 3300053158 | Ga0500627_0000329 | Ga0500627_0000329_11880_12359 | 159 |
| 85 | 3300005844 | Ga0068862_100092289 | Ga0068862_1000922892 | 160 |
| 86 | 3300028380 | Ga0268265_10344499 | Ga0268265_103444992 | 160 |
| 87 | 3300045051 | Ga0451576_0706404 | Ga0451576_0706404_534_1016 | 160 |
| 88 | 3300053092 | Ga0500583_0195322 | Ga0500583_0195322_271_753 | 160 |
| 89 | 3300053130 | Ga0500642_0359719 | Ga0500642_0359719_42_524 | 160 |
| 90 | 3300009551 | Ga0105238_10000045 | Ga0105238_1000004522 | 161 |
| 91 | 3300025924 | Ga0207694_10001350 | Ga0207694_1000135012 | 161 |
| 92 | 3300044842 | Ga0466957_0052546 | Ga0466957_0052546_499_984 | 161 |
| 93 | 3300048915 | Ga0496112_1240881 | Ga0496112_1240881_53_538 | 161 |
| 94 | 3300031238 | Ga0265332_10011981 | Ga0265332_100119813 | 163 |
| 95 | 3300046557 | Ga0495622_0059439 | Ga0495622_0059439_807_1298 | 163 |
| 96 | 3300053136 | Ga0500559_0473438 | Ga0500559_0473438_63_554 | 163 |
| 97 | 3300028794 | Ga0307515_10033612 | Ga0307515_100336121 | 164 |
| 98 | 3300048904 | Ga0496101_0539426 | Ga0496101_0539426_23_517 | 164 |
| 99 | 3300049571 | Ga0501034_0152702 | Ga0501034_0152702_466_1029 | 164 |
| 100 | 3300059506 | Ga0587085_093888 | Ga0587085_093888_11_574 | 164 |
| 101 | 3300005289 | Ga0065704_10102072 | Ga0065704_101020722 | 165 |
| 102 | 3300005295 | Ga0065707_10085380 | Ga0065707_100853803 | 165 |
| 103 | 3300006844 | Ga0075428_100014648 | Ga0075428_1000146484 | 165 |
| 104 | 3300006847 | Ga0075431_100100787 | Ga0075431_1001007874 | 165 |
| 105 | 3300006847 | Ga0075431_100804322 | Ga0075431_1008043221 | 165 |
| 106 | 3300009094 | Ga0111539_10703093 | Ga0111539_107030932 | 165 |
| 107 | 3300044712 | Ga0453684_0647825 | Ga0453684_0647825_205_741 | 165 |
| 108 | 3300050510 | nmdc:mga06r32_377195_c1 | nmdc:mga06r32_377195_c1_112_717 | 165 |
| 109 | 3300050510 | nmdc:mga06r32_748034_c1 | nmdc:mga06r32_748034_c1_118_693 | 165 |
| 110 | 3300031251 | Ga0265327_10000952 | Ga0265327_1000095212 | 167 |
| 111 | 3300047472 | Ga0495686_0137875 | Ga0495686_0137875_85_684 | 171 |
| 112 | iso_pu_bacteria | 2847085930 | 2847087831 | 175 |
| 113 | iso_pu_bacteria | 2739367756 | 2739793318 | 176 |
| 114 | iso_pu_bacteria | 2987605356 | 2987607062 | 177 |
| 115 | 3300031728 | Ga0316578_10123241 | Ga0316578_101232412 | 179 |
| 116 | 3300013105 | Ga0157369_10004714 | Ga0157369_100047142 | 180 |
| 117 | 3300039437 | Ga0436365_1797099 | Ga0436365_1797099_84244_84786 | 180 |
| 118 | 3300005577 | Ga0068857_100189435 | Ga0068857_1001894353 | 181 |
| 119 | 3300009093 | Ga0105240_10511552 | Ga0105240_105115522 | 181 |
| 120 | 3300026116 | Ga0207674_10197203 | Ga0207674_101972032 | 181 |
| 121 | 3300026121 | Ga0207683_10657017 | Ga0207683_106570172 | 181 |
| 122 | 3300028800 | Ga0265338_10005677 | Ga0265338_100056777 | 181 |
| 123 | 3300028800 | Ga0265338_10134720 | Ga0265338_101347202 | 181 |
| 124 | 3300031616 | Ga0307508_10135290 | Ga0307508_101352902 | 181 |
| 125 | 3300031727 | Ga0316576_10471369 | Ga0316576_104713692 | 181 |
| 126 | 3300031728 | Ga0316578_10205206 | Ga0316578_102052061 | 181 |
| 127 | 3300031730 | Ga0307516_10000820 | Ga0307516_1000082014 | 181 |
| 128 | 3300031730 | Ga0307516_10142349 | Ga0307516_101423491 | 181 |
| 129 | 3300033180 | Ga0307510_10000001 | Ga0307510_1000000144 | 181 |
| 130 | 3300035113 | Ga0373936_0023372 | Ga0373936_0023372_1707_2252 | 181 |
| 131 | 3300035398 | Ga0316574_0234706 | Ga0316574_0234706_541_1086 | 181 |
| 132 | 3300036712 | Ga0316584_0057679 | Ga0316584_0057679_1808_2353 | 181 |
| 133 | 3300048917 | Ga0496114_0777858 | Ga0496114_0777858_88_669 | 181 |
| 134 | 3300048925 | Ga0496122_0000879 | Ga0496122_0000879_34628_35173 | 181 |
| 135 | 3300048926 | Ga0496123_0000676 | Ga0496123_0000676_34628_35173 | 181 |
| 136 | 3300049823 | Ga0501044_0240198 | Ga0501044_0240198_1057_1602 | 181 |
| 137 | 3300005335 | Ga0070666_10140055 | Ga0070666_101400552 | 182 |
| 138 | 3300005335 | Ga0070666_10364932 | Ga0070666_103649322 | 182 |
| 139 | 3300005347 | Ga0070668_100051630 | Ga0070668_1000516302 | 182 |
| 140 | 3300005366 | Ga0070659_100426546 | Ga0070659_1004265462 | 182 |
| 141 | 3300005367 | Ga0070667_100294187 | Ga0070667_1002941872 | 182 |
| 142 | 3300005456 | Ga0070678_101185034 | Ga0070678_1011850341 | 182 |
| 143 | 3300005530 | Ga0070679_101008191 | Ga0070679_1010081912 | 182 |
| 144 | 3300005539 | Ga0068853_100323253 | Ga0068853_1003232532 | 182 |
| 145 | 3300005618 | Ga0068864_100002289 | Ga0068864_1000022895 | 182 |
| 146 | 3300005842 | Ga0068858_100000884 | Ga0068858_10000088417 | 182 |
| 147 | 3300006048 | Ga0075363_100242074 | Ga0075363_1002420742 | 182 |
| 148 | 3300009093 | Ga0105240_10002294 | Ga0105240_100022947 | 182 |
| 149 | 3300009093 | Ga0105240_10015794 | Ga0105240_100157943 | 182 |
| 150 | 3300009174 | Ga0105241_10573249 | Ga0105241_105732491 | 182 |
| 151 | 3300009174 | Ga0105241_10620290 | Ga0105241_106202901 | 182 |
| 152 | 3300009177 | Ga0105248_10171244 | Ga0105248_101712444 | 182 |
| 153 | 3300009551 | Ga0105238_10101524 | Ga0105238_101015242 | 182 |
| 154 | 3300009551 | Ga0105238_10128822 | Ga0105238_101288223 | 182 |
| 155 | 3300010375 | Ga0105239_10910658 | Ga0105239_109106582 | 182 |
| 156 | 3300013296 | Ga0157374_10265574 | Ga0157374_102655743 | 182 |
| 157 | 3300013306 | Ga0163162_10045923 | Ga0163162_100459236 | 182 |
| 158 | 3300017792 | Ga0163161_10166644 | Ga0163161_101666443 | 182 |
| 159 | 3300025903 | Ga0207680_10089654 | Ga0207680_100896542 | 182 |
| 160 | 3300025913 | Ga0207695_10024262 | Ga0207695_100242624 | 182 |
| 161 | 3300025913 | Ga0207695_10385116 | Ga0207695_103851162 | 182 |
| 162 | 3300025920 | Ga0207649_10543355 | Ga0207649_105433552 | 182 |
| 163 | 3300025924 | Ga0207694_10105273 | Ga0207694_101052733 | 182 |
| 164 | 3300025924 | Ga0207694_10118885 | Ga0207694_101188852 | 182 |
| 165 | 3300025933 | Ga0207706_10394424 | Ga0207706_103944242 | 182 |
| 166 | 3300025941 | Ga0207711_10030705 | Ga0207711_100307056 | 182 |
| 167 | 3300025949 | Ga0207667_10044332 | Ga0207667_100443323 | 182 |
| 168 | 3300025972 | Ga0207668_10052683 | Ga0207668_100526832 | 182 |
| 169 | 3300025986 | Ga0207658_10308407 | Ga0207658_103084071 | 182 |
| 170 | 3300026035 | Ga0207703_10000593 | Ga0207703_1000059329 | 182 |
| 171 | 3300026041 | Ga0207639_10058399 | Ga0207639_100583992 | 182 |
| 172 | 3300026095 | Ga0207676_10001758 | Ga0207676_100017586 | 182 |
| 173 | 3300026118 | Ga0207675_100837255 | Ga0207675_1008372551 | 182 |
| 174 | 3300026121 | Ga0207683_11018422 | Ga0207683_110184221 | 182 |
| 175 | 3300028380 | Ga0268265_10365075 | Ga0268265_103650751 | 182 |
| 176 | 3300031456 | Ga0307513_10015734 | Ga0307513_100157346 | 182 |
| 177 | 3300031995 | Ga0307409_101094707 | Ga0307409_1010947071 | 182 |
| 178 | 3300032005 | Ga0307411_11375358 | Ga0307411_113753581 | 182 |
| 179 | 3300033180 | Ga0307510_10006416 | Ga0307510_1000641615 | 182 |
| 180 | 3300038705 | Ga0237819_00546 | Ga0237819_00546_9568_10116 | 182 |
| 181 | 3300046616 | Ga0495668_0016018 | Ga0495668_0016018_329_892 | 182 |
| 182 | 3300046660 | Ga0495625_0097051 | Ga0495625_0097051_770_1333 | 182 |
| 183 | 3300046684 | Ga0495669_0036518 | Ga0495669_0036518_699_1250 | 182 |
| 184 | 3300047317 | Ga0495604_0688441 | Ga0495604_0688441_86_637 | 182 |
| 185 | 3300047445 | Ga0495677_0005540 | Ga0495677_0005540_89_682 | 182 |
| 186 | 3300047472 | Ga0495686_0003725 | Ga0495686_0003725_1177_1725 | 182 |
| 187 | 3300047472 | Ga0495686_0015352 | Ga0495686_0015352_2683_3231 | 182 |
| 188 | 3300048915 | Ga0496112_0115455 | Ga0496112_0115455_1429_1977 | 182 |
| 189 | 3300049581 | Ga0501047_0003777 | Ga0501047_0003777_3643_4191 | 182 |
| 190 | 3300049686 | Ga0501257_004737 | Ga0501257_004737_1113_1661 | 182 |
| 191 | 3300053087 | Ga0500643_002858 | Ga0500643_002858_1080_1655 | 182 |
| 192 | 3300053087 | Ga0500643_005342 | Ga0500643_005342_1447_1995 | 182 |
| 193 | 3300053087 | Ga0500643_008934 | Ga0500643_008934_1833_2381 | 182 |
| 194 | 3300053093 | Ga0500651_0159232 | Ga0500651_0159232_204_761 | 182 |
| 195 | 3300053136 | Ga0500559_0009362 | Ga0500559_0009362_223_771 | 182 |
| 196 | 3300005289 | Ga0065704_10325031 | Ga0065704_103250312 | 183 |
| 197 | 3300005331 | Ga0070670_100055168 | Ga0070670_1000551682 | 183 |
| 198 | 3300005347 | Ga0070668_100010990 | Ga0070668_1000109905 | 183 |
| 199 | 3300005355 | Ga0070671_100133994 | Ga0070671_1001339942 | 183 |
| 200 | 3300005367 | Ga0070667_100004567 | Ga0070667_1000045673 | 183 |
| 201 | 3300005367 | Ga0070667_100140450 | Ga0070667_1001404501 | 183 |
| 202 | 3300005617 | Ga0068859_100129578 | Ga0068859_1001295782 | 183 |
| 203 | 3300005617 | Ga0068859_100147706 | Ga0068859_1001477062 | 183 |
| 204 | 3300005618 | Ga0068864_100021332 | Ga0068864_1000213321 | 183 |
| 205 | 3300005719 | Ga0068861_100267663 | Ga0068861_1002676632 | 183 |
| 206 | 3300005841 | Ga0068863_100026005 | Ga0068863_1000260051 | 183 |
| 207 | 3300005843 | Ga0068860_100000104 | Ga0068860_100000104113 | 183 |
| 208 | 3300005843 | Ga0068860_100008984 | Ga0068860_1000089842 | 183 |
| 209 | 3300005844 | Ga0068862_100007221 | Ga0068862_1000072215 | 183 |
| 210 | 3300005844 | Ga0068862_100031122 | Ga0068862_1000311223 | 183 |
| 211 | 3300006931 | Ga0097620_100129575 | Ga0097620_1001295752 | 183 |
| 212 | 3300006931 | Ga0097620_100147711 | Ga0097620_1001477112 | 183 |
| 213 | 3300009177 | Ga0105248_10202280 | Ga0105248_102022802 | 183 |
| 214 | 3300009551 | Ga0105238_11450410 | Ga0105238_114504101 | 183 |
| 215 | 3300009553 | Ga0105249_10007607 | Ga0105249_100076076 | 183 |
| 216 | 3300009553 | Ga0105249_10315483 | Ga0105249_103154832 | 183 |
| 217 | 3300014326 | Ga0157380_10154540 | Ga0157380_101545402 | 183 |
| 218 | 3300021361 | Ga0213872_10105236 | Ga0213872_101052361 | 183 |
| 219 | 3300021441 | Ga0213871_10042092 | Ga0213871_100420922 | 183 |
| 220 | 3300025297 | Ga0209758_1026400 | Ga0209758_10264003 | 183 |
| 221 | 3300025304 | Ga0209257_1024848 | Ga0209257_10248482 | 183 |
| 222 | 3300025923 | Ga0207681_10026005 | Ga0207681_100260052 | 183 |
| 223 | 3300025925 | Ga0207650_10012613 | Ga0207650_100126133 | 183 |
| 224 | 3300025931 | Ga0207644_10618185 | Ga0207644_106181851 | 183 |
| 225 | 3300025941 | Ga0207711_10401952 | Ga0207711_104019522 | 183 |
| 226 | 3300025961 | Ga0207712_10000002 | Ga0207712_10000002196 | 183 |
| 227 | 3300025961 | Ga0207712_10444070 | Ga0207712_104440702 | 183 |
| 228 | 3300025972 | Ga0207668_10016352 | Ga0207668_100163523 | 183 |
| 229 | 3300025986 | Ga0207658_10018834 | Ga0207658_100188342 | 183 |
| 230 | 3300025986 | Ga0207658_10403217 | Ga0207658_104032171 | 183 |
| 231 | 3300026088 | Ga0207641_10019187 | Ga0207641_100191875 | 183 |
| 232 | 3300026118 | Ga0207675_100014364 | Ga0207675_1000143643 | 183 |
| 233 | 3300028380 | Ga0268265_10000104 | Ga0268265_10000104110 | 183 |
| 234 | 3300028380 | Ga0268265_10005318 | Ga0268265_100053183 | 183 |
| 235 | 3300028380 | Ga0268265_10011849 | Ga0268265_100118494 | 183 |
| 236 | 3300028380 | Ga0268265_10050795 | Ga0268265_100507952 | 183 |
| 237 | 3300028381 | Ga0268264_10000008 | Ga0268264_10000008373 | 183 |
| 238 | 3300028381 | Ga0268264_10045406 | Ga0268264_100454062 | 183 |
| 239 | 3300037853 | Ga0436364_0013276 | Ga0436364_0013276_1539_2096 | 183 |
| 240 | 3300039438 | Ga0436360_1168634 | Ga0436360_1168634_621_1178 | 183 |
| 241 | 3300039447 | Ga0436361_0493436 | Ga0436361_0493436_250_807 | 183 |
| 242 | 3300046460 | Ga0495638_0310737 | Ga0495638_0310737_105_659 | 183 |
| 243 | 3300047320 | Ga0495672_0049418 | Ga0495672_0049418_1845_2399 | 183 |
| 244 | 3300053088 | Ga0500644_0195020 | Ga0500644_0195020_141_692 | 183 |
| 245 | 3300053088 | Ga0500644_0302329 | Ga0500644_0302329_48_599 | 183 |
| 246 | 3300053099 | Ga0500654_151078 | Ga0500654_151078_180_731 | 183 |
| 247 | 3300053134 | Ga0500658_0274251 | Ga0500658_0274251_178_729 | 183 |
| 248 | 3300053139 | Ga0500568_0009693 | Ga0500568_0009693_3858_4409 | 183 |
| 249 | 3300053139 | Ga0500568_0049335 | Ga0500568_0049335_293_844 | 183 |
| 250 | 3300053151 | Ga0500604_0001648 | Ga0500604_0001648_3158_3709 | 183 |
| 251 | 3300053153 | Ga0500616_0001170 | Ga0500616_0001170_2771_3322 | 183 |
| 252 | 3300003215 | JGI25153J46596_10000022 | JGI25153J46596_10000022188 | 184 |
| 253 | 3300025297 | Ga0209758_1000005 | Ga0209758_1000005375 | 184 |
| 254 | 3300041512 | Ga0451853_2791993 | Ga0451853_2791993_86_640 | 184 |
| 255 | 3300046513 | Ga0495616_0319413 | Ga0495616_0319413_35_589 | 184 |
| 256 | 3300047320 | Ga0495672_0190972 | Ga0495672_0190972_231_836 | 184 |
| 257 | 3300053086 | Ga0500578_0030847 | Ga0500578_0030847_401_955 | 184 |
| 258 | 3300053090 | Ga0500646_0093214 | Ga0500646_0093214_156_710 | 184 |
| 259 | 3300053093 | Ga0500651_0157838 | Ga0500651_0157838_47_601 | 184 |
| 260 | 3300053094 | Ga0500566_0024737 | Ga0500566_0024737_1954_2508 | 184 |
| 261 | 3300053096 | Ga0500641_0020427 | Ga0500641_0020427_411_965 | 184 |
| 262 | 3300053118 | Ga0500594_0096107 | Ga0500594_0096107_247_801 | 184 |
| 263 | 3300053119 | Ga0500595_000113 | Ga0500595_000113_31387_31941 | 184 |
| 264 | 3300053130 | Ga0500642_0000307 | Ga0500642_0000307_15772_16326 | 184 |
| 265 | 3300053131 | Ga0500652_215996 | Ga0500652_215996_47_601 | 184 |
| 266 | 3300053133 | Ga0500655_042941 | Ga0500655_042941_159_713 | 184 |
| 267 | 3300053134 | Ga0500658_0042703 | Ga0500658_0042703_676_1230 | 184 |
| 268 | 3300053142 | Ga0500577_0015605 | Ga0500577_0015605_195_749 | 184 |
| 269 | 3300053142 | Ga0500577_0178460 | Ga0500577_0178460_168_722 | 184 |
| 270 | 3300053146 | Ga0500588_0129788 | Ga0500588_0129788_97_651 | 184 |
| 271 | 3300053731 | Ga0500609_000193 | Ga0500609_000193_7486_8040 | 184 |
| 272 | 3300005548 | Ga0070665_100064289 | Ga0070665_1000642893 | 185 |
| 273 | 3300014325 | Ga0163163_10230076 | Ga0163163_102300762 | 185 |
| 274 | 3300014968 | Ga0157379_10166992 | Ga0157379_101669922 | 185 |
| 275 | 3300028379 | Ga0268266_10066557 | Ga0268266_100665573 | 185 |
| 276 | 3300048923 | Ga0496120_0342170 | Ga0496120_0342170_94_651 | 185 |
| 277 | 3300048928 | Ga0496125_0173209 | Ga0496125_0173209_76_633 | 185 |
| 278 | 3300048929 | Ga0496126_0003032 | Ga0496126_0003032_19465_20022 | 185 |
| 279 | 3300001976 | JGI24752J21851_1000436 | JGI24752J21851_10004364 | 186 |
| 280 | 3300005289 | Ga0065704_10123648 | Ga0065704_101236481 | 186 |
| 281 | 3300005331 | Ga0070670_100000068 | Ga0070670_10000006826 | 186 |
| 282 | 3300005355 | Ga0070671_100699680 | Ga0070671_1006996801 | 186 |
| 283 | 3300005367 | Ga0070667_100001002 | Ga0070667_10000100228 | 186 |
| 284 | 3300005617 | Ga0068859_100039829 | Ga0068859_1000398294 | 186 |
| 285 | 3300005618 | Ga0068864_100000019 | Ga0068864_10000001928 | 186 |
| 286 | 3300005841 | Ga0068863_100000015 | Ga0068863_10000001528 | 186 |
| 287 | 3300005844 | Ga0068862_100000094 | Ga0068862_10000009426 | 186 |
| 288 | 3300006931 | Ga0097620_100039829 | Ga0097620_1000398294 | 186 |
| 289 | 3300009011 | Ga0105251_10000853 | Ga0105251_1000085321 | 186 |
| 290 | 3300009101 | Ga0105247_10003627 | Ga0105247_100036275 | 186 |
| 291 | 3300009177 | Ga0105248_10000311 | Ga0105248_1000031147 | 186 |
| 292 | 3300009553 | Ga0105249_10000568 | Ga0105249_1000056822 | 186 |
| 293 | 3300013306 | Ga0163162_10058375 | Ga0163162_100583752 | 186 |
| 294 | 3300025735 | Ga0207713_1015664 | Ga0207713_10156643 | 186 |
| 295 | 3300025900 | Ga0207710_10003244 | Ga0207710_100032442 | 186 |
| 296 | 3300025925 | Ga0207650_10000054 | Ga0207650_1000005449 | 186 |
| 297 | 3300025941 | Ga0207711_10000017 | Ga0207711_10000017115 | 186 |
| 298 | 3300025961 | Ga0207712_10000163 | Ga0207712_1000016344 | 186 |
| 299 | 3300025986 | Ga0207658_10000223 | Ga0207658_1000022347 | 186 |
| 300 | 3300026088 | Ga0207641_10000008 | Ga0207641_10000008142 | 186 |
| 301 | 3300026095 | Ga0207676_10000019 | Ga0207676_1000001926 | 186 |
| 302 | 3300028380 | Ga0268265_10000011 | Ga0268265_10000011142 | 186 |
| 303 | 3300028786 | Ga0307517_10407881 | Ga0307517_104078811 | 186 |
| 304 | 3300039453 | Ga0436362_0770601 | Ga0436362_0770601_834_1400 | 186 |
| 305 | 3300048906 | Ga0496103_0086609 | Ga0496103_0086609_606_1166 | 186 |
| 306 | 3300048920 | Ga0496117_0003796 | Ga0496117_0003796_10657_11217 | 186 |
| 307 | 3300048921 | Ga0496118_0000870 | Ga0496118_0000870_25070_25630 | 186 |
| 308 | 3300005289 | Ga0065704_10160255 | Ga0065704_101602552 | 187 |
| 309 | 3300005295 | Ga0065707_10082105 | Ga0065707_100821052 | 187 |
| 310 | 3300013308 | Ga0157375_11729340 | Ga0157375_117293401 | 187 |
| 311 | 3300014326 | Ga0157380_10003723 | Ga0157380_100037235 | 187 |
| 312 | 3300046525 | Ga0495663_0008887 | Ga0495663_0008887_1628_2191 | 187 |
| 313 | 3300046530 | Ga0495654_0006012 | Ga0495654_0006012_942_1505 | 187 |
| 314 | 3300046616 | Ga0495668_0010907 | Ga0495668_0010907_881_1444 | 187 |
| 315 | 3300046794 | Ga0495589_0123485 | Ga0495589_0123485_190_753 | 187 |
| 316 | 3300049459 | Ga0495678_101596 | Ga0495678_101596_237_800 | 187 |
| 317 | 3300053116 | Ga0500592_000243 | Ga0500592_000243_4654_5217 | 187 |
| 318 | 3300053142 | Ga0500577_0214656 | Ga0500577_0214656_128_691 | 187 |
| 319 | 3300053146 | Ga0500588_0004071 | Ga0500588_0004071_248_811 | 187 |
| 320 | 3300053156 | Ga0500622_0164163 | Ga0500622_0164163_398_979 | 187 |
| 321 | 3300053158 | Ga0500627_0000347 | Ga0500627_0000347_11323_11886 | 187 |
| 322 | 3300053158 | Ga0500627_0072521 | Ga0500627_0072521_882_1445 | 187 |
| 323 | 3300053727 | Ga0500611_048924 | Ga0500611_048924_181_744 | 187 |
| 324 | 3300001904 | JGI24736J21556_1000024 | JGI24736J21556_100002415 | 188 |
| 325 | 3300001915 | JGI24741J21665_1006453 | JGI24741J21665_10064532 | 188 |
| 326 | 3300001976 | JGI24752J21851_1000048 | JGI24752J21851_10000485 | 188 |
| 327 | 3300001979 | JGI24740J21852_10004963 | JGI24740J21852_100049636 | 188 |
| 328 | 3300001979 | JGI24740J21852_10092384 | JGI24740J21852_100923841 | 188 |
| 329 | 3300001989 | JGI24739J22299_10024328 | JGI24739J22299_100243283 | 188 |
| 330 | 3300001990 | JGI24737J22298_10005153 | JGI24737J22298_100051536 | 188 |
| 331 | 3300002067 | JGI24735J21928_10003032 | JGI24735J21928_100030324 | 188 |
| 332 | 3300002070 | JGI24750J21931_1000042 | JGI24750J21931_10000427 | 188 |
| 333 | 3300002074 | JGI24748J21848_1000063 | JGI24748J21848_100006340 | 188 |
| 334 | 3300002075 | JGI24738J21930_10001487 | JGI24738J21930_100014876 | 188 |
| 335 | 3300002076 | JGI24749J21850_1000472 | JGI24749J21850_10004724 | 188 |
| 336 | 3300002239 | JGI24034J26672_10000007 | JGI24034J26672_1000000713 | 188 |
| 337 | 3300002244 | JGI24742J22300_10002810 | JGI24742J22300_100028103 | 188 |
| 338 | 3300005327 | Ga0070658_10109171 | Ga0070658_101091713 | 188 |
| 339 | 3300005330 | Ga0070690_100000110 | Ga0070690_10000011020 | 188 |
| 340 | 3300005331 | Ga0070670_100054238 | Ga0070670_1000542385 | 188 |
| 341 | 3300005335 | Ga0070666_10000417 | Ga0070666_100004176 | 188 |
| 342 | 3300005337 | Ga0070682_100246689 | Ga0070682_1002466891 | 188 |
| 343 | 3300005339 | Ga0070660_100201009 | Ga0070660_1002010091 | 188 |
| 344 | 3300005340 | Ga0070689_100040808 | Ga0070689_1000408083 | 188 |
| 345 | 3300005344 | Ga0070661_100332032 | Ga0070661_1003320321 | 188 |
| 346 | 3300005353 | Ga0070669_100000332 | Ga0070669_10000033223 | 188 |
| 347 | 3300005355 | Ga0070671_100020174 | Ga0070671_1000201742 | 188 |
| 348 | 3300005365 | Ga0070688_100002132 | Ga0070688_1000021323 | 188 |
| 349 | 3300005366 | Ga0070659_100179815 | Ga0070659_1001798152 | 188 |
| 350 | 3300005457 | Ga0070662_100022201 | Ga0070662_1000222014 | 188 |
| 351 | 3300005457 | Ga0070662_100090184 | Ga0070662_1000901842 | 188 |
| 352 | 3300005466 | Ga0070685_10000036 | Ga0070685_1000003679 | 188 |
| 353 | 3300005535 | Ga0070684_100179811 | Ga0070684_1001798113 | 188 |
| 354 | 3300005539 | Ga0068853_100412531 | Ga0068853_1004125312 | 188 |
| 355 | 3300005544 | Ga0070686_100000045 | Ga0070686_10000004582 | 188 |
| 356 | 3300005548 | Ga0070665_100000042 | Ga0070665_100000042207 | 188 |
| 357 | 3300005564 | Ga0070664_100205330 | Ga0070664_1002053302 | 188 |
| 358 | 3300005577 | Ga0068857_100089178 | Ga0068857_1000891782 | 188 |
| 359 | 3300005577 | Ga0068857_100287823 | Ga0068857_1002878231 | 188 |
| 360 | 3300005578 | Ga0068854_100237589 | Ga0068854_1002375892 | 188 |
| 361 | 3300005617 | Ga0068859_100010776 | Ga0068859_1000107763 | 188 |
| 362 | 3300005834 | Ga0068851_10101458 | Ga0068851_101014582 | 188 |
| 363 | 3300005841 | Ga0068863_100000280 | Ga0068863_10000028012 | 188 |
| 364 | 3300005842 | Ga0068858_100007900 | Ga0068858_1000079004 | 188 |
| 365 | 3300005843 | Ga0068860_100000182 | Ga0068860_10000018283 | 188 |
| 366 | 3300005844 | Ga0068862_100000308 | Ga0068862_10000030821 | 188 |
| 367 | 3300006931 | Ga0097620_100010776 | Ga0097620_1000107763 | 188 |
| 368 | 3300009011 | Ga0105251_10112231 | Ga0105251_101122312 | 188 |
| 369 | 3300009101 | Ga0105247_10131270 | Ga0105247_101312702 | 188 |
| 370 | 3300009551 | Ga0105238_10152585 | Ga0105238_101525852 | 188 |
| 371 | 3300009551 | Ga0105238_10515016 | Ga0105238_105150162 | 188 |
| 372 | 3300009553 | Ga0105249_10000012 | Ga0105249_1000001281 | 188 |
| 373 | 3300013104 | Ga0157370_10024209 | Ga0157370_100242094 | 188 |
| 374 | 3300013105 | Ga0157369_10031631 | Ga0157369_100316314 | 188 |
| 375 | 3300013306 | Ga0163162_10298086 | Ga0163162_102980862 | 188 |
| 376 | 3300013307 | Ga0157372_10321824 | Ga0157372_103218242 | 188 |
| 377 | 3300014325 | Ga0163163_10067350 | Ga0163163_100673505 | 188 |
| 378 | 3300014326 | Ga0157380_10000151 | Ga0157380_1000015131 | 188 |
| 379 | 3300014968 | Ga0157379_10607493 | Ga0157379_106074932 | 188 |
| 380 | 3300017792 | Ga0163161_10000202 | Ga0163161_1000020214 | 188 |
| 381 | 3300025321 | Ga0207656_10025940 | Ga0207656_100259402 | 188 |
| 382 | 3300025900 | Ga0207710_10081772 | Ga0207710_100817722 | 188 |
| 383 | 3300025903 | Ga0207680_10000012 | Ga0207680_10000012205 | 188 |
| 384 | 3300025904 | Ga0207647_10015957 | Ga0207647_100159573 | 188 |
| 385 | 3300025909 | Ga0207705_10071923 | Ga0207705_100719232 | 188 |
| 386 | 3300025911 | Ga0207654_10001661 | Ga0207654_1000166110 | 188 |
| 387 | 3300025911 | Ga0207654_10438945 | Ga0207654_104389451 | 188 |
| 388 | 3300025913 | Ga0207695_10000641 | Ga0207695_1000064113 | 188 |
| 389 | 3300025914 | Ga0207671_10002738 | Ga0207671_100027388 | 188 |
| 390 | 3300025923 | Ga0207681_10000076 | Ga0207681_1000007675 | 188 |
| 391 | 3300025924 | Ga0207694_10001461 | Ga0207694_1000146114 | 188 |
| 392 | 3300025924 | Ga0207694_10240619 | Ga0207694_102406192 | 188 |
| 393 | 3300025925 | Ga0207650_10071137 | Ga0207650_100711372 | 188 |
| 394 | 3300025932 | Ga0207690_10040990 | Ga0207690_100409901 | 188 |
| 395 | 3300025933 | Ga0207706_10018187 | Ga0207706_100181876 | 188 |
| 396 | 3300025933 | Ga0207706_10115904 | Ga0207706_101159042 | 188 |
| 397 | 3300025936 | Ga0207670_10028238 | Ga0207670_100282383 | 188 |
| 398 | 3300025944 | Ga0207661_10955406 | Ga0207661_109554061 | 188 |
| 399 | 3300025949 | Ga0207667_10004663 | Ga0207667_100046636 | 188 |
| 400 | 3300025961 | Ga0207712_10000021 | Ga0207712_10000021205 | 188 |
| 401 | 3300025981 | Ga0207640_10292715 | Ga0207640_102927152 | 188 |
| 402 | 3300025986 | Ga0207658_10001629 | Ga0207658_1000162919 | 188 |
| 403 | 3300026035 | Ga0207703_10098271 | Ga0207703_100982712 | 188 |
| 404 | 3300026041 | Ga0207639_10383793 | Ga0207639_103837931 | 188 |
| 405 | 3300026041 | Ga0207639_10437558 | Ga0207639_104375582 | 188 |
| 406 | 3300026067 | Ga0207678_10003417 | Ga0207678_100034172 | 188 |
| 407 | 3300026078 | Ga0207702_10008254 | Ga0207702_100082544 | 188 |
| 408 | 3300026088 | Ga0207641_10000414 | Ga0207641_100004149 | 188 |
| 409 | 3300026095 | Ga0207676_10009609 | Ga0207676_100096096 | 188 |
| 410 | 3300026116 | Ga0207674_10019146 | Ga0207674_1001914612 | 188 |
| 411 | 3300026116 | Ga0207674_10041562 | Ga0207674_100415623 | 188 |
| 412 | 3300026118 | Ga0207675_100000227 | Ga0207675_10000022736 | 188 |
| 413 | 3300028379 | Ga0268266_10000054 | Ga0268266_10000054204 | 188 |
| 414 | 3300028380 | Ga0268265_10004916 | Ga0268265_100049163 | 188 |
| 415 | 3300028381 | Ga0268264_10000074 | Ga0268264_10000074205 | 188 |
| 416 | 3300031731 | Ga0307405_10151422 | Ga0307405_101514222 | 188 |
| 417 | 3300031731 | Ga0307405_10542519 | Ga0307405_105425192 | 188 |
| 418 | 3300031901 | Ga0307406_10315386 | Ga0307406_103153861 | 188 |
| 419 | 3300031911 | Ga0307412_10171295 | Ga0307412_101712952 | 188 |
| 420 | 3300031995 | Ga0307409_100062284 | Ga0307409_1000622842 | 188 |
| 421 | 3300048903 | Ga0496100_0029233 | Ga0496100_0029233_696_1262 | 188 |
| 422 | 3300048904 | Ga0496101_0187333 | Ga0496101_0187333_731_1297 | 188 |
| 423 | 3300048905 | Ga0496102_0067110 | Ga0496102_0067110_2648_3214 | 188 |
| 424 | 3300048906 | Ga0496103_0001901 | Ga0496103_0001901_604_1170 | 188 |
| 425 | 3300048907 | Ga0496104_0073721 | Ga0496104_0073721_2472_3038 | 188 |
| 426 | 3300048908 | Ga0496105_0069283 | Ga0496105_0069283_2209_2775 | 188 |
| 427 | 3300048914 | Ga0496111_0345760 | Ga0496111_0345760_355_921 | 188 |
| 428 | 3300048920 | Ga0496117_0006080 | Ga0496117_0006080_775_1341 | 188 |
| 429 | 3300048921 | Ga0496118_0027199 | Ga0496118_0027199_4231_4797 | 188 |
| 430 | 3300053087 | Ga0500643_000474 | Ga0500643_000474_2061_2684 | 188 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2wgr-assembly1.cif.gz_A | combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase | 0.9482 | 3 | 183 |
| 2v1m-assembly1.cif.gz_A | crystal structure of schistosoma mansoni glutathione peroxidase | 0.9427 | 3 | 183 |
| 2wgr-assembly1.cif.gz_A | combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase | 0.9312 | 3 | 183 |
| 2v1m-assembly1.cif.gz_A | crystal structure of schistosoma mansoni glutathione peroxidase | 0.9259 | 3 | 183 |
| 7l8l-assembly1.cif.gz_A | crystal structure of human r152h gpx4-u46c | 0.9214 | 4 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O59858_1_158_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9563 | 3 | 179 | 3.40.30.10 |
| af_Q2FUZ6_1_164_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9523 | 2 | 183 | 3.40.30.10 |
| af_P06610_1_183_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9415 | 1 | 182 | 3.40.30.10 |
| af_O59858_1_158_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9387 | 3 | 179 | 3.40.30.10 |
| af_P06610_1_183_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9315 | 1 | 182 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G3KCC8-F1-model_v4 | Glutathione peroxidase | 0.9945 | 6 | 182 |
GO:0004601
GO:0034599 |
| AF-A0A2K0YDP6-F1-model_v4 | Glutathione peroxidase | 0.9936 | 5 | 182 |
GO:0004601
GO:0034599 |
| AF-T0H1Y1-F1-model_v4 | Glutathione peroxidase | 0.9934 | 5 | 182 |
GO:0004601
GO:0034599 |
| AF-A0A0Q4CC12-F1-model_v4 | Glutathione peroxidase | 0.99 | 3 | 182 |
GO:0004601
GO:0034599 |
| AF-A0A0U5I9G7-F1-model_v4 | deleted | 0.9866 | 3 | 182 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar