F442170

General Info

Members Datasets Scaffolds Average Seq Length
430 247 427 180

Family's Representative Sequence

Representative Sequence 3300028380|Ga0268265_10011849|Ga0268265_100118494
Length 216
Sequence VTGCPAYRARDIAAGLVQNAGPINAPNHPRETRMSRSLYDIPVSRIDGEKTSLAAYRGKVLLVVNVASECGLTPQYEGLQDLYAEKRAQGLEILGFPANNFGAQEPGTEAEIAAFCTGKFGVEFPMFEKISVLGADRHPLYDALVAAQPKAEGTDAMRKSLIEYGEKPAAETDVLWNFEKFVIGRDGTVLARFSPDITPDDPRLGKVLDRALAAKV

Samples

Sample ID Description Type Environment
1 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
2 2847085930 Erwinia persicina B64 Isolate Bulb
3 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
13 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
14 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
15 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
16 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
17 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
20 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
31 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
81 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
149 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
168 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
169 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
170 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
171 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
172 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
175 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
176 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
180 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
181 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
187 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
188 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
189 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
190 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
191 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
192 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
193 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
202 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
203 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
204 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
205 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
206 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
207 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
208 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
209 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
212 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
218 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
219 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
220 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
221 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
222 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
223 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
224 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
225 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
226 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
227 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
228 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
229 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
230 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
231 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
232 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
233 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
234 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
235 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
236 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
237 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
238 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
239 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
240 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
241 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
242 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
243 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
244 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
245 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
246 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
247 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.07
Metatranscriptomes 0.23
Isolates 0.7

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0.23
Endosphere 11.16
Nodule 0
Rhizoplane 3.02
Rhizosphere 80.23
Stem 0
Stem Tuber 0
Unclassified 5.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1000024 3300001904 Bacteria 25524
2 JGI24741J21665_1006453 3300001915 Bacteria 2354
3 JGI24752J21851_1000048 3300001976 Bacteria 14796
4 JGI24752J21851_1000436 3300001976 Bacteria 5654
5 JGI24740J21852_10004963 3300001979 Bacteria 5657
6 JGI24740J21852_10092384 3300001979 Bacteria 779
7 JGI24739J22299_10024328 3300001989 Bacteria 2136
8 JGI24737J22298_10005153 3300001990 Bacteria 4525
9 JGI24735J21928_10003032 3300002067 Bacteria 5764
10 JGI24750J21931_1000042 3300002070 Bacteria 16868
11 JGI24748J21848_1000063 3300002074 Bacteria 40664
12 JGI24738J21930_10001487 3300002075 Bacteria 6511
13 JGI24749J21850_1000472 3300002076 Bacteria 5977
14 JGI24034J26672_10000007 3300002239 Bacteria 224370
15 JGI24742J22300_10002810 3300002244 Bacteria 2809
16 JGI25153J46596_10000022 3300003215 Bacteria 251919
17 Ga0065704_10102072 3300005289 Bacteria 2216
18 Ga0065704_10123648 3300005289 Bacteria 1730
19 Ga0065704_10160255 3300005289 Bacteria 1360
20 Ga0065704_10325031 3300005289 Bacteria 847
21 Ga0065707_10082105 3300005295 Bacteria 21836
22 Ga0065707_10085380 3300005295 Bacteria 6198
23 Ga0070658_10109171 3300005327 Bacteria 2291
24 Ga0070690_100000110 3300005330 Bacteria 42574
25 Ga0070670_100000068 3300005331 Bacteria 106494
26 Ga0070670_100054238 3300005331 Bacteria 3441
27 Ga0070670_100055168 3300005331 Bacteria 3411
28 Ga0070666_10000417 3300005335 Bacteria 26409
29 Ga0070666_10140055 3300005335 Bacteria 1685
30 Ga0070666_10364932 3300005335 Bacteria 1035
31 Ga0070680_100397693 3300005336 Bacteria 1174
32 Ga0070682_100246689 3300005337 Bacteria 1285
33 Ga0070660_100201009 3300005339 Bacteria 1616
34 Ga0070689_100040808 3300005340 Bacteria 3559
35 Ga0070691_10000365 3300005341 Bacteria 16356
36 Ga0070661_100332032 3300005344 Bacteria 1189
37 Ga0070668_100010990 3300005347 Bacteria 6739
38 Ga0070668_100012847 3300005347 Bacteria 6234
39 Ga0070668_100051630 3300005347 Bacteria 3169
40 Ga0070669_100000332 3300005353 Bacteria 36750
41 Ga0070671_100020174 3300005355 Bacteria 5432
42 Ga0070671_100133994 3300005355 Bacteria 2088
43 Ga0070671_100699680 3300005355 Bacteria 879
44 Ga0070688_100002132 3300005365 Bacteria 9972
45 Ga0070659_100179815 3300005366 Bacteria 1735
46 Ga0070659_100426546 3300005366 Bacteria 1122
47 Ga0070667_100001002 3300005367 Bacteria 25860
48 Ga0070667_100004567 3300005367 Bacteria 11631
49 Ga0070667_100140450 3300005367 Bacteria 2115
50 Ga0070667_100294187 3300005367 Bacteria 1461
51 Ga0070709_10029060 3300005434 Bacteria 3303
52 Ga0070714_100008568 3300005435 Bacteria 7997
53 Ga0070714_100245500 3300005435 Bacteria 1654
54 Ga0070713_100000001 3300005436 Bacteria 257984
55 Ga0070694_100661432 3300005444 Bacteria 846
56 Ga0070678_101185034 3300005456 Bacteria 708
57 Ga0070662_100022201 3300005457 Bacteria 4341
58 Ga0070662_100090184 3300005457 Bacteria 2300
59 Ga0070681_10820922 3300005458 Bacteria 847
60 Ga0070685_10000036 3300005466 Bacteria 80641
61 Ga0070679_101008191 3300005530 Bacteria 777
62 Ga0070684_100179811 3300005535 Bacteria 1923
63 Ga0070684_101118784 3300005535 Bacteria 740
64 Ga0068853_100007961 3300005539 Bacteria 8499
65 Ga0068853_100159077 3300005539 Bacteria 2037
66 Ga0068853_100323253 3300005539 Bacteria 1431
67 Ga0068853_100412531 3300005539 Bacteria 1265
68 Ga0070686_100000045 3300005544 Bacteria 101988
69 Ga0070695_100027185 3300005545 Bacteria 3543
70 Ga0070665_100000042 3300005548 Bacteria 292582
71 Ga0070665_100064289 3300005548 Bacteria 3679
72 Ga0068855_100093068 3300005563 Bacteria 3476
73 Ga0070664_100136766 3300005564 Bacteria 2155
74 Ga0070664_100205330 3300005564 Bacteria 1759
75 Ga0068857_100000759 3300005577 Bacteria 23985
76 Ga0068857_100089178 3300005577 Bacteria 2759
77 Ga0068857_100189435 3300005577 Bacteria 1873
78 Ga0068857_100287823 3300005577 Bacteria 1512
79 Ga0068854_100237589 3300005578 Bacteria 1449
80 Ga0068856_100001359 3300005614 Bacteria 25713
81 Ga0068856_100030985 3300005614 Bacteria 5232
82 Ga0068852_100082637 3300005616 Bacteria 2855
83 Ga0068859_100010776 3300005617 Bacteria 9202
84 Ga0068859_100039829 3300005617 Bacteria 4716
85 Ga0068859_100129578 3300005617 Bacteria 2594
86 Ga0068859_100147706 3300005617 Bacteria 2426
87 Ga0068864_100000019 3300005618 Bacteria 271650
88 Ga0068864_100002289 3300005618 Bacteria 15834
89 Ga0068864_100021332 3300005618 Bacteria 5427
90 Ga0068861_100267663 3300005719 Bacteria 1466
91 Ga0068851_10101458 3300005834 Bacteria 1527
92 Ga0068863_100000015 3300005841 Bacteria 214824
93 Ga0068863_100000280 3300005841 Bacteria 52729
94 Ga0068863_100026005 3300005841 Bacteria 5585
95 Ga0068858_100000884 3300005842 Bacteria 31099
96 Ga0068858_100007900 3300005842 Bacteria 10254
97 Ga0068860_100000104 3300005843 Bacteria 138111
98 Ga0068860_100000182 3300005843 Bacteria 100888
99 Ga0068860_100008984 3300005843 Bacteria 9954
100 Ga0068862_100000094 3300005844 Bacteria 106159
101 Ga0068862_100000308 3300005844 Bacteria 53687
102 Ga0068862_100007221 3300005844 Bacteria 9224
103 Ga0068862_100007469 3300005844 Bacteria 9060
104 Ga0068862_100031122 3300005844 Bacteria 4501
105 Ga0068862_100092289 3300005844 Bacteria 2639
106 Ga0075363_100242074 3300006048 Bacteria 1037
107 Ga0070712_100000761 3300006175 Bacteria 18982
108 Ga0097621_100709310 3300006237 Bacteria 927
109 Ga0068871_100591137 3300006358 Bacteria 1009
110 Ga0075428_100014648 3300006844 Bacteria 8708
111 Ga0075431_100100787 3300006847 Bacteria 2980
112 Ga0075431_100804322 3300006847 Bacteria 913
113 Ga0075434_100076681 3300006871 Bacteria 3338
114 Ga0075436_100002535 3300006914 Bacteria 12571
115 Ga0075436_100016286 3300006914 Bacteria 5089
116 Ga0097620_100010776 3300006931 Bacteria 9202
117 Ga0097620_100039829 3300006931 Bacteria 4716
118 Ga0097620_100129575 3300006931 Bacteria 2594
119 Ga0097620_100147711 3300006931 Bacteria 2426
120 Ga0075435_100083948 3300007076 Bacteria 2620
121 Ga0105251_10000853 3300009011 Bacteria 27320
122 Ga0105251_10112231 3300009011 Bacteria 1241
123 Ga0105240_10002294 3300009093 Bacteria 30970
124 Ga0105240_10015794 3300009093 Bacteria 10244
125 Ga0105240_10032211 3300009093 Bacteria 6789
126 Ga0105240_10511552 3300009093 Bacteria 1334
127 Ga0111539_10703093 3300009094 Bacteria 1177
128 Ga0105247_10003627 3300009101 Bacteria 10024
129 Ga0105247_10131270 3300009101 Bacteria 1633
130 Ga0105241_10100637 3300009174 Bacteria 2297
131 Ga0105241_10573249 3300009174 Bacteria 1016
132 Ga0105241_10620290 3300009174 Bacteria 979
133 Ga0105248_10000311 3300009177 Bacteria 57870
134 Ga0105248_10171244 3300009177 Bacteria 2447
135 Ga0105248_10202280 3300009177 Bacteria 2238
136 Ga0105237_10106567 3300009545 Bacteria 2795
137 Ga0105238_10000045 3300009551 Bacteria 148069
138 Ga0105238_10002544 3300009551 Bacteria 18220
139 Ga0105238_10101524 3300009551 Bacteria 2859
140 Ga0105238_10128822 3300009551 Bacteria 2509
141 Ga0105238_10152585 3300009551 Bacteria 2285
142 Ga0105238_10515016 3300009551 Bacteria 1198
143 Ga0105238_11450410 3300009551 Bacteria 714
144 Ga0105249_10000012 3300009553 Bacteria 292640
145 Ga0105249_10000568 3300009553 Bacteria 33920
146 Ga0105249_10007607 3300009553 Bacteria 9452
147 Ga0105249_10315483 3300009553 Bacteria 1573
148 Ga0105239_10010826 3300010375 Bacteria 10192
149 Ga0105239_10910658 3300010375 Bacteria 1009
150 Ga0157373_10019637 3300013100 Bacteria 4915
151 Ga0157370_10024209 3300013104 Bacteria 6016
152 Ga0157370_10035418 3300013104 Bacteria 4851
153 Ga0157369_10004483 3300013105 Bacteria 16454
154 Ga0157369_10004714 3300013105 Bacteria 16032
155 Ga0157369_10031631 3300013105 Bacteria 5825
156 Ga0157374_10141842 3300013296 Bacteria 2333
157 Ga0157374_10265574 3300013296 Bacteria 1691
158 Ga0163162_10045923 3300013306 Bacteria 4378
159 Ga0163162_10058375 3300013306 Bacteria 3887
160 Ga0163162_10184997 3300013306 Bacteria 2210
161 Ga0163162_10298086 3300013306 Bacteria 1744
162 Ga0157372_10321824 3300013307 Bacteria 1800
163 Ga0157375_11729340 3300013308 Bacteria 741
164 Ga0163163_10067350 3300014325 Bacteria 3560
165 Ga0163163_10177594 3300014325 Bacteria 2176
166 Ga0163163_10230076 3300014325 Bacteria 1903
167 Ga0163163_10317700 3300014325 Bacteria 1611
168 Ga0163163_10369885 3300014325 Bacteria 1490
169 Ga0157380_10000151 3300014326 Bacteria 39765
170 Ga0157380_10003723 3300014326 Bacteria 10487
171 Ga0157380_10154540 3300014326 Bacteria 1987
172 Ga0157379_10026550 3300014968 Bacteria 5155
173 Ga0157379_10166992 3300014968 Bacteria 1987
174 Ga0157379_10607493 3300014968 Bacteria 1021
175 Ga0163161_10000202 3300017792 Bacteria 54518
176 Ga0163161_10166644 3300017792 Bacteria 1682
177 Ga0213872_10105236 3300021361 Bacteria 1256
178 Ga0213871_10042092 3300021441 Bacteria 1229
179 Ga0209758_1000005 3300025297 Bacteria 1368918
180 Ga0209758_1026400 3300025297 Bacteria 2514
181 Ga0209257_1024848 3300025304 Bacteria 2062
182 Ga0207656_10025940 3300025321 Bacteria 2384
183 Ga0207713_1015664 3300025735 Bacteria 3879
184 Ga0207710_10003244 3300025900 Bacteria 7267
185 Ga0207710_10081772 3300025900 Bacteria 1500
186 Ga0207680_10000012 3300025903 Bacteria 293810
187 Ga0207680_10089654 3300025903 Bacteria 1953
188 Ga0207647_10015957 3300025904 Bacteria 5135
189 Ga0207699_10000445 3300025906 Bacteria 21151
190 Ga0207699_10026341 3300025906 Bacteria 3203
191 Ga0207705_10071923 3300025909 Bacteria 2508
192 Ga0207654_10001661 3300025911 Bacteria 11622
193 Ga0207654_10438945 3300025911 Bacteria 914
194 Ga0207695_10000641 3300025913 Bacteria 69705
195 Ga0207695_10024262 3300025913 Bacteria 6829
196 Ga0207695_10040856 3300025913 Bacteria 4968
197 Ga0207695_10385116 3300025913 Bacteria 1287
198 Ga0207671_10002738 3300025914 Bacteria 18433
199 Ga0207671_10125640 3300025914 Bacteria 1964
200 Ga0207693_10000456 3300025915 Bacteria 37291
201 Ga0207649_10543355 3300025920 Bacteria 888
202 Ga0207681_10000076 3300025923 Bacteria 89353
203 Ga0207681_10026005 3300025923 Bacteria 3772
204 Ga0207694_10001350 3300025924 Bacteria 21139
205 Ga0207694_10001461 3300025924 Bacteria 20212
206 Ga0207694_10105273 3300025924 Bacteria 2239
207 Ga0207694_10118885 3300025924 Bacteria 2109
208 Ga0207694_10240619 3300025924 Bacteria 1479
209 Ga0207650_10000054 3300025925 Bacteria 162602
210 Ga0207650_10012613 3300025925 Bacteria 5833
211 Ga0207650_10071137 3300025925 Bacteria 2616
212 Ga0207700_10000015 3300025928 Bacteria 224772
213 Ga0207664_10020189 3300025929 Bacteria 4935
214 Ga0207664_10191333 3300025929 Bacteria 1761
215 Ga0207644_10618185 3300025931 Bacteria 900
216 Ga0207690_10040990 3300025932 Bacteria 3031
217 Ga0207706_10018187 3300025933 Bacteria 6322
218 Ga0207706_10115904 3300025933 Bacteria 2356
219 Ga0207706_10394424 3300025933 Bacteria 1200
220 Ga0207670_10028238 3300025936 Bacteria 3559
221 Ga0207665_10139190 3300025939 Bacteria 1729
222 Ga0207711_10000017 3300025941 Bacteria 441730
223 Ga0207711_10030705 3300025941 Bacteria 4533
224 Ga0207711_10401952 3300025941 Bacteria 1273
225 Ga0207661_10955406 3300025944 Bacteria 789
226 Ga0207679_10079428 3300025945 Bacteria 2502
227 Ga0207667_10004663 3300025949 Bacteria 16793
228 Ga0207667_10005157 3300025949 Bacteria 15956
229 Ga0207667_10044332 3300025949 Bacteria 4714
230 Ga0207712_10000002 3300025961 Bacteria 706628
231 Ga0207712_10000021 3300025961 Bacteria 292649
232 Ga0207712_10000163 3300025961 Bacteria 68522
233 Ga0207712_10444070 3300025961 Bacteria 1099
234 Ga0207668_10007043 3300025972 Bacteria 6670
235 Ga0207668_10016352 3300025972 Bacteria 4628
236 Ga0207668_10052683 3300025972 Bacteria 2816
237 Ga0207640_10292715 3300025981 Bacteria 1284
238 Ga0207658_10000223 3300025986 Bacteria 59510
239 Ga0207658_10001629 3300025986 Bacteria 17221
240 Ga0207658_10018834 3300025986 Bacteria 4774
241 Ga0207658_10308407 3300025986 Bacteria 1366
242 Ga0207658_10403217 3300025986 Bacteria 1202
243 Ga0207703_10000593 3300026035 Bacteria 36861
244 Ga0207703_10098271 3300026035 Bacteria 2475
245 Ga0207639_10000300 3300026041 Bacteria 35006
246 Ga0207639_10015953 3300026041 Bacteria 5305
247 Ga0207639_10058399 3300026041 Bacteria 2968
248 Ga0207639_10383793 3300026041 Bacteria 1262
249 Ga0207639_10437558 3300026041 Bacteria 1185
250 Ga0207678_10003417 3300026067 Bacteria 14294
251 Ga0207702_10000011 3300026078 Bacteria 284514
252 Ga0207702_10008254 3300026078 Bacteria 8801
253 Ga0207702_10027197 3300026078 Bacteria 4750
254 Ga0207641_10000008 3300026088 Bacteria 424415
255 Ga0207641_10000414 3300026088 Bacteria 49835
256 Ga0207641_10019187 3300026088 Bacteria 5610
257 Ga0207676_10000019 3300026095 Bacteria 305653
258 Ga0207676_10001758 3300026095 Bacteria 15884
259 Ga0207676_10009609 3300026095 Bacteria 6885
260 Ga0207674_10000002 3300026116 Bacteria 279738
261 Ga0207674_10019146 3300026116 Bacteria 7421
262 Ga0207674_10041562 3300026116 Bacteria 4753
263 Ga0207674_10197203 3300026116 Bacteria 1963
264 Ga0207675_100000227 3300026118 Bacteria 53090
265 Ga0207675_100014364 3300026118 Bacteria 7384
266 Ga0207675_100837255 3300026118 Bacteria 934
267 Ga0207683_10657017 3300026121 Unclassified 971
268 Ga0207683_11018422 3300026121 Bacteria 769
269 Ga0268266_10000054 3300028379 Bacteria 292717
270 Ga0268266_10066557 3300028379 Bacteria 3116
271 Ga0268265_10000011 3300028380 Bacteria 343832
272 Ga0268265_10000104 3300028380 Bacteria 105776
273 Ga0268265_10001421 3300028380 Bacteria 20258
274 Ga0268265_10004916 3300028380 Bacteria 9189
275 Ga0268265_10005318 3300028380 Bacteria 8827
276 Ga0268265_10011849 3300028380 Bacteria 5894
277 Ga0268265_10050795 3300028380 Bacteria 3126
278 Ga0268265_10344499 3300028380 Unclassified 1358
279 Ga0268265_10354153 3300028380 Bacteria 1341
280 Ga0268265_10365075 3300028380 Bacteria 1323
281 Ga0268264_10000008 3300028381 Bacteria 773387
282 Ga0268264_10000074 3300028381 Bacteria 259555
283 Ga0268264_10045406 3300028381 Bacteria 3647
284 Ga0307517_10407881 3300028786 Bacteria 717
285 Ga0307515_10033612 3300028794 Bacteria 8432
286 Ga0265338_10005677 3300028800 Bacteria 16159
287 Ga0265338_10134720 3300028800 Bacteria 1944
288 Ga0265332_10011981 3300031238 Bacteria 3849
289 Ga0265327_10000952 3300031251 Bacteria 41843
290 Ga0307513_10015734 3300031456 Bacteria 9157
291 Ga0307508_10135290 3300031616 Bacteria 2068
292 Ga0316576_10471369 3300031727 Bacteria 926
293 Ga0316578_10123241 3300031728 Bacteria 1559
294 Ga0316578_10205206 3300031728 Bacteria 1186
295 Ga0307516_10000820 3300031730 Bacteria 42605
296 Ga0307516_10142349 3300031730 Bacteria 2166
297 Ga0307405_10151422 3300031731 Bacteria 1631
298 Ga0307405_10542519 3300031731 Bacteria 939
299 Ga0307406_10315386 3300031901 Bacteria 1207
300 Ga0307412_10171295 3300031911 Bacteria 1623
301 Ga0307409_100062284 3300031995 Bacteria 2920
302 Ga0307409_101094707 3300031995 Bacteria 818
303 Ga0307409_102374967 3300031995 Bacteria 559
304 Ga0307411_11375358 3300032005 Bacteria 645
305 Ga0307510_10000001 3300033180 Bacteria 1172244
306 Ga0307510_10006416 3300033180 Bacteria 14025
307 Ga0373923_0194686 3300035111 Bacteria 935
308 Ga0373936_0023372 3300035113 Bacteria 2409
309 Ga0373956_0129000 3300035119 Bacteria 1183
310 Ga0373957_0050987 3300035120 Bacteria 1583
311 Ga0373955_0004309 3300035172 Bacteria 6287
312 Ga0316574_0234706 3300035398 Bacteria 1173
313 Ga0373933_0029509 3300035724 Bacteria 3172
314 Ga0373937_0214699 3300036401 Bacteria 1810
315 Ga0316584_0057679 3300036712 Bacteria 2907
316 Ga0436364_0013276 3300037853 Bacteria 5331
317 Ga0237819_00546 3300038705 Bacteria 12675
318 Ga0436365_1797099 3300039437 Bacteria 84930
319 Ga0436360_1168634 3300039438 Bacteria 10578
320 Ga0436360_1227163 3300039438 Bacteria 575
321 Ga0436361_0493436 3300039447 Bacteria 15670
322 Ga0436362_0770601 3300039453 Bacteria 1516
323 Ga0451853_2791993 3300041512 Bacteria 888
324 Ga0439449_0085640 3300042007 Bacteria 1163
325 Ga0466965_0112846 3300044683 Bacteria 1398
326 Ga0453684_0647825 3300044712 Bacteria 1153
327 Ga0466957_0052546 3300044842 Bacteria 2481
328 Ga0451576_0706404 3300045051 Bacteria 1059
329 Ga0495638_0310737 3300046460 Bacteria 846
330 Ga0495616_0319413 3300046513 Bacteria 652
331 Ga0495663_0008887 3300046525 Bacteria 2787
332 Ga0495654_0006012 3300046530 Bacteria 6967
333 Ga0495654_0015546 3300046530 Bacteria 4040
334 Ga0495587_0242948 3300046536 Bacteria 1013
335 Ga0495622_0059439 3300046557 Bacteria 1770
336 Ga0495668_0010907 3300046616 Bacteria 5472
337 Ga0495668_0016018 3300046616 Bacteria 4366
338 Ga0495625_0097051 3300046660 Bacteria 2029
339 Ga0495657_0186300 3300046675 Bacteria 1270
340 Ga0495669_0036518 3300046684 Bacteria 2172
341 Ga0495589_0123485 3300046794 Bacteria 1246
342 Ga0495604_0688441 3300047317 Bacteria 650
343 Ga0495672_0049418 3300047320 Bacteria 2489
344 Ga0495672_0190972 3300047320 Bacteria 1030
345 Ga0495677_0005540 3300047445 Bacteria 4782
346 Ga0495686_0003725 3300047472 Bacteria 13010
347 Ga0495686_0015352 3300047472 Bacteria 5232
348 Ga0495686_0137875 3300047472 Bacteria 1442
349 Ga0495602_0159679 3300048088 Bacteria 1762
350 Ga0496100_0029233 3300048903 Bacteria 3407
351 Ga0496101_0187333 3300048904 Bacteria 1596
352 Ga0496101_0539426 3300048904 Bacteria 922
353 Ga0496102_0067110 3300048905 Bacteria 3289
354 Ga0496103_0001901 3300048906 Bacteria 13580
355 Ga0496103_0086609 3300048906 Bacteria 1975
356 Ga0496104_0073721 3300048907 Bacteria 3248
357 Ga0496105_0069283 3300048908 Bacteria 2915
358 Ga0496106_0183233 3300048909 Bacteria 1663
359 Ga0496111_0345760 3300048914 Bacteria 1101
360 Ga0496112_0115455 3300048915 Bacteria 2655
361 Ga0496112_1240881 3300048915 Unclassified 662
362 Ga0496114_0777858 3300048917 Bacteria 835
363 Ga0496117_0003796 3300048920 Bacteria 17237
364 Ga0496117_0006080 3300048920 Bacteria 12379
365 Ga0496118_0000870 3300048921 Bacteria 47798
366 Ga0496118_0027199 3300048921 Bacteria 4847
367 Ga0496120_0342170 3300048923 Bacteria 674
368 Ga0496122_0000879 3300048925 Bacteria 56300
369 Ga0496123_0000676 3300048926 Bacteria 56312
370 Ga0496125_0173209 3300048928 Bacteria 1448
371 Ga0496126_0003032 3300048929 Bacteria 21769
372 Ga0495678_101596 3300049459 Bacteria 995
373 Ga0501034_0152702 3300049571 Bacteria 2284
374 Ga0501046_0269042 3300049580 Bacteria 1250
375 Ga0501047_0003777 3300049581 Bacteria 14254
376 Ga0501257_004737 3300049686 Bacteria 2976
377 Ga0501044_0240198 3300049823 Bacteria 1756
378 nmdc:mga06r32_377195_c1 3300050510 Bacteria 1401
379 nmdc:mga06r32_748034_c1 3300050510 Bacteria 941
380 nmdc:mga0n895_75397_c1 3300050512 Bacteria 3353
381 nmdc:mga0rr50_32063_c1 3300050513 Bacteria 3739
382 nmdc:mga08x19_1603_c1 3300050514 Bacteria 14031
383 nmdc:mga08x19_37023_c1 3300050514 Bacteria 3094
384 Ga0500578_0030847 3300053086 Bacteria 3444
385 Ga0500643_000474 3300053087 Bacteria 29409
386 Ga0500643_002858 3300053087 Bacteria 8604
387 Ga0500643_005342 3300053087 Bacteria 5554
388 Ga0500643_008934 3300053087 Bacteria 3878
389 Ga0500644_0195020 3300053088 Bacteria 835
390 Ga0500644_0302329 3300053088 Bacteria 685
391 Ga0500646_0022921 3300053090 Bacteria 1672
392 Ga0500646_0093214 3300053090 Bacteria 935
393 Ga0500583_0195322 3300053092 Bacteria 1006
394 Ga0500651_0157838 3300053093 Bacteria 1358
395 Ga0500651_0159232 3300053093 Bacteria 1351
396 Ga0500566_0024737 3300053094 Bacteria 3523
397 Ga0500641_0020427 3300053096 Bacteria 2514
398 Ga0500654_151078 3300053099 Bacteria 816
399 Ga0500592_000243 3300053116 Bacteria 9903
400 Ga0500592_002917 3300053116 Bacteria 2744
401 Ga0500594_0096107 3300053118 Bacteria 906
402 Ga0500595_000113 3300053119 Bacteria 53829
403 Ga0500642_0000307 3300053130 Bacteria 17520
404 Ga0500642_0359719 3300053130 Bacteria 644
405 Ga0500652_215996 3300053131 Bacteria 773
406 Ga0500655_042941 3300053133 Bacteria 890
407 Ga0500658_0042703 3300053134 Bacteria 1823
408 Ga0500658_0274251 3300053134 Bacteria 775
409 Ga0500559_0009362 3300053136 Bacteria 4245
410 Ga0500559_0473438 3300053136 Bacteria 577
411 Ga0500568_0009693 3300053139 Bacteria 4560
412 Ga0500568_0031758 3300053139 Bacteria 2176
413 Ga0500568_0049335 3300053139 Bacteria 1662
414 Ga0500577_0015605 3300053142 Bacteria 2376
415 Ga0500577_0178460 3300053142 Bacteria 911
416 Ga0500577_0214656 3300053142 Bacteria 832
417 Ga0500588_0004071 3300053146 Bacteria 3137
418 Ga0500588_0129788 3300053146 Bacteria 896
419 Ga0500604_0001648 3300053151 Bacteria 6272
420 Ga0500616_0001170 3300053153 Bacteria 26722
421 Ga0500622_0164163 3300053156 Bacteria 1039
422 Ga0500627_0000329 3300053158 Bacteria 12969
423 Ga0500627_0000347 3300053158 Bacteria 12569
424 Ga0500627_0072521 3300053158 Bacteria 1527
425 Ga0500611_048924 3300053727 Bacteria 960
426 Ga0500609_000193 3300053731 Bacteria 8665
427 Ga0587085_093888 3300059506 Bacteria 624

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039438 Ga0436360_1227163 Ga0436360_1227163_14_484 156
2 3300005347 Ga0070668_100012847 Ga0070668_1000128476 157
3 3300009545 Ga0105237_10106567 Ga0105237_101065673 158
4 3300025914 Ga0207671_10125640 Ga0207671_101256402 158
5 3300031995 Ga0307409_102374967 Ga0307409_1023749671 158
6 3300053090 Ga0500646_0022921 Ga0500646_0022921_235_711 158
7 3300053139 Ga0500568_0031758 Ga0500568_0031758_97_573 158
8 3300005336 Ga0070680_100397693 Ga0070680_1003976932 159
9 3300005341 Ga0070691_10000365 Ga0070691_100003659 159
10 3300005434 Ga0070709_10029060 Ga0070709_100290602 159
11 3300005435 Ga0070714_100008568 Ga0070714_10000856810 159
12 3300005435 Ga0070714_100245500 Ga0070714_1002455002 159
13 3300005436 Ga0070713_100000001 Ga0070713_100000001221 159
14 3300005444 Ga0070694_100661432 Ga0070694_1006614322 159
15 3300005458 Ga0070681_10820922 Ga0070681_108209222 159
16 3300005535 Ga0070684_101118784 Ga0070684_1011187841 159
17 3300005539 Ga0068853_100007961 Ga0068853_1000079614 159
18 3300005539 Ga0068853_100159077 Ga0068853_1001590772 159
19 3300005545 Ga0070695_100027185 Ga0070695_1000271853 159
20 3300005563 Ga0068855_100093068 Ga0068855_1000930683 159
21 3300005564 Ga0070664_100136766 Ga0070664_1001367663 159
22 3300005577 Ga0068857_100000759 Ga0068857_1000007594 159
23 3300005614 Ga0068856_100001359 Ga0068856_10000135921 159
24 3300005614 Ga0068856_100030985 Ga0068856_1000309854 159
25 3300005616 Ga0068852_100082637 Ga0068852_1000826372 159
26 3300005844 Ga0068862_100007469 Ga0068862_1000074693 159
27 3300006175 Ga0070712_100000761 Ga0070712_10000076113 159
28 3300006237 Ga0097621_100709310 Ga0097621_1007093102 159
29 3300006358 Ga0068871_100591137 Ga0068871_1005911372 159
30 3300006871 Ga0075434_100076681 Ga0075434_1000766815 159
31 3300006914 Ga0075436_100002535 Ga0075436_10000253513 159
32 3300006914 Ga0075436_100016286 Ga0075436_1000162862 159
33 3300007076 Ga0075435_100083948 Ga0075435_1000839482 159
34 3300009093 Ga0105240_10032211 Ga0105240_100322115 159
35 3300009174 Ga0105241_10100637 Ga0105241_101006373 159
36 3300009551 Ga0105238_10002544 Ga0105238_100025443 159
37 3300010375 Ga0105239_10010826 Ga0105239_100108262 159
38 3300013100 Ga0157373_10019637 Ga0157373_100196375 159
39 3300013104 Ga0157370_10035418 Ga0157370_100354185 159
40 3300013105 Ga0157369_10004483 Ga0157369_1000448316 159
41 3300013296 Ga0157374_10141842 Ga0157374_101418422 159
42 3300013306 Ga0163162_10184997 Ga0163162_101849972 159
43 3300014325 Ga0163163_10177594 Ga0163163_101775943 159
44 3300014325 Ga0163163_10317700 Ga0163163_103177002 159
45 3300014325 Ga0163163_10369885 Ga0163163_103698852 159
46 3300014968 Ga0157379_10026550 Ga0157379_100265502 159
47 3300025906 Ga0207699_10000445 Ga0207699_1000044515 159
48 3300025906 Ga0207699_10026341 Ga0207699_100263412 159
49 3300025913 Ga0207695_10040856 Ga0207695_100408564 159
50 3300025915 Ga0207693_10000456 Ga0207693_1000045628 159
51 3300025928 Ga0207700_10000015 Ga0207700_1000001545 159
52 3300025929 Ga0207664_10020189 Ga0207664_100201896 159
53 3300025929 Ga0207664_10191333 Ga0207664_101913333 159
54 3300025939 Ga0207665_10139190 Ga0207665_101391902 159
55 3300025945 Ga0207679_10079428 Ga0207679_100794283 159
56 3300025949 Ga0207667_10005157 Ga0207667_100051578 159
57 3300025972 Ga0207668_10007043 Ga0207668_100070432 159
58 3300026041 Ga0207639_10000300 Ga0207639_1000030033 159
59 3300026041 Ga0207639_10015953 Ga0207639_100159533 159
60 3300026078 Ga0207702_10000011 Ga0207702_1000001140 159
61 3300026078 Ga0207702_10027197 Ga0207702_100271972 159
62 3300026116 Ga0207674_10000002 Ga0207674_1000000242 159
63 3300028380 Ga0268265_10001421 Ga0268265_1000142121 159
64 3300028380 Ga0268265_10354153 Ga0268265_103541532 159
65 3300035111 Ga0373923_0194686 Ga0373923_0194686_288_767 159
66 3300035119 Ga0373956_0129000 Ga0373956_0129000_513_992 159
67 3300035120 Ga0373957_0050987 Ga0373957_0050987_559_1038 159
68 3300035172 Ga0373955_0004309 Ga0373955_0004309_3816_4295 159
69 3300035724 Ga0373933_0029509 Ga0373933_0029509_2017_2496 159
70 3300036401 Ga0373937_0214699 Ga0373937_0214699_576_1055 159
71 3300042007 Ga0439449_0085640 Ga0439449_0085640_368_847 159
72 3300044683 Ga0466965_0112846 Ga0466965_0112846_862_1341 159
73 3300046530 Ga0495654_0015546 Ga0495654_0015546_1441_1920 159
74 3300046536 Ga0495587_0242948 Ga0495587_0242948_77_556 159
75 3300046675 Ga0495657_0186300 Ga0495657_0186300_570_1049 159
76 3300048088 Ga0495602_0159679 Ga0495602_0159679_582_1061 159
77 3300048909 Ga0496106_0183233 Ga0496106_0183233_241_720 159
78 3300049580 Ga0501046_0269042 Ga0501046_0269042_31_510 159
79 3300050512 nmdc:mga0n895_75397_c1 nmdc:mga0n895_75397_c1_609_1088 159
80 3300050513 nmdc:mga0rr50_32063_c1 nmdc:mga0rr50_32063_c1_627_1106 159
81 3300050514 nmdc:mga08x19_1603_c1 nmdc:mga08x19_1603_c1_1477_1956 159
82 3300050514 nmdc:mga08x19_37023_c1 nmdc:mga08x19_37023_c1_1784_2263 159
83 3300053116 Ga0500592_002917 Ga0500592_002917_1709_2188 159
84 3300053158 Ga0500627_0000329 Ga0500627_0000329_11880_12359 159
85 3300005844 Ga0068862_100092289 Ga0068862_1000922892 160
86 3300028380 Ga0268265_10344499 Ga0268265_103444992 160
87 3300045051 Ga0451576_0706404 Ga0451576_0706404_534_1016 160
88 3300053092 Ga0500583_0195322 Ga0500583_0195322_271_753 160
89 3300053130 Ga0500642_0359719 Ga0500642_0359719_42_524 160
90 3300009551 Ga0105238_10000045 Ga0105238_1000004522 161
91 3300025924 Ga0207694_10001350 Ga0207694_1000135012 161
92 3300044842 Ga0466957_0052546 Ga0466957_0052546_499_984 161
93 3300048915 Ga0496112_1240881 Ga0496112_1240881_53_538 161
94 3300031238 Ga0265332_10011981 Ga0265332_100119813 163
95 3300046557 Ga0495622_0059439 Ga0495622_0059439_807_1298 163
96 3300053136 Ga0500559_0473438 Ga0500559_0473438_63_554 163
97 3300028794 Ga0307515_10033612 Ga0307515_100336121 164
98 3300048904 Ga0496101_0539426 Ga0496101_0539426_23_517 164
99 3300049571 Ga0501034_0152702 Ga0501034_0152702_466_1029 164
100 3300059506 Ga0587085_093888 Ga0587085_093888_11_574 164
101 3300005289 Ga0065704_10102072 Ga0065704_101020722 165
102 3300005295 Ga0065707_10085380 Ga0065707_100853803 165
103 3300006844 Ga0075428_100014648 Ga0075428_1000146484 165
104 3300006847 Ga0075431_100100787 Ga0075431_1001007874 165
105 3300006847 Ga0075431_100804322 Ga0075431_1008043221 165
106 3300009094 Ga0111539_10703093 Ga0111539_107030932 165
107 3300044712 Ga0453684_0647825 Ga0453684_0647825_205_741 165
108 3300050510 nmdc:mga06r32_377195_c1 nmdc:mga06r32_377195_c1_112_717 165
109 3300050510 nmdc:mga06r32_748034_c1 nmdc:mga06r32_748034_c1_118_693 165
110 3300031251 Ga0265327_10000952 Ga0265327_1000095212 167
111 3300047472 Ga0495686_0137875 Ga0495686_0137875_85_684 171
112 iso_pu_bacteria 2847085930 2847087831 175
113 iso_pu_bacteria 2739367756 2739793318 176
114 iso_pu_bacteria 2987605356 2987607062 177
115 3300031728 Ga0316578_10123241 Ga0316578_101232412 179
116 3300013105 Ga0157369_10004714 Ga0157369_100047142 180
117 3300039437 Ga0436365_1797099 Ga0436365_1797099_84244_84786 180
118 3300005577 Ga0068857_100189435 Ga0068857_1001894353 181
119 3300009093 Ga0105240_10511552 Ga0105240_105115522 181
120 3300026116 Ga0207674_10197203 Ga0207674_101972032 181
121 3300026121 Ga0207683_10657017 Ga0207683_106570172 181
122 3300028800 Ga0265338_10005677 Ga0265338_100056777 181
123 3300028800 Ga0265338_10134720 Ga0265338_101347202 181
124 3300031616 Ga0307508_10135290 Ga0307508_101352902 181
125 3300031727 Ga0316576_10471369 Ga0316576_104713692 181
126 3300031728 Ga0316578_10205206 Ga0316578_102052061 181
127 3300031730 Ga0307516_10000820 Ga0307516_1000082014 181
128 3300031730 Ga0307516_10142349 Ga0307516_101423491 181
129 3300033180 Ga0307510_10000001 Ga0307510_1000000144 181
130 3300035113 Ga0373936_0023372 Ga0373936_0023372_1707_2252 181
131 3300035398 Ga0316574_0234706 Ga0316574_0234706_541_1086 181
132 3300036712 Ga0316584_0057679 Ga0316584_0057679_1808_2353 181
133 3300048917 Ga0496114_0777858 Ga0496114_0777858_88_669 181
134 3300048925 Ga0496122_0000879 Ga0496122_0000879_34628_35173 181
135 3300048926 Ga0496123_0000676 Ga0496123_0000676_34628_35173 181
136 3300049823 Ga0501044_0240198 Ga0501044_0240198_1057_1602 181
137 3300005335 Ga0070666_10140055 Ga0070666_101400552 182
138 3300005335 Ga0070666_10364932 Ga0070666_103649322 182
139 3300005347 Ga0070668_100051630 Ga0070668_1000516302 182
140 3300005366 Ga0070659_100426546 Ga0070659_1004265462 182
141 3300005367 Ga0070667_100294187 Ga0070667_1002941872 182
142 3300005456 Ga0070678_101185034 Ga0070678_1011850341 182
143 3300005530 Ga0070679_101008191 Ga0070679_1010081912 182
144 3300005539 Ga0068853_100323253 Ga0068853_1003232532 182
145 3300005618 Ga0068864_100002289 Ga0068864_1000022895 182
146 3300005842 Ga0068858_100000884 Ga0068858_10000088417 182
147 3300006048 Ga0075363_100242074 Ga0075363_1002420742 182
148 3300009093 Ga0105240_10002294 Ga0105240_100022947 182
149 3300009093 Ga0105240_10015794 Ga0105240_100157943 182
150 3300009174 Ga0105241_10573249 Ga0105241_105732491 182
151 3300009174 Ga0105241_10620290 Ga0105241_106202901 182
152 3300009177 Ga0105248_10171244 Ga0105248_101712444 182
153 3300009551 Ga0105238_10101524 Ga0105238_101015242 182
154 3300009551 Ga0105238_10128822 Ga0105238_101288223 182
155 3300010375 Ga0105239_10910658 Ga0105239_109106582 182
156 3300013296 Ga0157374_10265574 Ga0157374_102655743 182
157 3300013306 Ga0163162_10045923 Ga0163162_100459236 182
158 3300017792 Ga0163161_10166644 Ga0163161_101666443 182
159 3300025903 Ga0207680_10089654 Ga0207680_100896542 182
160 3300025913 Ga0207695_10024262 Ga0207695_100242624 182
161 3300025913 Ga0207695_10385116 Ga0207695_103851162 182
162 3300025920 Ga0207649_10543355 Ga0207649_105433552 182
163 3300025924 Ga0207694_10105273 Ga0207694_101052733 182
164 3300025924 Ga0207694_10118885 Ga0207694_101188852 182
165 3300025933 Ga0207706_10394424 Ga0207706_103944242 182
166 3300025941 Ga0207711_10030705 Ga0207711_100307056 182
167 3300025949 Ga0207667_10044332 Ga0207667_100443323 182
168 3300025972 Ga0207668_10052683 Ga0207668_100526832 182
169 3300025986 Ga0207658_10308407 Ga0207658_103084071 182
170 3300026035 Ga0207703_10000593 Ga0207703_1000059329 182
171 3300026041 Ga0207639_10058399 Ga0207639_100583992 182
172 3300026095 Ga0207676_10001758 Ga0207676_100017586 182
173 3300026118 Ga0207675_100837255 Ga0207675_1008372551 182
174 3300026121 Ga0207683_11018422 Ga0207683_110184221 182
175 3300028380 Ga0268265_10365075 Ga0268265_103650751 182
176 3300031456 Ga0307513_10015734 Ga0307513_100157346 182
177 3300031995 Ga0307409_101094707 Ga0307409_1010947071 182
178 3300032005 Ga0307411_11375358 Ga0307411_113753581 182
179 3300033180 Ga0307510_10006416 Ga0307510_1000641615 182
180 3300038705 Ga0237819_00546 Ga0237819_00546_9568_10116 182
181 3300046616 Ga0495668_0016018 Ga0495668_0016018_329_892 182
182 3300046660 Ga0495625_0097051 Ga0495625_0097051_770_1333 182
183 3300046684 Ga0495669_0036518 Ga0495669_0036518_699_1250 182
184 3300047317 Ga0495604_0688441 Ga0495604_0688441_86_637 182
185 3300047445 Ga0495677_0005540 Ga0495677_0005540_89_682 182
186 3300047472 Ga0495686_0003725 Ga0495686_0003725_1177_1725 182
187 3300047472 Ga0495686_0015352 Ga0495686_0015352_2683_3231 182
188 3300048915 Ga0496112_0115455 Ga0496112_0115455_1429_1977 182
189 3300049581 Ga0501047_0003777 Ga0501047_0003777_3643_4191 182
190 3300049686 Ga0501257_004737 Ga0501257_004737_1113_1661 182
191 3300053087 Ga0500643_002858 Ga0500643_002858_1080_1655 182
192 3300053087 Ga0500643_005342 Ga0500643_005342_1447_1995 182
193 3300053087 Ga0500643_008934 Ga0500643_008934_1833_2381 182
194 3300053093 Ga0500651_0159232 Ga0500651_0159232_204_761 182
195 3300053136 Ga0500559_0009362 Ga0500559_0009362_223_771 182
196 3300005289 Ga0065704_10325031 Ga0065704_103250312 183
197 3300005331 Ga0070670_100055168 Ga0070670_1000551682 183
198 3300005347 Ga0070668_100010990 Ga0070668_1000109905 183
199 3300005355 Ga0070671_100133994 Ga0070671_1001339942 183
200 3300005367 Ga0070667_100004567 Ga0070667_1000045673 183
201 3300005367 Ga0070667_100140450 Ga0070667_1001404501 183
202 3300005617 Ga0068859_100129578 Ga0068859_1001295782 183
203 3300005617 Ga0068859_100147706 Ga0068859_1001477062 183
204 3300005618 Ga0068864_100021332 Ga0068864_1000213321 183
205 3300005719 Ga0068861_100267663 Ga0068861_1002676632 183
206 3300005841 Ga0068863_100026005 Ga0068863_1000260051 183
207 3300005843 Ga0068860_100000104 Ga0068860_100000104113 183
208 3300005843 Ga0068860_100008984 Ga0068860_1000089842 183
209 3300005844 Ga0068862_100007221 Ga0068862_1000072215 183
210 3300005844 Ga0068862_100031122 Ga0068862_1000311223 183
211 3300006931 Ga0097620_100129575 Ga0097620_1001295752 183
212 3300006931 Ga0097620_100147711 Ga0097620_1001477112 183
213 3300009177 Ga0105248_10202280 Ga0105248_102022802 183
214 3300009551 Ga0105238_11450410 Ga0105238_114504101 183
215 3300009553 Ga0105249_10007607 Ga0105249_100076076 183
216 3300009553 Ga0105249_10315483 Ga0105249_103154832 183
217 3300014326 Ga0157380_10154540 Ga0157380_101545402 183
218 3300021361 Ga0213872_10105236 Ga0213872_101052361 183
219 3300021441 Ga0213871_10042092 Ga0213871_100420922 183
220 3300025297 Ga0209758_1026400 Ga0209758_10264003 183
221 3300025304 Ga0209257_1024848 Ga0209257_10248482 183
222 3300025923 Ga0207681_10026005 Ga0207681_100260052 183
223 3300025925 Ga0207650_10012613 Ga0207650_100126133 183
224 3300025931 Ga0207644_10618185 Ga0207644_106181851 183
225 3300025941 Ga0207711_10401952 Ga0207711_104019522 183
226 3300025961 Ga0207712_10000002 Ga0207712_10000002196 183
227 3300025961 Ga0207712_10444070 Ga0207712_104440702 183
228 3300025972 Ga0207668_10016352 Ga0207668_100163523 183
229 3300025986 Ga0207658_10018834 Ga0207658_100188342 183
230 3300025986 Ga0207658_10403217 Ga0207658_104032171 183
231 3300026088 Ga0207641_10019187 Ga0207641_100191875 183
232 3300026118 Ga0207675_100014364 Ga0207675_1000143643 183
233 3300028380 Ga0268265_10000104 Ga0268265_10000104110 183
234 3300028380 Ga0268265_10005318 Ga0268265_100053183 183
235 3300028380 Ga0268265_10011849 Ga0268265_100118494 183
236 3300028380 Ga0268265_10050795 Ga0268265_100507952 183
237 3300028381 Ga0268264_10000008 Ga0268264_10000008373 183
238 3300028381 Ga0268264_10045406 Ga0268264_100454062 183
239 3300037853 Ga0436364_0013276 Ga0436364_0013276_1539_2096 183
240 3300039438 Ga0436360_1168634 Ga0436360_1168634_621_1178 183
241 3300039447 Ga0436361_0493436 Ga0436361_0493436_250_807 183
242 3300046460 Ga0495638_0310737 Ga0495638_0310737_105_659 183
243 3300047320 Ga0495672_0049418 Ga0495672_0049418_1845_2399 183
244 3300053088 Ga0500644_0195020 Ga0500644_0195020_141_692 183
245 3300053088 Ga0500644_0302329 Ga0500644_0302329_48_599 183
246 3300053099 Ga0500654_151078 Ga0500654_151078_180_731 183
247 3300053134 Ga0500658_0274251 Ga0500658_0274251_178_729 183
248 3300053139 Ga0500568_0009693 Ga0500568_0009693_3858_4409 183
249 3300053139 Ga0500568_0049335 Ga0500568_0049335_293_844 183
250 3300053151 Ga0500604_0001648 Ga0500604_0001648_3158_3709 183
251 3300053153 Ga0500616_0001170 Ga0500616_0001170_2771_3322 183
252 3300003215 JGI25153J46596_10000022 JGI25153J46596_10000022188 184
253 3300025297 Ga0209758_1000005 Ga0209758_1000005375 184
254 3300041512 Ga0451853_2791993 Ga0451853_2791993_86_640 184
255 3300046513 Ga0495616_0319413 Ga0495616_0319413_35_589 184
256 3300047320 Ga0495672_0190972 Ga0495672_0190972_231_836 184
257 3300053086 Ga0500578_0030847 Ga0500578_0030847_401_955 184
258 3300053090 Ga0500646_0093214 Ga0500646_0093214_156_710 184
259 3300053093 Ga0500651_0157838 Ga0500651_0157838_47_601 184
260 3300053094 Ga0500566_0024737 Ga0500566_0024737_1954_2508 184
261 3300053096 Ga0500641_0020427 Ga0500641_0020427_411_965 184
262 3300053118 Ga0500594_0096107 Ga0500594_0096107_247_801 184
263 3300053119 Ga0500595_000113 Ga0500595_000113_31387_31941 184
264 3300053130 Ga0500642_0000307 Ga0500642_0000307_15772_16326 184
265 3300053131 Ga0500652_215996 Ga0500652_215996_47_601 184
266 3300053133 Ga0500655_042941 Ga0500655_042941_159_713 184
267 3300053134 Ga0500658_0042703 Ga0500658_0042703_676_1230 184
268 3300053142 Ga0500577_0015605 Ga0500577_0015605_195_749 184
269 3300053142 Ga0500577_0178460 Ga0500577_0178460_168_722 184
270 3300053146 Ga0500588_0129788 Ga0500588_0129788_97_651 184
271 3300053731 Ga0500609_000193 Ga0500609_000193_7486_8040 184
272 3300005548 Ga0070665_100064289 Ga0070665_1000642893 185
273 3300014325 Ga0163163_10230076 Ga0163163_102300762 185
274 3300014968 Ga0157379_10166992 Ga0157379_101669922 185
275 3300028379 Ga0268266_10066557 Ga0268266_100665573 185
276 3300048923 Ga0496120_0342170 Ga0496120_0342170_94_651 185
277 3300048928 Ga0496125_0173209 Ga0496125_0173209_76_633 185
278 3300048929 Ga0496126_0003032 Ga0496126_0003032_19465_20022 185
279 3300001976 JGI24752J21851_1000436 JGI24752J21851_10004364 186
280 3300005289 Ga0065704_10123648 Ga0065704_101236481 186
281 3300005331 Ga0070670_100000068 Ga0070670_10000006826 186
282 3300005355 Ga0070671_100699680 Ga0070671_1006996801 186
283 3300005367 Ga0070667_100001002 Ga0070667_10000100228 186
284 3300005617 Ga0068859_100039829 Ga0068859_1000398294 186
285 3300005618 Ga0068864_100000019 Ga0068864_10000001928 186
286 3300005841 Ga0068863_100000015 Ga0068863_10000001528 186
287 3300005844 Ga0068862_100000094 Ga0068862_10000009426 186
288 3300006931 Ga0097620_100039829 Ga0097620_1000398294 186
289 3300009011 Ga0105251_10000853 Ga0105251_1000085321 186
290 3300009101 Ga0105247_10003627 Ga0105247_100036275 186
291 3300009177 Ga0105248_10000311 Ga0105248_1000031147 186
292 3300009553 Ga0105249_10000568 Ga0105249_1000056822 186
293 3300013306 Ga0163162_10058375 Ga0163162_100583752 186
294 3300025735 Ga0207713_1015664 Ga0207713_10156643 186
295 3300025900 Ga0207710_10003244 Ga0207710_100032442 186
296 3300025925 Ga0207650_10000054 Ga0207650_1000005449 186
297 3300025941 Ga0207711_10000017 Ga0207711_10000017115 186
298 3300025961 Ga0207712_10000163 Ga0207712_1000016344 186
299 3300025986 Ga0207658_10000223 Ga0207658_1000022347 186
300 3300026088 Ga0207641_10000008 Ga0207641_10000008142 186
301 3300026095 Ga0207676_10000019 Ga0207676_1000001926 186
302 3300028380 Ga0268265_10000011 Ga0268265_10000011142 186
303 3300028786 Ga0307517_10407881 Ga0307517_104078811 186
304 3300039453 Ga0436362_0770601 Ga0436362_0770601_834_1400 186
305 3300048906 Ga0496103_0086609 Ga0496103_0086609_606_1166 186
306 3300048920 Ga0496117_0003796 Ga0496117_0003796_10657_11217 186
307 3300048921 Ga0496118_0000870 Ga0496118_0000870_25070_25630 186
308 3300005289 Ga0065704_10160255 Ga0065704_101602552 187
309 3300005295 Ga0065707_10082105 Ga0065707_100821052 187
310 3300013308 Ga0157375_11729340 Ga0157375_117293401 187
311 3300014326 Ga0157380_10003723 Ga0157380_100037235 187
312 3300046525 Ga0495663_0008887 Ga0495663_0008887_1628_2191 187
313 3300046530 Ga0495654_0006012 Ga0495654_0006012_942_1505 187
314 3300046616 Ga0495668_0010907 Ga0495668_0010907_881_1444 187
315 3300046794 Ga0495589_0123485 Ga0495589_0123485_190_753 187
316 3300049459 Ga0495678_101596 Ga0495678_101596_237_800 187
317 3300053116 Ga0500592_000243 Ga0500592_000243_4654_5217 187
318 3300053142 Ga0500577_0214656 Ga0500577_0214656_128_691 187
319 3300053146 Ga0500588_0004071 Ga0500588_0004071_248_811 187
320 3300053156 Ga0500622_0164163 Ga0500622_0164163_398_979 187
321 3300053158 Ga0500627_0000347 Ga0500627_0000347_11323_11886 187
322 3300053158 Ga0500627_0072521 Ga0500627_0072521_882_1445 187
323 3300053727 Ga0500611_048924 Ga0500611_048924_181_744 187
324 3300001904 JGI24736J21556_1000024 JGI24736J21556_100002415 188
325 3300001915 JGI24741J21665_1006453 JGI24741J21665_10064532 188
326 3300001976 JGI24752J21851_1000048 JGI24752J21851_10000485 188
327 3300001979 JGI24740J21852_10004963 JGI24740J21852_100049636 188
328 3300001979 JGI24740J21852_10092384 JGI24740J21852_100923841 188
329 3300001989 JGI24739J22299_10024328 JGI24739J22299_100243283 188
330 3300001990 JGI24737J22298_10005153 JGI24737J22298_100051536 188
331 3300002067 JGI24735J21928_10003032 JGI24735J21928_100030324 188
332 3300002070 JGI24750J21931_1000042 JGI24750J21931_10000427 188
333 3300002074 JGI24748J21848_1000063 JGI24748J21848_100006340 188
334 3300002075 JGI24738J21930_10001487 JGI24738J21930_100014876 188
335 3300002076 JGI24749J21850_1000472 JGI24749J21850_10004724 188
336 3300002239 JGI24034J26672_10000007 JGI24034J26672_1000000713 188
337 3300002244 JGI24742J22300_10002810 JGI24742J22300_100028103 188
338 3300005327 Ga0070658_10109171 Ga0070658_101091713 188
339 3300005330 Ga0070690_100000110 Ga0070690_10000011020 188
340 3300005331 Ga0070670_100054238 Ga0070670_1000542385 188
341 3300005335 Ga0070666_10000417 Ga0070666_100004176 188
342 3300005337 Ga0070682_100246689 Ga0070682_1002466891 188
343 3300005339 Ga0070660_100201009 Ga0070660_1002010091 188
344 3300005340 Ga0070689_100040808 Ga0070689_1000408083 188
345 3300005344 Ga0070661_100332032 Ga0070661_1003320321 188
346 3300005353 Ga0070669_100000332 Ga0070669_10000033223 188
347 3300005355 Ga0070671_100020174 Ga0070671_1000201742 188
348 3300005365 Ga0070688_100002132 Ga0070688_1000021323 188
349 3300005366 Ga0070659_100179815 Ga0070659_1001798152 188
350 3300005457 Ga0070662_100022201 Ga0070662_1000222014 188
351 3300005457 Ga0070662_100090184 Ga0070662_1000901842 188
352 3300005466 Ga0070685_10000036 Ga0070685_1000003679 188
353 3300005535 Ga0070684_100179811 Ga0070684_1001798113 188
354 3300005539 Ga0068853_100412531 Ga0068853_1004125312 188
355 3300005544 Ga0070686_100000045 Ga0070686_10000004582 188
356 3300005548 Ga0070665_100000042 Ga0070665_100000042207 188
357 3300005564 Ga0070664_100205330 Ga0070664_1002053302 188
358 3300005577 Ga0068857_100089178 Ga0068857_1000891782 188
359 3300005577 Ga0068857_100287823 Ga0068857_1002878231 188
360 3300005578 Ga0068854_100237589 Ga0068854_1002375892 188
361 3300005617 Ga0068859_100010776 Ga0068859_1000107763 188
362 3300005834 Ga0068851_10101458 Ga0068851_101014582 188
363 3300005841 Ga0068863_100000280 Ga0068863_10000028012 188
364 3300005842 Ga0068858_100007900 Ga0068858_1000079004 188
365 3300005843 Ga0068860_100000182 Ga0068860_10000018283 188
366 3300005844 Ga0068862_100000308 Ga0068862_10000030821 188
367 3300006931 Ga0097620_100010776 Ga0097620_1000107763 188
368 3300009011 Ga0105251_10112231 Ga0105251_101122312 188
369 3300009101 Ga0105247_10131270 Ga0105247_101312702 188
370 3300009551 Ga0105238_10152585 Ga0105238_101525852 188
371 3300009551 Ga0105238_10515016 Ga0105238_105150162 188
372 3300009553 Ga0105249_10000012 Ga0105249_1000001281 188
373 3300013104 Ga0157370_10024209 Ga0157370_100242094 188
374 3300013105 Ga0157369_10031631 Ga0157369_100316314 188
375 3300013306 Ga0163162_10298086 Ga0163162_102980862 188
376 3300013307 Ga0157372_10321824 Ga0157372_103218242 188
377 3300014325 Ga0163163_10067350 Ga0163163_100673505 188
378 3300014326 Ga0157380_10000151 Ga0157380_1000015131 188
379 3300014968 Ga0157379_10607493 Ga0157379_106074932 188
380 3300017792 Ga0163161_10000202 Ga0163161_1000020214 188
381 3300025321 Ga0207656_10025940 Ga0207656_100259402 188
382 3300025900 Ga0207710_10081772 Ga0207710_100817722 188
383 3300025903 Ga0207680_10000012 Ga0207680_10000012205 188
384 3300025904 Ga0207647_10015957 Ga0207647_100159573 188
385 3300025909 Ga0207705_10071923 Ga0207705_100719232 188
386 3300025911 Ga0207654_10001661 Ga0207654_1000166110 188
387 3300025911 Ga0207654_10438945 Ga0207654_104389451 188
388 3300025913 Ga0207695_10000641 Ga0207695_1000064113 188
389 3300025914 Ga0207671_10002738 Ga0207671_100027388 188
390 3300025923 Ga0207681_10000076 Ga0207681_1000007675 188
391 3300025924 Ga0207694_10001461 Ga0207694_1000146114 188
392 3300025924 Ga0207694_10240619 Ga0207694_102406192 188
393 3300025925 Ga0207650_10071137 Ga0207650_100711372 188
394 3300025932 Ga0207690_10040990 Ga0207690_100409901 188
395 3300025933 Ga0207706_10018187 Ga0207706_100181876 188
396 3300025933 Ga0207706_10115904 Ga0207706_101159042 188
397 3300025936 Ga0207670_10028238 Ga0207670_100282383 188
398 3300025944 Ga0207661_10955406 Ga0207661_109554061 188
399 3300025949 Ga0207667_10004663 Ga0207667_100046636 188
400 3300025961 Ga0207712_10000021 Ga0207712_10000021205 188
401 3300025981 Ga0207640_10292715 Ga0207640_102927152 188
402 3300025986 Ga0207658_10001629 Ga0207658_1000162919 188
403 3300026035 Ga0207703_10098271 Ga0207703_100982712 188
404 3300026041 Ga0207639_10383793 Ga0207639_103837931 188
405 3300026041 Ga0207639_10437558 Ga0207639_104375582 188
406 3300026067 Ga0207678_10003417 Ga0207678_100034172 188
407 3300026078 Ga0207702_10008254 Ga0207702_100082544 188
408 3300026088 Ga0207641_10000414 Ga0207641_100004149 188
409 3300026095 Ga0207676_10009609 Ga0207676_100096096 188
410 3300026116 Ga0207674_10019146 Ga0207674_1001914612 188
411 3300026116 Ga0207674_10041562 Ga0207674_100415623 188
412 3300026118 Ga0207675_100000227 Ga0207675_10000022736 188
413 3300028379 Ga0268266_10000054 Ga0268266_10000054204 188
414 3300028380 Ga0268265_10004916 Ga0268265_100049163 188
415 3300028381 Ga0268264_10000074 Ga0268264_10000074205 188
416 3300031731 Ga0307405_10151422 Ga0307405_101514222 188
417 3300031731 Ga0307405_10542519 Ga0307405_105425192 188
418 3300031901 Ga0307406_10315386 Ga0307406_103153861 188
419 3300031911 Ga0307412_10171295 Ga0307412_101712952 188
420 3300031995 Ga0307409_100062284 Ga0307409_1000622842 188
421 3300048903 Ga0496100_0029233 Ga0496100_0029233_696_1262 188
422 3300048904 Ga0496101_0187333 Ga0496101_0187333_731_1297 188
423 3300048905 Ga0496102_0067110 Ga0496102_0067110_2648_3214 188
424 3300048906 Ga0496103_0001901 Ga0496103_0001901_604_1170 188
425 3300048907 Ga0496104_0073721 Ga0496104_0073721_2472_3038 188
426 3300048908 Ga0496105_0069283 Ga0496105_0069283_2209_2775 188
427 3300048914 Ga0496111_0345760 Ga0496111_0345760_355_921 188
428 3300048920 Ga0496117_0006080 Ga0496117_0006080_775_1341 188
429 3300048921 Ga0496118_0027199 Ga0496118_0027199_4231_4797 188
430 3300053087 Ga0500643_000474 Ga0500643_000474_2061_2684 188

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00255

GSHPx

Glutathione peroxidase

38

145

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.9482 3 183
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9427 3 183
2wgr-assembly1.cif.gz_A combining crystallography and molecular dynamics: the case of schistosoma mansoni phospholipid glutathione peroxidase 0.9312 3 183
2v1m-assembly1.cif.gz_A crystal structure of schistosoma mansoni glutathione peroxidase 0.9259 3 183
7l8l-assembly1.cif.gz_A crystal structure of human r152h gpx4-u46c 0.9214 4 174
ID Description Score Start End Superfamily
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9563 3 179 3.40.30.10
af_Q2FUZ6_1_164_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9523 2 183 3.40.30.10
af_P06610_1_183_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9415 1 182 3.40.30.10
af_O59858_1_158_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9387 3 179 3.40.30.10
af_P06610_1_183_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9315 1 182 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1G3KCC8-F1-model_v4 Glutathione peroxidase 0.9945 6 182 GO:0004601
GO:0034599
AF-A0A2K0YDP6-F1-model_v4 Glutathione peroxidase 0.9936 5 182 GO:0004601
GO:0034599
AF-T0H1Y1-F1-model_v4 Glutathione peroxidase 0.9934 5 182 GO:0004601
GO:0034599
AF-A0A0Q4CC12-F1-model_v4 Glutathione peroxidase 0.99 3 182 GO:0004601
GO:0034599
AF-A0A0U5I9G7-F1-model_v4 deleted 0.9866 3 182

Feature Viewer

pLDDT pTM Quality
92.17 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map