F442121
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 430 | 251 | 430 | 103 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10479713|Ga0105240_104797132 |
| Length | 124 |
| Sequence | VVTNRAVDIDELTYVSQPTGKIMIHVIATVELNPGTRDKFLAEFRKLIPDVKSEAGCIEYGPAIDAETDIPIQYKLGPDRVVVVEKWETVAALKAHGVAPHMQAYRARVKDYVKGMELRVLSPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 62 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 70 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 71 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 72 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 73 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 74 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 75 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 91 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300019182 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 103 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 105 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 106 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 107 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 108 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 109 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 159 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 160 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 163 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 166 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 168 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 173 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 174 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 175 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 176 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 177 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 178 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 179 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 180 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 181 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 182 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 183 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 184 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 185 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 205 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 206 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 207 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 208 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 209 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 212 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 213 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 214 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 215 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 216 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 217 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 218 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 236 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 237 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 238 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 239 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 240 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 246 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 247 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 248 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.53 |
| Metatranscriptomes | 0.47 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.33 |
| Nodule | 0 |
| Rhizoplane | 4.42 |
| Rhizosphere | 88.84 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065707_10454769 | 3300005295 | Unclassified | 797 |
| 2 | Ga0070658_10722525 | 3300005327 | Bacteria | 865 |
| 3 | Ga0070676_10521337 | 3300005328 | Bacteria | 847 |
| 4 | Ga0070676_10581404 | 3300005328 | Unclassified | 805 |
| 5 | Ga0070690_100146968 | 3300005330 | Bacteria | 1605 |
| 6 | Ga0070690_100168754 | 3300005330 | Bacteria | 1505 |
| 7 | Ga0070670_100143056 | 3300005331 | Bacteria | 2068 |
| 8 | Ga0068869_100021968 | 3300005334 | Bacteria | 4392 |
| 9 | Ga0070680_100058853 | 3300005336 | Bacteria | 3143 |
| 10 | Ga0070680_100257281 | 3300005336 | Unclassified | 1476 |
| 11 | Ga0070680_100458417 | 3300005336 | Bacteria | 1089 |
| 12 | Ga0070680_101410455 | 3300005336 | Unclassified | 603 |
| 13 | Ga0070682_100736561 | 3300005337 | Unclassified | 794 |
| 14 | Ga0068868_100176020 | 3300005338 | Unclassified | 1773 |
| 15 | Ga0070689_100001664 | 3300005340 | Bacteria | 14184 |
| 16 | Ga0070689_100101280 | 3300005340 | Bacteria | 2280 |
| 17 | Ga0070691_10023886 | 3300005341 | Bacteria | 2839 |
| 18 | Ga0070661_100433017 | 3300005344 | Bacteria | 1044 |
| 19 | Ga0070692_10049587 | 3300005345 | Bacteria | 2178 |
| 20 | Ga0070692_11225377 | 3300005345 | Unclassified | 535 |
| 21 | Ga0070675_100708906 | 3300005354 | Bacteria | 917 |
| 22 | Ga0070671_100372366 | 3300005355 | Bacteria | 1220 |
| 23 | Ga0070671_101377812 | 3300005355 | Bacteria | 623 |
| 24 | Ga0070674_100036024 | 3300005356 | Bacteria | 3318 |
| 25 | Ga0070674_100188542 | 3300005356 | Bacteria | 1585 |
| 26 | Ga0070673_101567751 | 3300005364 | Unclassified | 622 |
| 27 | Ga0070688_100180273 | 3300005365 | Unclassified | 1465 |
| 28 | Ga0070659_100836338 | 3300005366 | Bacteria | 802 |
| 29 | Ga0070709_11276548 | 3300005434 | Unclassified | 592 |
| 30 | Ga0070709_11331686 | 3300005434 | Bacteria | 580 |
| 31 | Ga0070714_100033938 | 3300005435 | Bacteria | 4271 |
| 32 | Ga0070714_101248772 | 3300005435 | Bacteria | 725 |
| 33 | Ga0070714_101346022 | 3300005435 | Bacteria | 697 |
| 34 | Ga0070713_100030521 | 3300005436 | Bacteria | 4281 |
| 35 | Ga0070713_100459689 | 3300005436 | Bacteria | 1197 |
| 36 | Ga0070713_101554667 | 3300005436 | Bacteria | 642 |
| 37 | Ga0070710_10002314 | 3300005437 | Bacteria | 9009 |
| 38 | Ga0070710_10481081 | 3300005437 | Bacteria | 847 |
| 39 | Ga0070701_10005288 | 3300005438 | Bacteria | 5318 |
| 40 | Ga0070711_100064307 | 3300005439 | Unclassified | 2563 |
| 41 | Ga0070711_100173232 | 3300005439 | Bacteria | 1646 |
| 42 | Ga0070711_100519516 | 3300005439 | Bacteria | 984 |
| 43 | Ga0070711_101022680 | 3300005439 | Bacteria | 710 |
| 44 | Ga0070711_101317286 | 3300005439 | Bacteria | 627 |
| 45 | Ga0070705_100477943 | 3300005440 | Unclassified | 941 |
| 46 | Ga0070700_100004213 | 3300005441 | Bacteria | 7505 |
| 47 | Ga0070700_100012609 | 3300005441 | Bacteria | 4724 |
| 48 | Ga0070700_101179646 | 3300005441 | Bacteria | 638 |
| 49 | Ga0070694_100116702 | 3300005444 | Bacteria | 1909 |
| 50 | Ga0070694_100192588 | 3300005444 | Unclassified | 1515 |
| 51 | Ga0070708_100034755 | 3300005445 | Bacteria | 4387 |
| 52 | Ga0070663_100131668 | 3300005455 | Bacteria | 1900 |
| 53 | Ga0070663_100697461 | 3300005455 | Bacteria | 863 |
| 54 | Ga0070678_100076380 | 3300005456 | Bacteria | 2523 |
| 55 | Ga0070678_100110964 | 3300005456 | Bacteria | 2145 |
| 56 | Ga0070678_100365647 | 3300005456 | Bacteria | 1244 |
| 57 | Ga0070662_101930600 | 3300005457 | Unclassified | 510 |
| 58 | Ga0070681_10037120 | 3300005458 | Bacteria | 4891 |
| 59 | Ga0070681_10136994 | 3300005458 | Bacteria | 2378 |
| 60 | Ga0068867_100017730 | 3300005459 | Bacteria | 5053 |
| 61 | Ga0068867_100110611 | 3300005459 | Unclassified | 2111 |
| 62 | Ga0068867_101331654 | 3300005459 | Bacteria | 664 |
| 63 | Ga0068867_101410600 | 3300005459 | Bacteria | 646 |
| 64 | Ga0068867_101932185 | 3300005459 | Bacteria | 557 |
| 65 | Ga0070698_100016937 | 3300005471 | Bacteria | 7683 |
| 66 | Ga0070699_100162459 | 3300005518 | Bacteria | 1977 |
| 67 | Ga0070679_100065571 | 3300005530 | Bacteria | 3620 |
| 68 | Ga0070679_100195417 | 3300005530 | Bacteria | 1991 |
| 69 | Ga0070697_100489890 | 3300005536 | Unclassified | 1074 |
| 70 | Ga0068853_100143173 | 3300005539 | Bacteria | 2147 |
| 71 | Ga0070672_100001303 | 3300005543 | Bacteria | 15378 |
| 72 | Ga0070672_100653831 | 3300005543 | Unclassified | 918 |
| 73 | Ga0070686_100009259 | 3300005544 | Bacteria | 5528 |
| 74 | Ga0070686_101633862 | 3300005544 | Bacteria | 546 |
| 75 | Ga0070695_101455569 | 3300005545 | Unclassified | 569 |
| 76 | Ga0070695_101731133 | 3300005545 | Unclassified | 524 |
| 77 | Ga0070696_100015241 | 3300005546 | Bacteria | 5162 |
| 78 | Ga0070696_100051746 | 3300005546 | Unclassified | 2857 |
| 79 | Ga0070696_100152900 | 3300005546 | Bacteria | 1695 |
| 80 | Ga0070693_100304730 | 3300005547 | Bacteria | 1075 |
| 81 | Ga0070704_100484632 | 3300005549 | Bacteria | 1070 |
| 82 | Ga0070704_101857552 | 3300005549 | Bacteria | 558 |
| 83 | Ga0068855_100061976 | 3300005563 | Bacteria | 4368 |
| 84 | Ga0068855_100196573 | 3300005563 | Unclassified | 2272 |
| 85 | Ga0070664_100515033 | 3300005564 | Bacteria | 1104 |
| 86 | Ga0068857_100209883 | 3300005577 | Bacteria | 1777 |
| 87 | Ga0068854_100822411 | 3300005578 | Unclassified | 811 |
| 88 | Ga0068856_100594580 | 3300005614 | Bacteria | 1128 |
| 89 | Ga0068856_102152971 | 3300005614 | Unclassified | 567 |
| 90 | Ga0070702_100000858 | 3300005615 | Bacteria | 11749 |
| 91 | Ga0070702_100209480 | 3300005615 | Bacteria | 1296 |
| 92 | Ga0068852_100270489 | 3300005616 | Bacteria | 1635 |
| 93 | Ga0068859_100136457 | 3300005617 | Bacteria | 2526 |
| 94 | Ga0068859_100519128 | 3300005617 | Bacteria | 1286 |
| 95 | Ga0068859_101383019 | 3300005617 | Bacteria | 776 |
| 96 | Ga0068859_102541138 | 3300005617 | Unclassified | 564 |
| 97 | Ga0068864_100085546 | 3300005618 | Bacteria | 2773 |
| 98 | Ga0068864_100449834 | 3300005618 | Bacteria | 1232 |
| 99 | Ga0068864_101832883 | 3300005618 | Bacteria | 612 |
| 100 | Ga0068866_10011953 | 3300005718 | Bacteria | 3773 |
| 101 | Ga0068866_10590356 | 3300005718 | Unclassified | 748 |
| 102 | Ga0068861_100000970 | 3300005719 | Bacteria | 17479 |
| 103 | Ga0068863_100918840 | 3300005841 | Bacteria | 876 |
| 104 | Ga0068863_101136842 | 3300005841 | Bacteria | 786 |
| 105 | Ga0068863_101156160 | 3300005841 | Bacteria | 779 |
| 106 | Ga0068858_100003501 | 3300005842 | Bacteria | 15567 |
| 107 | Ga0068858_100326529 | 3300005842 | Bacteria | 1467 |
| 108 | Ga0068858_101444853 | 3300005842 | Bacteria | 678 |
| 109 | Ga0068860_100071474 | 3300005843 | Bacteria | 3298 |
| 110 | Ga0068862_100067035 | 3300005844 | Bacteria | 3093 |
| 111 | Ga0068862_100797493 | 3300005844 | Unclassified | 922 |
| 112 | Ga0081540_1002454 | 3300005983 | Bacteria | 15098 |
| 113 | Ga0070717_11123402 | 3300006028 | Bacteria | 716 |
| 114 | Ga0075364_10343229 | 3300006051 | Bacteria | 1018 |
| 115 | Ga0070712_100015173 | 3300006175 | Bacteria | 4955 |
| 116 | Ga0070712_100053269 | 3300006175 | Bacteria | 2825 |
| 117 | Ga0070712_101112952 | 3300006175 | Bacteria | 686 |
| 118 | Ga0075362_10174185 | 3300006177 | Bacteria | 1040 |
| 119 | Ga0075367_10998108 | 3300006178 | Bacteria | 535 |
| 120 | Ga0075366_10571032 | 3300006195 | Bacteria | 701 |
| 121 | Ga0097621_100284961 | 3300006237 | Unclassified | 1455 |
| 122 | Ga0097621_100389064 | 3300006237 | Bacteria | 1247 |
| 123 | Ga0097621_102058044 | 3300006237 | Bacteria | 546 |
| 124 | Ga0097621_102113908 | 3300006237 | Unclassified | 538 |
| 125 | Ga0068871_100011124 | 3300006358 | Bacteria | 6596 |
| 126 | Ga0068871_100391829 | 3300006358 | Bacteria | 1236 |
| 127 | Ga0068871_101516112 | 3300006358 | Unclassified | 634 |
| 128 | Ga0068871_102054757 | 3300006358 | Unclassified | 544 |
| 129 | Ga0075430_100499300 | 3300006846 | Bacteria | 1004 |
| 130 | Ga0075431_100009631 | 3300006847 | Bacteria | 9703 |
| 131 | Ga0075431_101709542 | 3300006847 | Bacteria | 586 |
| 132 | Ga0075429_100173164 | 3300006880 | Bacteria | 1891 |
| 133 | Ga0068865_100001909 | 3300006881 | Bacteria | 12250 |
| 134 | Ga0068865_100083928 | 3300006881 | Unclassified | 2294 |
| 135 | Ga0068865_100354806 | 3300006881 | Bacteria | 1189 |
| 136 | Ga0075436_100013013 | 3300006914 | Bacteria | 5704 |
| 137 | Ga0097620_100136446 | 3300006931 | Bacteria | 2526 |
| 138 | Ga0097620_100519148 | 3300006931 | Bacteria | 1286 |
| 139 | Ga0097620_101382918 | 3300006931 | Bacteria | 776 |
| 140 | Ga0097620_102540740 | 3300006931 | Unclassified | 564 |
| 141 | Ga0075435_101402723 | 3300007076 | Bacteria | 612 |
| 142 | Ga0099795_10187285 | 3300007788 | Bacteria | 867 |
| 143 | Ga0105240_10479713 | 3300009093 | Bacteria | 1386 |
| 144 | Ga0105240_12469236 | 3300009093 | Unclassified | 538 |
| 145 | Ga0111539_10106621 | 3300009094 | Bacteria | 3287 |
| 146 | Ga0111539_10499426 | 3300009094 | Bacteria | 1417 |
| 147 | Ga0105245_10086056 | 3300009098 | Bacteria | 2882 |
| 148 | Ga0105245_10824033 | 3300009098 | Bacteria | 967 |
| 149 | Ga0105245_10851498 | 3300009098 | Bacteria | 952 |
| 150 | Ga0105247_10146728 | 3300009101 | Bacteria | 1551 |
| 151 | Ga0105247_11646089 | 3300009101 | Unclassified | 529 |
| 152 | Ga0114129_10009531 | 3300009147 | Bacteria | 13852 |
| 153 | Ga0105243_10000798 | 3300009148 | Bacteria | 30100 |
| 154 | Ga0105243_10076343 | 3300009148 | Bacteria | 2722 |
| 155 | Ga0105243_10163804 | 3300009148 | Bacteria | 1920 |
| 156 | Ga0105241_10026169 | 3300009174 | Bacteria | 4339 |
| 157 | Ga0105241_10530014 | 3300009174 | Unclassified | 1054 |
| 158 | Ga0105242_11284471 | 3300009176 | Unclassified | 755 |
| 159 | Ga0105242_12243808 | 3300009176 | Bacteria | 592 |
| 160 | Ga0105248_12297976 | 3300009177 | Unclassified | 614 |
| 161 | Ga0105237_10010747 | 3300009545 | Bacteria | 9713 |
| 162 | Ga0105238_11403876 | 3300009551 | Unclassified | 725 |
| 163 | Ga0105238_11789444 | 3300009551 | Unclassified | 646 |
| 164 | Ga0105238_12252356 | 3300009551 | Unclassified | 580 |
| 165 | Ga0105238_13054594 | 3300009551 | Unclassified | 502 |
| 166 | Ga0105249_10065598 | 3300009553 | Bacteria | 3340 |
| 167 | Ga0105249_10152804 | 3300009553 | Bacteria | 2224 |
| 168 | Ga0105249_10209136 | 3300009553 | Bacteria | 1914 |
| 169 | Ga0105249_12958189 | 3300009553 | Bacteria | 545 |
| 170 | Ga0099796_10346470 | 3300010159 | Bacteria | 640 |
| 171 | Ga0105239_10020365 | 3300010375 | Bacteria | 7317 |
| 172 | Ga0105246_12302807 | 3300011119 | Unclassified | 526 |
| 173 | Ga0157370_10133767 | 3300013104 | Bacteria | 2312 |
| 174 | Ga0157369_10661686 | 3300013105 | Bacteria | 1077 |
| 175 | Ga0157374_10206574 | 3300013296 | Bacteria | 1925 |
| 176 | Ga0157374_11536562 | 3300013296 | Unclassified | 689 |
| 177 | Ga0157378_10033692 | 3300013297 | Bacteria | 4530 |
| 178 | Ga0157378_10116146 | 3300013297 | Bacteria | 2460 |
| 179 | Ga0157378_11588033 | 3300013297 | Bacteria | 700 |
| 180 | Ga0157378_13271092 | 3300013297 | Unclassified | 503 |
| 181 | Ga0157375_10351789 | 3300013308 | Bacteria | 1639 |
| 182 | Ga0157375_10352605 | 3300013308 | Bacteria | 1637 |
| 183 | Ga0157375_10677541 | 3300013308 | Bacteria | 1186 |
| 184 | Ga0157375_12355034 | 3300013308 | Bacteria | 635 |
| 185 | Ga0163163_10065474 | 3300014325 | Bacteria | 3608 |
| 186 | Ga0157380_10011865 | 3300014326 | Bacteria | 6300 |
| 187 | Ga0157380_10208955 | 3300014326 | Bacteria | 1738 |
| 188 | Ga0157380_11100612 | 3300014326 | Unclassified | 833 |
| 189 | Ga0157379_10379899 | 3300014968 | Bacteria | 1296 |
| 190 | Ga0157379_10753769 | 3300014968 | Bacteria | 917 |
| 191 | Ga0157379_12374768 | 3300014968 | Unclassified | 529 |
| 192 | Ga0157376_10508675 | 3300014969 | Bacteria | 1185 |
| 193 | Ga0157376_10544109 | 3300014969 | Bacteria | 1148 |
| 194 | Ga0157376_11358321 | 3300014969 | Unclassified | 741 |
| 195 | Ga0184598_106064 | 3300019182 | Bacteria | 520 |
| 196 | Ga0206352_11112191 | 3300020078 | Bacteria | 581 |
| 197 | Ga0213873_10018038 | 3300021358 | Bacteria | 1618 |
| 198 | Ga0213873_10039401 | 3300021358 | Bacteria | 1211 |
| 199 | Ga0213874_10031653 | 3300021377 | Bacteria | 1532 |
| 200 | Ga0213874_10144217 | 3300021377 | Bacteria | 826 |
| 201 | Ga0213874_10150170 | 3300021377 | Unclassified | 812 |
| 202 | Ga0213876_10101737 | 3300021384 | Bacteria | 1523 |
| 203 | Ga0213875_10001235 | 3300021388 | Bacteria | 17262 |
| 204 | Ga0213875_10032984 | 3300021388 | Bacteria | 2446 |
| 205 | Ga0213871_10001506 | 3300021441 | Bacteria | 3938 |
| 206 | Ga0213871_10089449 | 3300021441 | Unclassified | 891 |
| 207 | Ga0207656_10283949 | 3300025321 | Bacteria | 817 |
| 208 | Ga0207692_10064779 | 3300025898 | Bacteria | 1904 |
| 209 | Ga0207692_10812775 | 3300025898 | Bacteria | 612 |
| 210 | Ga0207642_10224200 | 3300025899 | Bacteria | 1052 |
| 211 | Ga0207642_10949769 | 3300025899 | Unclassified | 552 |
| 212 | Ga0207680_10818252 | 3300025903 | Bacteria | 668 |
| 213 | Ga0207699_10297498 | 3300025906 | Unclassified | 1126 |
| 214 | Ga0207645_10915201 | 3300025907 | Bacteria | 595 |
| 215 | Ga0207684_10116738 | 3300025910 | Unclassified | 2287 |
| 216 | Ga0207684_10983503 | 3300025910 | Bacteria | 706 |
| 217 | Ga0207654_10451521 | 3300025911 | Unclassified | 901 |
| 218 | Ga0207654_10601254 | 3300025911 | Unclassified | 785 |
| 219 | Ga0207707_10032701 | 3300025912 | Bacteria | 4552 |
| 220 | Ga0207707_10043419 | 3300025912 | Bacteria | 3922 |
| 221 | Ga0207671_10008421 | 3300025914 | Bacteria | 8749 |
| 222 | Ga0207693_10016096 | 3300025915 | Bacteria | 5985 |
| 223 | Ga0207693_10117448 | 3300025915 | Bacteria | 2088 |
| 224 | Ga0207693_10149245 | 3300025915 | Bacteria | 1838 |
| 225 | Ga0207693_11355721 | 3300025915 | Unclassified | 530 |
| 226 | Ga0207663_10151918 | 3300025916 | Bacteria | 1625 |
| 227 | Ga0207663_10202992 | 3300025916 | Bacteria | 1431 |
| 228 | Ga0207663_10302263 | 3300025916 | Bacteria | 1196 |
| 229 | Ga0207663_10827514 | 3300025916 | Bacteria | 738 |
| 230 | Ga0207663_11148041 | 3300025916 | Bacteria | 625 |
| 231 | Ga0207663_11223571 | 3300025916 | Bacteria | 605 |
| 232 | Ga0207663_11274445 | 3300025916 | Bacteria | 592 |
| 233 | Ga0207660_10065468 | 3300025917 | Bacteria | 2626 |
| 234 | Ga0207660_10101686 | 3300025917 | Bacteria | 2148 |
| 235 | Ga0207660_10402854 | 3300025917 | Bacteria | 1102 |
| 236 | Ga0207660_11377510 | 3300025917 | Unclassified | 572 |
| 237 | Ga0207649_11512545 | 3300025920 | Unclassified | 531 |
| 238 | Ga0207652_10098023 | 3300025921 | Bacteria | 2585 |
| 239 | Ga0207652_10439114 | 3300025921 | Bacteria | 1177 |
| 240 | Ga0207694_11124135 | 3300025924 | Unclassified | 665 |
| 241 | Ga0207650_10156470 | 3300025925 | Bacteria | 1802 |
| 242 | Ga0207650_10963142 | 3300025925 | Bacteria | 725 |
| 243 | Ga0207659_10075794 | 3300025926 | Bacteria | 2470 |
| 244 | Ga0207687_11373299 | 3300025927 | Unclassified | 607 |
| 245 | Ga0207664_10674862 | 3300025929 | Bacteria | 929 |
| 246 | Ga0207664_11227401 | 3300025929 | Unclassified | 668 |
| 247 | Ga0207644_10092689 | 3300025931 | Bacteria | 2254 |
| 248 | Ga0207644_11662562 | 3300025931 | Unclassified | 535 |
| 249 | Ga0207690_10719758 | 3300025932 | Bacteria | 821 |
| 250 | Ga0207706_11586254 | 3300025933 | Bacteria | 531 |
| 251 | Ga0207686_10418640 | 3300025934 | Unclassified | 1024 |
| 252 | Ga0207709_10246708 | 3300025935 | Unclassified | 1302 |
| 253 | Ga0207709_10530816 | 3300025935 | Unclassified | 923 |
| 254 | Ga0207670_10068307 | 3300025936 | Bacteria | 2448 |
| 255 | Ga0207670_10099149 | 3300025936 | Bacteria | 2078 |
| 256 | Ga0207704_10007957 | 3300025938 | Bacteria | 5040 |
| 257 | Ga0207704_11239602 | 3300025938 | Bacteria | 637 |
| 258 | Ga0207704_11618810 | 3300025938 | Unclassified | 556 |
| 259 | Ga0207665_10220191 | 3300025939 | Unclassified | 1391 |
| 260 | Ga0207665_11190566 | 3300025939 | Bacteria | 608 |
| 261 | Ga0207691_10016784 | 3300025940 | Bacteria | 6948 |
| 262 | Ga0207691_10495091 | 3300025940 | Unclassified | 1038 |
| 263 | Ga0207711_10462294 | 3300025941 | Bacteria | 1182 |
| 264 | Ga0207689_10007096 | 3300025942 | Bacteria | 9847 |
| 265 | Ga0207689_11607810 | 3300025942 | Unclassified | 540 |
| 266 | Ga0207679_11095785 | 3300025945 | Bacteria | 731 |
| 267 | Ga0207667_10155971 | 3300025949 | Bacteria | 2349 |
| 268 | Ga0207667_10165527 | 3300025949 | Bacteria | 2273 |
| 269 | Ga0207712_10102079 | 3300025961 | Bacteria | 2134 |
| 270 | Ga0207712_10211133 | 3300025961 | Bacteria | 1546 |
| 271 | Ga0207668_11120638 | 3300025972 | Bacteria | 706 |
| 272 | Ga0207640_11733468 | 3300025981 | Unclassified | 564 |
| 273 | Ga0207658_10642459 | 3300025986 | Bacteria | 956 |
| 274 | Ga0207677_10098748 | 3300026023 | Bacteria | 2142 |
| 275 | Ga0207703_10028240 | 3300026035 | Bacteria | 4421 |
| 276 | Ga0207703_10327836 | 3300026035 | Bacteria | 1404 |
| 277 | Ga0207703_11023803 | 3300026035 | Bacteria | 792 |
| 278 | Ga0207639_11881426 | 3300026041 | Unclassified | 559 |
| 279 | Ga0207678_10109137 | 3300026067 | Bacteria | 2360 |
| 280 | Ga0207708_10000385 | 3300026075 | Bacteria | 34524 |
| 281 | Ga0207708_10008430 | 3300026075 | Bacteria | 7626 |
| 282 | Ga0207648_10001978 | 3300026089 | Bacteria | 22373 |
| 283 | Ga0207648_10060508 | 3300026089 | Unclassified | 3303 |
| 284 | Ga0207676_10354265 | 3300026095 | Bacteria | 1358 |
| 285 | Ga0207676_11711001 | 3300026095 | Bacteria | 627 |
| 286 | Ga0207674_10028785 | 3300026116 | Bacteria | 5858 |
| 287 | Ga0207675_100002060 | 3300026118 | Bacteria | 20050 |
| 288 | Ga0207683_10013001 | 3300026121 | Bacteria | 7105 |
| 289 | Ga0268265_10471976 | 3300028380 | Bacteria | 1176 |
| 290 | Ga0268265_10827495 | 3300028380 | Unclassified | 904 |
| 291 | Ga0268264_10429820 | 3300028381 | Bacteria | 1275 |
| 292 | Ga0268264_11299359 | 3300028381 | Bacteria | 738 |
| 293 | Ga0307406_11866069 | 3300031901 | Bacteria | 535 |
| 294 | Ga0307416_103759585 | 3300032002 | Bacteria | 508 |
| 295 | Ga0373944_0157818 | 3300035089 | Bacteria | 803 |
| 296 | Ga0373923_0675048 | 3300035111 | Unclassified | 512 |
| 297 | Ga0373945_0093255 | 3300035116 | Bacteria | 1169 |
| 298 | Ga0373945_0438786 | 3300035116 | Unclassified | 576 |
| 299 | Ga0373953_0236777 | 3300035117 | Bacteria | 792 |
| 300 | Ga0373956_0243967 | 3300035119 | Bacteria | 854 |
| 301 | Ga0373946_0285514 | 3300035171 | Bacteria | 813 |
| 302 | Ga0373931_0093659 | 3300035691 | Bacteria | 1678 |
| 303 | Ga0373935_0099844 | 3300035692 | Bacteria | 1911 |
| 304 | Ga0373927_0058330 | 3300035695 | Bacteria | 2497 |
| 305 | Ga0373927_0099278 | 3300035695 | Bacteria | 1893 |
| 306 | Ga0373927_0215799 | 3300035695 | Bacteria | 1260 |
| 307 | Ga0373947_0468244 | 3300035725 | Bacteria | 854 |
| 308 | Ga0373937_0081098 | 3300036401 | Bacteria | 3001 |
| 309 | Ga0373925_0487022 | 3300037068 | Bacteria | 1012 |
| 310 | Ga0373925_1297524 | 3300037068 | Bacteria | 597 |
| 311 | Ga0395905_0104749 | 3300037471 | Bacteria | 2656 |
| 312 | Ga0436364_0905998 | 3300037853 | Bacteria | 1916 |
| 313 | Ga0436364_1420692 | 3300037853 | Bacteria | 8891 |
| 314 | Ga0436365_0310730 | 3300039437 | Bacteria | 540 |
| 315 | Ga0436365_0383665 | 3300039437 | Bacteria | 643 |
| 316 | Ga0436365_1360801 | 3300039437 | Bacteria | 3394 |
| 317 | Ga0436360_0125134 | 3300039438 | Unclassified | 1009 |
| 318 | Ga0436360_0153426 | 3300039438 | Bacteria | 729 |
| 319 | Ga0436360_0203368 | 3300039438 | Bacteria | 574 |
| 320 | Ga0436360_0442223 | 3300039438 | Bacteria | 1372 |
| 321 | Ga0436360_0653311 | 3300039438 | Bacteria | 995 |
| 322 | Ga0436360_0664960 | 3300039438 | Bacteria | 1151 |
| 323 | Ga0436360_0705024 | 3300039438 | Bacteria | 668 |
| 324 | Ga0436360_0761125 | 3300039438 | Bacteria | 1765 |
| 325 | Ga0436360_1135695 | 3300039438 | Unclassified | 567 |
| 326 | Ga0436360_1198800 | 3300039438 | Bacteria | 653 |
| 327 | Ga0436360_1302070 | 3300039438 | Bacteria | 1093 |
| 328 | Ga0436361_0144311 | 3300039447 | Bacteria | 702 |
| 329 | Ga0436361_0295633 | 3300039447 | Bacteria | 2949 |
| 330 | Ga0436361_0534918 | 3300039447 | Unclassified | 850 |
| 331 | Ga0436363_0002125 | 3300039450 | Bacteria | 12690 |
| 332 | Ga0436363_0432638 | 3300039450 | Bacteria | 1808 |
| 333 | Ga0436363_0565357 | 3300039450 | Unclassified | 1042 |
| 334 | Ga0436363_0796440 | 3300039450 | Bacteria | 906 |
| 335 | Ga0436363_1392544 | 3300039450 | Bacteria | 1608 |
| 336 | Ga0436363_1680540 | 3300039450 | Bacteria | 1091 |
| 337 | Ga0436362_0747529 | 3300039453 | Bacteria | 1542 |
| 338 | Ga0436362_1094717 | 3300039453 | Bacteria | 575 |
| 339 | Ga0436362_1176420 | 3300039453 | Bacteria | 905 |
| 340 | Ga0436362_1289551 | 3300039453 | Bacteria | 1440 |
| 341 | Ga0439465_0235928 | 3300041413 | Bacteria | 674 |
| 342 | Ga0451853_1169942 | 3300041512 | Bacteria | 510 |
| 343 | Ga0439458_0226651 | 3300042157 | Bacteria | 516 |
| 344 | Ga0466963_0844687 | 3300044694 | Bacteria | 646 |
| 345 | Ga0453684_0009320 | 3300044712 | Bacteria | 17224 |
| 346 | Ga0466957_0665163 | 3300044842 | Bacteria | 733 |
| 347 | Ga0466958_1020831 | 3300045836 | Bacteria | 540 |
| 348 | Ga0466967_0925519 | 3300045976 | Bacteria | 867 |
| 349 | Ga0466967_2040951 | 3300045976 | Unclassified | 570 |
| 350 | Ga0495651_0252154 | 3300046462 | Bacteria | 1205 |
| 351 | Ga0495580_0087633 | 3300046472 | Bacteria | 2168 |
| 352 | Ga0495582_0283198 | 3300046473 | Unclassified | 952 |
| 353 | Ga0495618_0571481 | 3300046514 | Bacteria | 675 |
| 354 | Ga0495640_0148923 | 3300046533 | Bacteria | 1505 |
| 355 | Ga0495640_0286743 | 3300046533 | Bacteria | 1025 |
| 356 | Ga0495640_0640402 | 3300046533 | Bacteria | 640 |
| 357 | Ga0495586_0316995 | 3300046535 | Bacteria | 894 |
| 358 | Ga0495667_0836513 | 3300046559 | Unclassified | 566 |
| 359 | Ga0495635_0326604 | 3300046663 | Bacteria | 1026 |
| 360 | Ga0495657_0216121 | 3300046675 | Bacteria | 1164 |
| 361 | Ga0495647_0058579 | 3300046681 | Bacteria | 1514 |
| 362 | Ga0495658_0032958 | 3300046683 | Bacteria | 2833 |
| 363 | Ga0495658_0756348 | 3300046683 | Bacteria | 622 |
| 364 | Ga0495613_0193872 | 3300046689 | Bacteria | 1435 |
| 365 | Ga0495604_0491817 | 3300047317 | Bacteria | 797 |
| 366 | Ga0495675_0800181 | 3300047444 | Unclassified | 522 |
| 367 | Ga0495684_0402753 | 3300047471 | Bacteria | 960 |
| 368 | Ga0495602_0764245 | 3300048088 | Bacteria | 651 |
| 369 | Ga0496100_0081120 | 3300048903 | Bacteria | 2191 |
| 370 | Ga0496101_1492597 | 3300048904 | Unclassified | 526 |
| 371 | Ga0496102_0217965 | 3300048905 | Bacteria | 1799 |
| 372 | Ga0496102_0513405 | 3300048905 | Bacteria | 1121 |
| 373 | Ga0496104_0006459 | 3300048907 | Bacteria | 10306 |
| 374 | Ga0496104_0701378 | 3300048907 | Bacteria | 920 |
| 375 | Ga0496105_0069294 | 3300048908 | Bacteria | 2915 |
| 376 | Ga0496106_0139670 | 3300048909 | Bacteria | 1905 |
| 377 | Ga0496108_0359101 | 3300048911 | Bacteria | 1271 |
| 378 | Ga0496109_0018529 | 3300048912 | Bacteria | 6115 |
| 379 | Ga0496109_0518510 | 3300048912 | Bacteria | 1125 |
| 380 | Ga0496110_0041716 | 3300048913 | Bacteria | 4005 |
| 381 | Ga0496110_0098138 | 3300048913 | Bacteria | 2625 |
| 382 | Ga0496111_0141286 | 3300048914 | Bacteria | 1784 |
| 383 | Ga0496111_1285925 | 3300048914 | Bacteria | 516 |
| 384 | Ga0496112_0092482 | 3300048915 | Bacteria | 2994 |
| 385 | Ga0496113_0121716 | 3300048916 | Bacteria | 2041 |
| 386 | Ga0496114_0073625 | 3300048917 | Bacteria | 2875 |
| 387 | Ga0496115_0007003 | 3300048918 | Bacteria | 8283 |
| 388 | Ga0496126_0840948 | 3300048929 | Unclassified | 701 |
| 389 | Ga0501033_0871761 | 3300049570 | Unclassified | 606 |
| 390 | Ga0501036_0286339 | 3300049572 | Bacteria | 1379 |
| 391 | Ga0501039_0089840 | 3300049575 | Unclassified | 2394 |
| 392 | Ga0501039_0368255 | 3300049575 | Bacteria | 1129 |
| 393 | Ga0501042_1221532 | 3300049578 | Unclassified | 548 |
| 394 | Ga0501047_1013695 | 3300049581 | Bacteria | 643 |
| 395 | Ga0501048_0266301 | 3300049582 | Unclassified | 1218 |
| 396 | Ga0501069_0235272 | 3300049585 | Bacteria | 1067 |
| 397 | Ga0501070_1376343 | 3300049586 | Bacteria | 537 |
| 398 | Ga0501073_0635609 | 3300049589 | Bacteria | 737 |
| 399 | Ga0501076_1156999 | 3300049592 | Bacteria | 637 |
| 400 | Ga0501077_0938398 | 3300049593 | Unclassified | 557 |
| 401 | Ga0501079_0184672 | 3300049741 | Bacteria | 1628 |
| 402 | Ga0501080_1144337 | 3300049742 | Bacteria | 671 |
| 403 | Ga0501081_1116873 | 3300049743 | Unclassified | 597 |
| 404 | Ga0501083_0031412 | 3300049744 | Bacteria | 3645 |
| 405 | Ga0501044_0113264 | 3300049823 | Bacteria | 2720 |
| 406 | Ga0501045_0987646 | 3300049824 | Unclassified | 617 |
| 407 | nmdc:mga03683_342361_c1 | 3300050489 | Bacteria | 707 |
| 408 | nmdc:mga00v17_792856_c1 | 3300050491 | Bacteria | 604 |
| 409 | nmdc:mga0yw44_340444_c1 | 3300050492 | Bacteria | 1009 |
| 410 | nmdc:mga0yw44_407167_c1 | 3300050492 | Bacteria | 920 |
| 411 | nmdc:mga0k408_346249_c1 | 3300050493 | Bacteria | 886 |
| 412 | nmdc:mga06z11_602593_c1 | 3300050494 | Bacteria | 668 |
| 413 | nmdc:mga05p37_48828_c1 | 3300050507 | Bacteria | 5204 |
| 414 | nmdc:mga09592_36296_c1 | 3300050508 | Bacteria | 4127 |
| 415 | nmdc:mga0qj67_655731_c1 | 3300050509 | Bacteria | 837 |
| 416 | nmdc:mga06r32_72497_c1 | 3300050510 | Bacteria | 3334 |
| 417 | nmdc:mga08y16_119835_c1 | 3300050511 | Bacteria | 2739 |
| 418 | nmdc:mga0n895_1672357_c1 | 3300050512 | Bacteria | 599 |
| 419 | nmdc:mga0rr50_1721835_c1 | 3300050513 | Bacteria | 528 |
| 420 | nmdc:mga08x19_15244_c1 | 3300050514 | Unclassified | 4674 |
| 421 | Ga0495601_0147733 | 3300053077 | Bacteria | 1534 |
| 422 | Ga0495601_0355080 | 3300053077 | Bacteria | 953 |
| 423 | Ga0495612_0062710 | 3300053078 | Bacteria | 1541 |
| 424 | Ga0495612_0438204 | 3300053078 | Bacteria | 596 |
| 425 | Ga0495619_0018080 | 3300053085 | Bacteria | 4470 |
| 426 | Ga0495619_0256695 | 3300053085 | Bacteria | 1211 |
| 427 | Ga0495619_0567372 | 3300053085 | Bacteria | 778 |
| 428 | Ga0501084_0490061 | 3300054114 | Bacteria | 1039 |
| 429 | Ga0501084_0531860 | 3300054114 | Bacteria | 994 |
| 430 | Ga0501084_0779482 | 3300054114 | Bacteria | 805 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005436 | Ga0070713_100459689 | Ga0070713_1004596892 | 99 |
| 2 | 3300006358 | Ga0068871_100391829 | Ga0068871_1003918292 | 99 |
| 3 | 3300005617 | Ga0068859_100519128 | Ga0068859_1005191282 | 100 |
| 4 | 3300006931 | Ga0097620_100519148 | Ga0097620_1005191482 | 100 |
| 5 | 3300032002 | Ga0307416_103759585 | Ga0307416_1037595851 | 100 |
| 6 | 3300041413 | Ga0439465_0235928 | Ga0439465_0235928_210_512 | 100 |
| 7 | 3300044712 | Ga0453684_0009320 | Ga0453684_0009320_4035_4349 | 100 |
| 8 | 3300005295 | Ga0065707_10454769 | Ga0065707_104547691 | 102 |
| 9 | 3300005327 | Ga0070658_10722525 | Ga0070658_107225251 | 102 |
| 10 | 3300005328 | Ga0070676_10521337 | Ga0070676_105213372 | 102 |
| 11 | 3300005328 | Ga0070676_10581404 | Ga0070676_105814041 | 102 |
| 12 | 3300005330 | Ga0070690_100146968 | Ga0070690_1001469683 | 102 |
| 13 | 3300005330 | Ga0070690_100168754 | Ga0070690_1001687543 | 102 |
| 14 | 3300005331 | Ga0070670_100143056 | Ga0070670_1001430563 | 102 |
| 15 | 3300005334 | Ga0068869_100021968 | Ga0068869_1000219684 | 102 |
| 16 | 3300005336 | Ga0070680_100058853 | Ga0070680_1000588532 | 102 |
| 17 | 3300005336 | Ga0070680_100257281 | Ga0070680_1002572812 | 102 |
| 18 | 3300005336 | Ga0070680_100458417 | Ga0070680_1004584171 | 102 |
| 19 | 3300005336 | Ga0070680_101410455 | Ga0070680_1014104551 | 102 |
| 20 | 3300005337 | Ga0070682_100736561 | Ga0070682_1007365612 | 102 |
| 21 | 3300005338 | Ga0068868_100176020 | Ga0068868_1001760201 | 102 |
| 22 | 3300005340 | Ga0070689_100001664 | Ga0070689_10000166410 | 102 |
| 23 | 3300005340 | Ga0070689_100101280 | Ga0070689_1001012803 | 102 |
| 24 | 3300005341 | Ga0070691_10023886 | Ga0070691_100238864 | 102 |
| 25 | 3300005344 | Ga0070661_100433017 | Ga0070661_1004330172 | 102 |
| 26 | 3300005345 | Ga0070692_10049587 | Ga0070692_100495871 | 102 |
| 27 | 3300005345 | Ga0070692_11225377 | Ga0070692_112253771 | 102 |
| 28 | 3300005354 | Ga0070675_100708906 | Ga0070675_1007089062 | 102 |
| 29 | 3300005355 | Ga0070671_100372366 | Ga0070671_1003723662 | 102 |
| 30 | 3300005355 | Ga0070671_101377812 | Ga0070671_1013778122 | 102 |
| 31 | 3300005356 | Ga0070674_100036024 | Ga0070674_1000360242 | 102 |
| 32 | 3300005356 | Ga0070674_100188542 | Ga0070674_1001885421 | 102 |
| 33 | 3300005364 | Ga0070673_101567751 | Ga0070673_1015677512 | 102 |
| 34 | 3300005365 | Ga0070688_100180273 | Ga0070688_1001802731 | 102 |
| 35 | 3300005366 | Ga0070659_100836338 | Ga0070659_1008363382 | 102 |
| 36 | 3300005434 | Ga0070709_11276548 | Ga0070709_112765482 | 102 |
| 37 | 3300005434 | Ga0070709_11331686 | Ga0070709_113316862 | 102 |
| 38 | 3300005435 | Ga0070714_100033938 | Ga0070714_1000339382 | 102 |
| 39 | 3300005435 | Ga0070714_101248772 | Ga0070714_1012487722 | 102 |
| 40 | 3300005435 | Ga0070714_101346022 | Ga0070714_1013460222 | 102 |
| 41 | 3300005436 | Ga0070713_100030521 | Ga0070713_1000305216 | 102 |
| 42 | 3300005436 | Ga0070713_101554667 | Ga0070713_1015546671 | 102 |
| 43 | 3300005437 | Ga0070710_10002314 | Ga0070710_100023146 | 102 |
| 44 | 3300005437 | Ga0070710_10481081 | Ga0070710_104810812 | 102 |
| 45 | 3300005438 | Ga0070701_10005288 | Ga0070701_100052887 | 102 |
| 46 | 3300005439 | Ga0070711_100064307 | Ga0070711_1000643075 | 102 |
| 47 | 3300005439 | Ga0070711_100173232 | Ga0070711_1001732322 | 102 |
| 48 | 3300005439 | Ga0070711_100519516 | Ga0070711_1005195162 | 102 |
| 49 | 3300005439 | Ga0070711_101022680 | Ga0070711_1010226801 | 102 |
| 50 | 3300005439 | Ga0070711_101317286 | Ga0070711_1013172862 | 102 |
| 51 | 3300005440 | Ga0070705_100477943 | Ga0070705_1004779431 | 102 |
| 52 | 3300005441 | Ga0070700_100004213 | Ga0070700_1000042136 | 102 |
| 53 | 3300005441 | Ga0070700_100012609 | Ga0070700_1000126094 | 102 |
| 54 | 3300005441 | Ga0070700_101179646 | Ga0070700_1011796461 | 102 |
| 55 | 3300005444 | Ga0070694_100116702 | Ga0070694_1001167021 | 102 |
| 56 | 3300005444 | Ga0070694_100192588 | Ga0070694_1001925882 | 102 |
| 57 | 3300005445 | Ga0070708_100034755 | Ga0070708_1000347553 | 102 |
| 58 | 3300005455 | Ga0070663_100131668 | Ga0070663_1001316681 | 102 |
| 59 | 3300005455 | Ga0070663_100697461 | Ga0070663_1006974611 | 102 |
| 60 | 3300005456 | Ga0070678_100076380 | Ga0070678_1000763802 | 102 |
| 61 | 3300005456 | Ga0070678_100110964 | Ga0070678_1001109642 | 102 |
| 62 | 3300005456 | Ga0070678_100365647 | Ga0070678_1003656471 | 102 |
| 63 | 3300005457 | Ga0070662_101930600 | Ga0070662_1019306001 | 102 |
| 64 | 3300005458 | Ga0070681_10037120 | Ga0070681_100371202 | 102 |
| 65 | 3300005458 | Ga0070681_10136994 | Ga0070681_101369942 | 102 |
| 66 | 3300005459 | Ga0068867_100017730 | Ga0068867_1000177303 | 102 |
| 67 | 3300005459 | Ga0068867_100110611 | Ga0068867_1001106112 | 102 |
| 68 | 3300005459 | Ga0068867_101331654 | Ga0068867_1013316542 | 102 |
| 69 | 3300005459 | Ga0068867_101410600 | Ga0068867_1014106001 | 102 |
| 70 | 3300005459 | Ga0068867_101932185 | Ga0068867_1019321851 | 102 |
| 71 | 3300005471 | Ga0070698_100016937 | Ga0070698_1000169377 | 102 |
| 72 | 3300005518 | Ga0070699_100162459 | Ga0070699_1001624594 | 102 |
| 73 | 3300005530 | Ga0070679_100065571 | Ga0070679_1000655712 | 102 |
| 74 | 3300005530 | Ga0070679_100195417 | Ga0070679_1001954173 | 102 |
| 75 | 3300005536 | Ga0070697_100489890 | Ga0070697_1004898901 | 102 |
| 76 | 3300005539 | Ga0068853_100143173 | Ga0068853_1001431732 | 102 |
| 77 | 3300005543 | Ga0070672_100001303 | Ga0070672_10000130319 | 102 |
| 78 | 3300005543 | Ga0070672_100653831 | Ga0070672_1006538312 | 102 |
| 79 | 3300005544 | Ga0070686_100009259 | Ga0070686_1000092592 | 102 |
| 80 | 3300005544 | Ga0070686_101633862 | Ga0070686_1016338621 | 102 |
| 81 | 3300005545 | Ga0070695_101455569 | Ga0070695_1014555692 | 102 |
| 82 | 3300005545 | Ga0070695_101731133 | Ga0070695_1017311331 | 102 |
| 83 | 3300005546 | Ga0070696_100015241 | Ga0070696_1000152413 | 102 |
| 84 | 3300005546 | Ga0070696_100051746 | Ga0070696_1000517462 | 102 |
| 85 | 3300005546 | Ga0070696_100152900 | Ga0070696_1001529002 | 102 |
| 86 | 3300005547 | Ga0070693_100304730 | Ga0070693_1003047302 | 102 |
| 87 | 3300005549 | Ga0070704_100484632 | Ga0070704_1004846322 | 102 |
| 88 | 3300005549 | Ga0070704_101857552 | Ga0070704_1018575522 | 102 |
| 89 | 3300005563 | Ga0068855_100061976 | Ga0068855_1000619764 | 102 |
| 90 | 3300005563 | Ga0068855_100196573 | Ga0068855_1001965732 | 102 |
| 91 | 3300005564 | Ga0070664_100515033 | Ga0070664_1005150332 | 102 |
| 92 | 3300005577 | Ga0068857_100209883 | Ga0068857_1002098832 | 102 |
| 93 | 3300005578 | Ga0068854_100822411 | Ga0068854_1008224112 | 102 |
| 94 | 3300005614 | Ga0068856_100594580 | Ga0068856_1005945802 | 102 |
| 95 | 3300005614 | Ga0068856_102152971 | Ga0068856_1021529712 | 102 |
| 96 | 3300005615 | Ga0070702_100000858 | Ga0070702_1000008584 | 102 |
| 97 | 3300005615 | Ga0070702_100209480 | Ga0070702_1002094802 | 102 |
| 98 | 3300005616 | Ga0068852_100270489 | Ga0068852_1002704893 | 102 |
| 99 | 3300005617 | Ga0068859_100136457 | Ga0068859_1001364573 | 102 |
| 100 | 3300005617 | Ga0068859_101383019 | Ga0068859_1013830192 | 102 |
| 101 | 3300005617 | Ga0068859_102541138 | Ga0068859_1025411382 | 102 |
| 102 | 3300005618 | Ga0068864_100085546 | Ga0068864_1000855462 | 102 |
| 103 | 3300005618 | Ga0068864_100449834 | Ga0068864_1004498342 | 102 |
| 104 | 3300005618 | Ga0068864_101832883 | Ga0068864_1018328831 | 102 |
| 105 | 3300005718 | Ga0068866_10011953 | Ga0068866_100119535 | 102 |
| 106 | 3300005718 | Ga0068866_10590356 | Ga0068866_105903561 | 102 |
| 107 | 3300005719 | Ga0068861_100000970 | Ga0068861_10000097014 | 102 |
| 108 | 3300005841 | Ga0068863_100918840 | Ga0068863_1009188402 | 102 |
| 109 | 3300005841 | Ga0068863_101136842 | Ga0068863_1011368422 | 102 |
| 110 | 3300005841 | Ga0068863_101156160 | Ga0068863_1011561602 | 102 |
| 111 | 3300005842 | Ga0068858_100003501 | Ga0068858_10000350113 | 102 |
| 112 | 3300005842 | Ga0068858_100326529 | Ga0068858_1003265292 | 102 |
| 113 | 3300005842 | Ga0068858_101444853 | Ga0068858_1014448532 | 102 |
| 114 | 3300005843 | Ga0068860_100071474 | Ga0068860_1000714743 | 102 |
| 115 | 3300005844 | Ga0068862_100067035 | Ga0068862_1000670354 | 102 |
| 116 | 3300005844 | Ga0068862_100797493 | Ga0068862_1007974932 | 102 |
| 117 | 3300005983 | Ga0081540_1002454 | Ga0081540_100245415 | 102 |
| 118 | 3300006028 | Ga0070717_11123402 | Ga0070717_111234022 | 102 |
| 119 | 3300006051 | Ga0075364_10343229 | Ga0075364_103432293 | 102 |
| 120 | 3300006175 | Ga0070712_100015173 | Ga0070712_1000151733 | 102 |
| 121 | 3300006175 | Ga0070712_100053269 | Ga0070712_1000532695 | 102 |
| 122 | 3300006175 | Ga0070712_101112952 | Ga0070712_1011129521 | 102 |
| 123 | 3300006177 | Ga0075362_10174185 | Ga0075362_101741852 | 102 |
| 124 | 3300006178 | Ga0075367_10998108 | Ga0075367_109981082 | 102 |
| 125 | 3300006195 | Ga0075366_10571032 | Ga0075366_105710321 | 102 |
| 126 | 3300006237 | Ga0097621_100284961 | Ga0097621_1002849612 | 102 |
| 127 | 3300006237 | Ga0097621_100389064 | Ga0097621_1003890642 | 102 |
| 128 | 3300006237 | Ga0097621_102058044 | Ga0097621_1020580442 | 102 |
| 129 | 3300006237 | Ga0097621_102113908 | Ga0097621_1021139081 | 102 |
| 130 | 3300006358 | Ga0068871_100011124 | Ga0068871_1000111245 | 102 |
| 131 | 3300006358 | Ga0068871_101516112 | Ga0068871_1015161122 | 102 |
| 132 | 3300006358 | Ga0068871_102054757 | Ga0068871_1020547571 | 102 |
| 133 | 3300006846 | Ga0075430_100499300 | Ga0075430_1004993001 | 102 |
| 134 | 3300006847 | Ga0075431_100009631 | Ga0075431_1000096318 | 102 |
| 135 | 3300006847 | Ga0075431_101709542 | Ga0075431_1017095421 | 102 |
| 136 | 3300006880 | Ga0075429_100173164 | Ga0075429_1001731642 | 102 |
| 137 | 3300006881 | Ga0068865_100001909 | Ga0068865_1000019098 | 102 |
| 138 | 3300006881 | Ga0068865_100083928 | Ga0068865_1000839282 | 102 |
| 139 | 3300006881 | Ga0068865_100354806 | Ga0068865_1003548062 | 102 |
| 140 | 3300006914 | Ga0075436_100013013 | Ga0075436_1000130132 | 102 |
| 141 | 3300006931 | Ga0097620_100136446 | Ga0097620_1001364463 | 102 |
| 142 | 3300006931 | Ga0097620_101382918 | Ga0097620_1013829182 | 102 |
| 143 | 3300006931 | Ga0097620_102540740 | Ga0097620_1025407402 | 102 |
| 144 | 3300007076 | Ga0075435_101402723 | Ga0075435_1014027231 | 102 |
| 145 | 3300007788 | Ga0099795_10187285 | Ga0099795_101872853 | 102 |
| 146 | 3300009093 | Ga0105240_10479713 | Ga0105240_104797132 | 102 |
| 147 | 3300009093 | Ga0105240_12469236 | Ga0105240_124692362 | 102 |
| 148 | 3300009094 | Ga0111539_10106621 | Ga0111539_101066212 | 102 |
| 149 | 3300009094 | Ga0111539_10499426 | Ga0111539_104994262 | 102 |
| 150 | 3300009098 | Ga0105245_10086056 | Ga0105245_100860561 | 102 |
| 151 | 3300009098 | Ga0105245_10824033 | Ga0105245_108240333 | 102 |
| 152 | 3300009098 | Ga0105245_10851498 | Ga0105245_108514981 | 102 |
| 153 | 3300009101 | Ga0105247_10146728 | Ga0105247_101467282 | 102 |
| 154 | 3300009101 | Ga0105247_11646089 | Ga0105247_116460892 | 102 |
| 155 | 3300009147 | Ga0114129_10009531 | Ga0114129_100095316 | 102 |
| 156 | 3300009148 | Ga0105243_10000798 | Ga0105243_100007983 | 102 |
| 157 | 3300009148 | Ga0105243_10076343 | Ga0105243_100763433 | 102 |
| 158 | 3300009148 | Ga0105243_10163804 | Ga0105243_101638043 | 102 |
| 159 | 3300009174 | Ga0105241_10026169 | Ga0105241_100261697 | 102 |
| 160 | 3300009174 | Ga0105241_10530014 | Ga0105241_105300141 | 102 |
| 161 | 3300009176 | Ga0105242_11284471 | Ga0105242_112844711 | 102 |
| 162 | 3300009176 | Ga0105242_12243808 | Ga0105242_122438082 | 102 |
| 163 | 3300009177 | Ga0105248_12297976 | Ga0105248_122979762 | 102 |
| 164 | 3300009545 | Ga0105237_10010747 | Ga0105237_1001074712 | 102 |
| 165 | 3300009551 | Ga0105238_11403876 | Ga0105238_114038762 | 102 |
| 166 | 3300009551 | Ga0105238_11789444 | Ga0105238_117894441 | 102 |
| 167 | 3300009551 | Ga0105238_12252356 | Ga0105238_122523562 | 102 |
| 168 | 3300009551 | Ga0105238_13054594 | Ga0105238_130545941 | 102 |
| 169 | 3300009553 | Ga0105249_10065598 | Ga0105249_100655983 | 102 |
| 170 | 3300009553 | Ga0105249_10152804 | Ga0105249_101528042 | 102 |
| 171 | 3300009553 | Ga0105249_10209136 | Ga0105249_102091362 | 102 |
| 172 | 3300009553 | Ga0105249_12958189 | Ga0105249_129581891 | 102 |
| 173 | 3300010159 | Ga0099796_10346470 | Ga0099796_103464701 | 102 |
| 174 | 3300010375 | Ga0105239_10020365 | Ga0105239_100203651 | 102 |
| 175 | 3300011119 | Ga0105246_12302807 | Ga0105246_123028071 | 102 |
| 176 | 3300013104 | Ga0157370_10133767 | Ga0157370_101337672 | 102 |
| 177 | 3300013105 | Ga0157369_10661686 | Ga0157369_106616862 | 102 |
| 178 | 3300013296 | Ga0157374_10206574 | Ga0157374_102065742 | 102 |
| 179 | 3300013296 | Ga0157374_11536562 | Ga0157374_115365622 | 102 |
| 180 | 3300013297 | Ga0157378_10033692 | Ga0157378_100336924 | 102 |
| 181 | 3300013297 | Ga0157378_10116146 | Ga0157378_101161462 | 102 |
| 182 | 3300013297 | Ga0157378_11588033 | Ga0157378_115880331 | 102 |
| 183 | 3300013297 | Ga0157378_13271092 | Ga0157378_132710922 | 102 |
| 184 | 3300013308 | Ga0157375_10351789 | Ga0157375_103517892 | 102 |
| 185 | 3300013308 | Ga0157375_10352605 | Ga0157375_103526052 | 102 |
| 186 | 3300013308 | Ga0157375_10677541 | Ga0157375_106775412 | 102 |
| 187 | 3300013308 | Ga0157375_12355034 | Ga0157375_123550341 | 102 |
| 188 | 3300014325 | Ga0163163_10065474 | Ga0163163_100654744 | 102 |
| 189 | 3300014326 | Ga0157380_10011865 | Ga0157380_100118653 | 102 |
| 190 | 3300014326 | Ga0157380_10208955 | Ga0157380_102089552 | 102 |
| 191 | 3300014326 | Ga0157380_11100612 | Ga0157380_111006121 | 102 |
| 192 | 3300014968 | Ga0157379_10379899 | Ga0157379_103798992 | 102 |
| 193 | 3300014968 | Ga0157379_10753769 | Ga0157379_107537692 | 102 |
| 194 | 3300014968 | Ga0157379_12374768 | Ga0157379_123747681 | 102 |
| 195 | 3300014969 | Ga0157376_10508675 | Ga0157376_105086752 | 102 |
| 196 | 3300014969 | Ga0157376_10544109 | Ga0157376_105441092 | 102 |
| 197 | 3300014969 | Ga0157376_11358321 | Ga0157376_113583211 | 102 |
| 198 | 3300019182 | Ga0184598_106064 | Ga0184598_1060641 | 102 |
| 199 | 3300020078 | Ga0206352_11112191 | Ga0206352_111121911 | 102 |
| 200 | 3300021358 | Ga0213873_10018038 | Ga0213873_100180382 | 102 |
| 201 | 3300021358 | Ga0213873_10039401 | Ga0213873_100394011 | 102 |
| 202 | 3300021377 | Ga0213874_10031653 | Ga0213874_100316533 | 102 |
| 203 | 3300021377 | Ga0213874_10144217 | Ga0213874_101442171 | 102 |
| 204 | 3300021377 | Ga0213874_10150170 | Ga0213874_101501702 | 102 |
| 205 | 3300021384 | Ga0213876_10101737 | Ga0213876_101017371 | 102 |
| 206 | 3300021388 | Ga0213875_10001235 | Ga0213875_1000123517 | 102 |
| 207 | 3300021388 | Ga0213875_10032984 | Ga0213875_100329843 | 102 |
| 208 | 3300021441 | Ga0213871_10001506 | Ga0213871_100015062 | 102 |
| 209 | 3300021441 | Ga0213871_10089449 | Ga0213871_100894491 | 102 |
| 210 | 3300025321 | Ga0207656_10283949 | Ga0207656_102839492 | 102 |
| 211 | 3300025898 | Ga0207692_10064779 | Ga0207692_100647794 | 102 |
| 212 | 3300025898 | Ga0207692_10812775 | Ga0207692_108127751 | 102 |
| 213 | 3300025899 | Ga0207642_10224200 | Ga0207642_102242001 | 102 |
| 214 | 3300025899 | Ga0207642_10949769 | Ga0207642_109497691 | 102 |
| 215 | 3300025903 | Ga0207680_10818252 | Ga0207680_108182521 | 102 |
| 216 | 3300025906 | Ga0207699_10297498 | Ga0207699_102974983 | 102 |
| 217 | 3300025907 | Ga0207645_10915201 | Ga0207645_109152012 | 102 |
| 218 | 3300025910 | Ga0207684_10116738 | Ga0207684_101167382 | 102 |
| 219 | 3300025910 | Ga0207684_10983503 | Ga0207684_109835031 | 102 |
| 220 | 3300025911 | Ga0207654_10451521 | Ga0207654_104515212 | 102 |
| 221 | 3300025911 | Ga0207654_10601254 | Ga0207654_106012542 | 102 |
| 222 | 3300025912 | Ga0207707_10032701 | Ga0207707_100327014 | 102 |
| 223 | 3300025912 | Ga0207707_10043419 | Ga0207707_100434192 | 102 |
| 224 | 3300025914 | Ga0207671_10008421 | Ga0207671_100084213 | 102 |
| 225 | 3300025915 | Ga0207693_10016096 | Ga0207693_100160962 | 102 |
| 226 | 3300025915 | Ga0207693_10117448 | Ga0207693_101174482 | 102 |
| 227 | 3300025915 | Ga0207693_10149245 | Ga0207693_101492451 | 102 |
| 228 | 3300025915 | Ga0207693_11355721 | Ga0207693_113557211 | 102 |
| 229 | 3300025916 | Ga0207663_10151918 | Ga0207663_101519182 | 102 |
| 230 | 3300025916 | Ga0207663_10202992 | Ga0207663_102029923 | 102 |
| 231 | 3300025916 | Ga0207663_10302263 | Ga0207663_103022632 | 102 |
| 232 | 3300025916 | Ga0207663_10827514 | Ga0207663_108275142 | 102 |
| 233 | 3300025916 | Ga0207663_11148041 | Ga0207663_111480412 | 102 |
| 234 | 3300025916 | Ga0207663_11223571 | Ga0207663_112235712 | 102 |
| 235 | 3300025916 | Ga0207663_11274445 | Ga0207663_112744452 | 102 |
| 236 | 3300025917 | Ga0207660_10065468 | Ga0207660_100654682 | 102 |
| 237 | 3300025917 | Ga0207660_10101686 | Ga0207660_101016862 | 102 |
| 238 | 3300025917 | Ga0207660_10402854 | Ga0207660_104028542 | 102 |
| 239 | 3300025917 | Ga0207660_11377510 | Ga0207660_113775101 | 102 |
| 240 | 3300025920 | Ga0207649_11512545 | Ga0207649_115125451 | 102 |
| 241 | 3300025921 | Ga0207652_10098023 | Ga0207652_100980231 | 102 |
| 242 | 3300025921 | Ga0207652_10439114 | Ga0207652_104391142 | 102 |
| 243 | 3300025924 | Ga0207694_11124135 | Ga0207694_111241351 | 102 |
| 244 | 3300025925 | Ga0207650_10156470 | Ga0207650_101564702 | 102 |
| 245 | 3300025925 | Ga0207650_10963142 | Ga0207650_109631421 | 102 |
| 246 | 3300025926 | Ga0207659_10075794 | Ga0207659_100757942 | 102 |
| 247 | 3300025927 | Ga0207687_11373299 | Ga0207687_113732992 | 102 |
| 248 | 3300025929 | Ga0207664_10674862 | Ga0207664_106748622 | 102 |
| 249 | 3300025929 | Ga0207664_11227401 | Ga0207664_112274011 | 102 |
| 250 | 3300025931 | Ga0207644_10092689 | Ga0207644_100926892 | 102 |
| 251 | 3300025931 | Ga0207644_11662562 | Ga0207644_116625622 | 102 |
| 252 | 3300025932 | Ga0207690_10719758 | Ga0207690_107197582 | 102 |
| 253 | 3300025933 | Ga0207706_11586254 | Ga0207706_115862541 | 102 |
| 254 | 3300025934 | Ga0207686_10418640 | Ga0207686_104186401 | 102 |
| 255 | 3300025935 | Ga0207709_10246708 | Ga0207709_102467082 | 102 |
| 256 | 3300025935 | Ga0207709_10530816 | Ga0207709_105308162 | 102 |
| 257 | 3300025936 | Ga0207670_10068307 | Ga0207670_100683072 | 102 |
| 258 | 3300025936 | Ga0207670_10099149 | Ga0207670_100991493 | 102 |
| 259 | 3300025938 | Ga0207704_10007957 | Ga0207704_100079576 | 102 |
| 260 | 3300025938 | Ga0207704_11239602 | Ga0207704_112396022 | 102 |
| 261 | 3300025938 | Ga0207704_11618810 | Ga0207704_116188102 | 102 |
| 262 | 3300025939 | Ga0207665_10220191 | Ga0207665_102201914 | 102 |
| 263 | 3300025939 | Ga0207665_11190566 | Ga0207665_111905661 | 102 |
| 264 | 3300025940 | Ga0207691_10016784 | Ga0207691_100167845 | 102 |
| 265 | 3300025940 | Ga0207691_10495091 | Ga0207691_104950912 | 102 |
| 266 | 3300025941 | Ga0207711_10462294 | Ga0207711_104622942 | 102 |
| 267 | 3300025942 | Ga0207689_10007096 | Ga0207689_100070963 | 102 |
| 268 | 3300025942 | Ga0207689_11607810 | Ga0207689_116078101 | 102 |
| 269 | 3300025945 | Ga0207679_11095785 | Ga0207679_110957852 | 102 |
| 270 | 3300025949 | Ga0207667_10155971 | Ga0207667_101559712 | 102 |
| 271 | 3300025949 | Ga0207667_10165527 | Ga0207667_101655273 | 102 |
| 272 | 3300025961 | Ga0207712_10102079 | Ga0207712_101020792 | 102 |
| 273 | 3300025961 | Ga0207712_10211133 | Ga0207712_102111331 | 102 |
| 274 | 3300025972 | Ga0207668_11120638 | Ga0207668_111206382 | 102 |
| 275 | 3300025981 | Ga0207640_11733468 | Ga0207640_117334682 | 102 |
| 276 | 3300025986 | Ga0207658_10642459 | Ga0207658_106424592 | 102 |
| 277 | 3300026023 | Ga0207677_10098748 | Ga0207677_100987483 | 102 |
| 278 | 3300026035 | Ga0207703_10028240 | Ga0207703_100282403 | 102 |
| 279 | 3300026035 | Ga0207703_10327836 | Ga0207703_103278362 | 102 |
| 280 | 3300026035 | Ga0207703_11023803 | Ga0207703_110238032 | 102 |
| 281 | 3300026041 | Ga0207639_11881426 | Ga0207639_118814261 | 102 |
| 282 | 3300026067 | Ga0207678_10109137 | Ga0207678_101091373 | 102 |
| 283 | 3300026075 | Ga0207708_10000385 | Ga0207708_1000038522 | 102 |
| 284 | 3300026075 | Ga0207708_10008430 | Ga0207708_100084301 | 102 |
| 285 | 3300026089 | Ga0207648_10001978 | Ga0207648_100019787 | 102 |
| 286 | 3300026089 | Ga0207648_10060508 | Ga0207648_100605082 | 102 |
| 287 | 3300026095 | Ga0207676_10354265 | Ga0207676_103542652 | 102 |
| 288 | 3300026095 | Ga0207676_11711001 | Ga0207676_117110012 | 102 |
| 289 | 3300026116 | Ga0207674_10028785 | Ga0207674_100287858 | 102 |
| 290 | 3300026118 | Ga0207675_100002060 | Ga0207675_1000020607 | 102 |
| 291 | 3300026121 | Ga0207683_10013001 | Ga0207683_100130016 | 102 |
| 292 | 3300028380 | Ga0268265_10471976 | Ga0268265_104719762 | 102 |
| 293 | 3300028380 | Ga0268265_10827495 | Ga0268265_108274952 | 102 |
| 294 | 3300028381 | Ga0268264_10429820 | Ga0268264_104298202 | 102 |
| 295 | 3300028381 | Ga0268264_11299359 | Ga0268264_112993591 | 102 |
| 296 | 3300031901 | Ga0307406_11866069 | Ga0307406_118660691 | 102 |
| 297 | 3300035089 | Ga0373944_0157818 | Ga0373944_0157818_305_613 | 102 |
| 298 | 3300035111 | Ga0373923_0675048 | Ga0373923_0675048_133_444 | 102 |
| 299 | 3300035116 | Ga0373945_0093255 | Ga0373945_0093255_623_931 | 102 |
| 300 | 3300035116 | Ga0373945_0438786 | Ga0373945_0438786_202_513 | 102 |
| 301 | 3300035117 | Ga0373953_0236777 | Ga0373953_0236777_137_445 | 102 |
| 302 | 3300035119 | Ga0373956_0243967 | Ga0373956_0243967_532_840 | 102 |
| 303 | 3300035171 | Ga0373946_0285514 | Ga0373946_0285514_282_590 | 102 |
| 304 | 3300035691 | Ga0373931_0093659 | Ga0373931_0093659_520_828 | 102 |
| 305 | 3300035692 | Ga0373935_0099844 | Ga0373935_0099844_1119_1427 | 102 |
| 306 | 3300035695 | Ga0373927_0058330 | Ga0373927_0058330_1418_1726 | 102 |
| 307 | 3300035695 | Ga0373927_0099278 | Ga0373927_0099278_560_868 | 102 |
| 308 | 3300035695 | Ga0373927_0215799 | Ga0373927_0215799_405_737 | 102 |
| 309 | 3300035725 | Ga0373947_0468244 | Ga0373947_0468244_296_607 | 102 |
| 310 | 3300036401 | Ga0373937_0081098 | Ga0373937_0081098_2276_2584 | 102 |
| 311 | 3300037068 | Ga0373925_0487022 | Ga0373925_0487022_124_432 | 102 |
| 312 | 3300037068 | Ga0373925_1297524 | Ga0373925_1297524_104_412 | 102 |
| 313 | 3300037471 | Ga0395905_0104749 | Ga0395905_0104749_1527_1838 | 102 |
| 314 | 3300037853 | Ga0436364_0905998 | Ga0436364_0905998_118_432 | 102 |
| 315 | 3300037853 | Ga0436364_1420692 | Ga0436364_1420692_6931_7239 | 102 |
| 316 | 3300039437 | Ga0436365_0310730 | Ga0436365_0310730_30_338 | 102 |
| 317 | 3300039437 | Ga0436365_0383665 | Ga0436365_0383665_264_572 | 102 |
| 318 | 3300039437 | Ga0436365_1360801 | Ga0436365_1360801_396_704 | 102 |
| 319 | 3300039438 | Ga0436360_0125134 | Ga0436360_0125134_162_470 | 102 |
| 320 | 3300039438 | Ga0436360_0153426 | Ga0436360_0153426_220_528 | 102 |
| 321 | 3300039438 | Ga0436360_0203368 | Ga0436360_0203368_104_415 | 102 |
| 322 | 3300039438 | Ga0436360_0442223 | Ga0436360_0442223_864_1172 | 102 |
| 323 | 3300039438 | Ga0436360_0653311 | Ga0436360_0653311_584_892 | 102 |
| 324 | 3300039438 | Ga0436360_0664960 | Ga0436360_0664960_68_376 | 102 |
| 325 | 3300039438 | Ga0436360_0705024 | Ga0436360_0705024_202_510 | 102 |
| 326 | 3300039438 | Ga0436360_0761125 | Ga0436360_0761125_13_324 | 102 |
| 327 | 3300039438 | Ga0436360_1135695 | Ga0436360_1135695_232_540 | 102 |
| 328 | 3300039438 | Ga0436360_1198800 | Ga0436360_1198800_297_605 | 102 |
| 329 | 3300039438 | Ga0436360_1302070 | Ga0436360_1302070_590_898 | 102 |
| 330 | 3300039447 | Ga0436361_0144311 | Ga0436361_0144311_197_505 | 102 |
| 331 | 3300039447 | Ga0436361_0295633 | Ga0436361_0295633_2264_2572 | 102 |
| 332 | 3300039447 | Ga0436361_0534918 | Ga0436361_0534918_406_714 | 102 |
| 333 | 3300039450 | Ga0436363_0002125 | Ga0436363_0002125_10715_11023 | 102 |
| 334 | 3300039450 | Ga0436363_0432638 | Ga0436363_0432638_333_641 | 102 |
| 335 | 3300039450 | Ga0436363_0565357 | Ga0436363_0565357_334_642 | 102 |
| 336 | 3300039450 | Ga0436363_0796440 | Ga0436363_0796440_194_502 | 102 |
| 337 | 3300039450 | Ga0436363_1392544 | Ga0436363_1392544_1047_1355 | 102 |
| 338 | 3300039450 | Ga0436363_1680540 | Ga0436363_1680540_769_1077 | 102 |
| 339 | 3300039453 | Ga0436362_0747529 | Ga0436362_0747529_229_537 | 102 |
| 340 | 3300039453 | Ga0436362_1094717 | Ga0436362_1094717_172_480 | 102 |
| 341 | 3300039453 | Ga0436362_1176420 | Ga0436362_1176420_42_350 | 102 |
| 342 | 3300039453 | Ga0436362_1289551 | Ga0436362_1289551_592_900 | 102 |
| 343 | 3300041512 | Ga0451853_1169942 | Ga0451853_1169942_73_381 | 102 |
| 344 | 3300042157 | Ga0439458_0226651 | Ga0439458_0226651_29_337 | 102 |
| 345 | 3300044694 | Ga0466963_0844687 | Ga0466963_0844687_62_370 | 102 |
| 346 | 3300044842 | Ga0466957_0665163 | Ga0466957_0665163_387_695 | 102 |
| 347 | 3300045836 | Ga0466958_1020831 | Ga0466958_1020831_129_437 | 102 |
| 348 | 3300045976 | Ga0466967_0925519 | Ga0466967_0925519_417_725 | 102 |
| 349 | 3300045976 | Ga0466967_2040951 | Ga0466967_2040951_233_544 | 102 |
| 350 | 3300046462 | Ga0495651_0252154 | Ga0495651_0252154_383_691 | 102 |
| 351 | 3300046472 | Ga0495580_0087633 | Ga0495580_0087633_1519_1827 | 102 |
| 352 | 3300046473 | Ga0495582_0283198 | Ga0495582_0283198_414_722 | 102 |
| 353 | 3300046514 | Ga0495618_0571481 | Ga0495618_0571481_352_660 | 102 |
| 354 | 3300046533 | Ga0495640_0148923 | Ga0495640_0148923_1078_1386 | 102 |
| 355 | 3300046533 | Ga0495640_0286743 | Ga0495640_0286743_44_352 | 102 |
| 356 | 3300046533 | Ga0495640_0640402 | Ga0495640_0640402_138_446 | 102 |
| 357 | 3300046535 | Ga0495586_0316995 | Ga0495586_0316995_558_866 | 102 |
| 358 | 3300046559 | Ga0495667_0836513 | Ga0495667_0836513_157_468 | 102 |
| 359 | 3300046663 | Ga0495635_0326604 | Ga0495635_0326604_633_941 | 102 |
| 360 | 3300046675 | Ga0495657_0216121 | Ga0495657_0216121_144_452 | 102 |
| 361 | 3300046681 | Ga0495647_0058579 | Ga0495647_0058579_366_674 | 102 |
| 362 | 3300046683 | Ga0495658_0032958 | Ga0495658_0032958_1941_2249 | 102 |
| 363 | 3300046683 | Ga0495658_0756348 | Ga0495658_0756348_103_411 | 102 |
| 364 | 3300046689 | Ga0495613_0193872 | Ga0495613_0193872_766_1074 | 102 |
| 365 | 3300047317 | Ga0495604_0491817 | Ga0495604_0491817_185_493 | 102 |
| 366 | 3300047444 | Ga0495675_0800181 | Ga0495675_0800181_132_443 | 102 |
| 367 | 3300047471 | Ga0495684_0402753 | Ga0495684_0402753_144_452 | 102 |
| 368 | 3300048088 | Ga0495602_0764245 | Ga0495602_0764245_128_436 | 102 |
| 369 | 3300048903 | Ga0496100_0081120 | Ga0496100_0081120_1629_1937 | 102 |
| 370 | 3300048904 | Ga0496101_1492597 | Ga0496101_1492597_148_459 | 102 |
| 371 | 3300048905 | Ga0496102_0217965 | Ga0496102_0217965_156_464 | 102 |
| 372 | 3300048905 | Ga0496102_0513405 | Ga0496102_0513405_70_381 | 102 |
| 373 | 3300048907 | Ga0496104_0006459 | Ga0496104_0006459_9352_9660 | 102 |
| 374 | 3300048907 | Ga0496104_0701378 | Ga0496104_0701378_95_403 | 102 |
| 375 | 3300048908 | Ga0496105_0069294 | Ga0496105_0069294_2164_2472 | 102 |
| 376 | 3300048909 | Ga0496106_0139670 | Ga0496106_0139670_201_509 | 102 |
| 377 | 3300048911 | Ga0496108_0359101 | Ga0496108_0359101_161_469 | 102 |
| 378 | 3300048912 | Ga0496109_0018529 | Ga0496109_0018529_130_438 | 102 |
| 379 | 3300048912 | Ga0496109_0518510 | Ga0496109_0518510_453_761 | 102 |
| 380 | 3300048913 | Ga0496110_0041716 | Ga0496110_0041716_1274_1582 | 102 |
| 381 | 3300048913 | Ga0496110_0098138 | Ga0496110_0098138_203_511 | 102 |
| 382 | 3300048914 | Ga0496111_0141286 | Ga0496111_0141286_61_369 | 102 |
| 383 | 3300048914 | Ga0496111_1285925 | Ga0496111_1285925_38_346 | 102 |
| 384 | 3300048915 | Ga0496112_0092482 | Ga0496112_0092482_80_388 | 102 |
| 385 | 3300048916 | Ga0496113_0121716 | Ga0496113_0121716_1382_1690 | 102 |
| 386 | 3300048917 | Ga0496114_0073625 | Ga0496114_0073625_532_840 | 102 |
| 387 | 3300048918 | Ga0496115_0007003 | Ga0496115_0007003_7939_8247 | 102 |
| 388 | 3300048929 | Ga0496126_0840948 | Ga0496126_0840948_37_345 | 102 |
| 389 | 3300049570 | Ga0501033_0871761 | Ga0501033_0871761_112_420 | 102 |
| 390 | 3300049572 | Ga0501036_0286339 | Ga0501036_0286339_188_499 | 102 |
| 391 | 3300049575 | Ga0501039_0089840 | Ga0501039_0089840_1188_1496 | 102 |
| 392 | 3300049575 | Ga0501039_0368255 | Ga0501039_0368255_661_972 | 102 |
| 393 | 3300049578 | Ga0501042_1221532 | Ga0501042_1221532_161_469 | 102 |
| 394 | 3300049581 | Ga0501047_1013695 | Ga0501047_1013695_194_505 | 102 |
| 395 | 3300049582 | Ga0501048_0266301 | Ga0501048_0266301_697_1005 | 102 |
| 396 | 3300049585 | Ga0501069_0235272 | Ga0501069_0235272_183_491 | 102 |
| 397 | 3300049586 | Ga0501070_1376343 | Ga0501070_1376343_169_480 | 102 |
| 398 | 3300049589 | Ga0501073_0635609 | Ga0501073_0635609_311_622 | 102 |
| 399 | 3300049592 | Ga0501076_1156999 | Ga0501076_1156999_281_589 | 102 |
| 400 | 3300049593 | Ga0501077_0938398 | Ga0501077_0938398_57_365 | 102 |
| 401 | 3300049741 | Ga0501079_0184672 | Ga0501079_0184672_1244_1552 | 102 |
| 402 | 3300049742 | Ga0501080_1144337 | Ga0501080_1144337_94_405 | 102 |
| 403 | 3300049743 | Ga0501081_1116873 | Ga0501081_1116873_67_375 | 102 |
| 404 | 3300049744 | Ga0501083_0031412 | Ga0501083_0031412_3158_3466 | 102 |
| 405 | 3300049823 | Ga0501044_0113264 | Ga0501044_0113264_941_1252 | 102 |
| 406 | 3300049824 | Ga0501045_0987646 | Ga0501045_0987646_72_380 | 102 |
| 407 | 3300050489 | nmdc:mga03683_342361_c1 | nmdc:mga03683_342361_c1_285_593 | 102 |
| 408 | 3300050491 | nmdc:mga00v17_792856_c1 | nmdc:mga00v17_792856_c1_112_420 | 102 |
| 409 | 3300050492 | nmdc:mga0yw44_340444_c1 | nmdc:mga0yw44_340444_c1_651_959 | 102 |
| 410 | 3300050492 | nmdc:mga0yw44_407167_c1 | nmdc:mga0yw44_407167_c1_498_806 | 102 |
| 411 | 3300050493 | nmdc:mga0k408_346249_c1 | nmdc:mga0k408_346249_c1_46_354 | 102 |
| 412 | 3300050494 | nmdc:mga06z11_602593_c1 | nmdc:mga06z11_602593_c1_264_572 | 102 |
| 413 | 3300050507 | nmdc:mga05p37_48828_c1 | nmdc:mga05p37_48828_c1_2212_2520 | 102 |
| 414 | 3300050508 | nmdc:mga09592_36296_c1 | nmdc:mga09592_36296_c1_1263_1571 | 102 |
| 415 | 3300050509 | nmdc:mga0qj67_655731_c1 | nmdc:mga0qj67_655731_c1_197_505 | 102 |
| 416 | 3300050510 | nmdc:mga06r32_72497_c1 | nmdc:mga06r32_72497_c1_751_1059 | 102 |
| 417 | 3300050511 | nmdc:mga08y16_119835_c1 | nmdc:mga08y16_119835_c1_229_537 | 102 |
| 418 | 3300050512 | nmdc:mga0n895_1672357_c1 | nmdc:mga0n895_1672357_c1_66_374 | 102 |
| 419 | 3300050513 | nmdc:mga0rr50_1721835_c1 | nmdc:mga0rr50_1721835_c1_179_487 | 102 |
| 420 | 3300050514 | nmdc:mga08x19_15244_c1 | nmdc:mga08x19_15244_c1_1562_1927 | 102 |
| 421 | 3300053077 | Ga0495601_0147733 | Ga0495601_0147733_371_679 | 102 |
| 422 | 3300053077 | Ga0495601_0355080 | Ga0495601_0355080_210_518 | 102 |
| 423 | 3300053078 | Ga0495612_0062710 | Ga0495612_0062710_979_1287 | 102 |
| 424 | 3300053078 | Ga0495612_0438204 | Ga0495612_0438204_239_571 | 102 |
| 425 | 3300053085 | Ga0495619_0018080 | Ga0495619_0018080_2227_2535 | 102 |
| 426 | 3300053085 | Ga0495619_0256695 | Ga0495619_0256695_54_362 | 102 |
| 427 | 3300053085 | Ga0495619_0567372 | Ga0495619_0567372_362_670 | 102 |
| 428 | 3300054114 | Ga0501084_0490061 | Ga0501084_0490061_148_456 | 102 |
| 429 | 3300054114 | Ga0501084_0531860 | Ga0501084_0531860_17_328 | 102 |
| 430 | 3300054114 | Ga0501084_0779482 | Ga0501084_0779482_241_549 | 102 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1r6y-assembly1.cif.gz_A | crystal structure of ygin from escherichia coli | 0.937 | 1 | 102 |
| 1r6y-assembly1.cif.gz_A | crystal structure of ygin from escherichia coli | 0.9283 | 1 | 102 |
| 4dpo-assembly1.cif.gz_B | crystal structure of a conserved protein mm_1583 from methanosarcina mazei go1 | 0.9076 | 2 | 102 |
| 2omo-assembly4.cif.gz_E | putative antibiotic biosynthesis monooxygenase from nitrosomonas europaea | 0.9071 | 1 | 102 |
| 4zos-assembly2.cif.gz_B | 2.20 angstrom resolution crystal structure of protein ye0340 of unidentified function from yersinia enterocolitica subsp. enterocolitica 8081] | 0.9034 | 2 | 102 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1tuvA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.939 | 1 | 102 | 3.30.70.100 |
| 1tuvA00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9303 | 1 | 102 | 3.30.70.100 |
| af_O33291_1_95_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9155 | 2 | 102 | 3.30.70.100 |
| af_Q55CR9_1_97_3.30.70.100 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9034 | 2 | 102 | 3.30.70.100 |
| 4zosB00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9034 | 2 | 102 | 3.30.70.100 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D7EFC9-F1-model_v4 | deleted | 0.9929 | 1 | 102 |
|
| AF-A0A0P7YDZ5-F1-model_v4 | ABM domain-containing protein | 0.9891 | 1 | 102 |
GO:0005829
GO:0016491 |
| AF-A0A3E0NDG9-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9879 | 1 | 102 |
GO:0004497
|
| AF-A0A2D9JRY0-F1-model_v4 | Antibiotic biosynthesis monooxygenase | 0.9865 | 1 | 102 |
GO:0004497
GO:0005829 |
| AF-A0A7C7NDH3-F1-model_v4 | deleted | 0.9859 | 1 | 102 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar