F442117

General Info

Members Datasets Scaffolds Average Seq Length
430 294 860 403

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10020785|Ga0105251_100207852
Length 430
Sequence MEGPMSARPFPVPGRPGAPDRPATRRXXXLGAAALGVVAALTLAACGSRPSEQAATSTEPIVIGISLPLTGDFSQPGGEAKRGYEVWQKQVNDNGGLLGRQVQLKIVDDASSQDTVVSDYTKLITQDKVDLVLGTFSSLLNYPASAVAEKNQMVFVEPAGGAPNMFTRGFKYLFFAQQATAPHQADVFVNYIKTLPPDKRPKTAAYPTQDDPFAAPVIESMQKQLSALGVQTVYTQTYPADTTNFQSIASQLAAKKPDLIAQGAVFEDGVGLVRSLKQLNYSPKMLFQTSAPSNAGQYSSAVGTANTEGVFYTVSWHQDAKTPQNAEFLAGYKAAYKNADPAXXXXDAFATAQVLQTAVTKVGTIDQAKIRDWLHANEVQTILGPLSWTATGEPRGQFLLAQWQSDKVQVVGPPDLATTETIVNPKPDWK

Samples

Sample ID Description Type Environment
1 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
52 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
65 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
143 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
144 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
145 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
146 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
147 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
148 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
149 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
158 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
159 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
160 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
161 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
162 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
168 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
169 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
176 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
177 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
178 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
179 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
184 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
193 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
194 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
195 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
196 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
202 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
205 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
206 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
209 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
219 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
220 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
229 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
230 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
231 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
239 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
240 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
241 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
242 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
243 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
244 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
245 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
246 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
247 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
248 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
249 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
250 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
251 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
252 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
253 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
254 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
257 2675903059 Asanoa hainanensis CGMCC 4.5593 Isolate Rhizosphere
258 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
259 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
260 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
261 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
262 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
263 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
264 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
265 2808606394 Promicromonospora sp. C35 Isolate Unclassified
266 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
267 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
268 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
269 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
270 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
271 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
272 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
273 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
274 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
275 2867302475 Micromonospora globbae WPS1-2 Isolate Unclassified
276 2867312974 Micromonospora musae NGC1-4 Isolate Unclassified
277 2867319477 Micromonospora musae MS1-9 Isolate Unclassified
278 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
279 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
280 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
281 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
282 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
283 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
284 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
285 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
286 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
287 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
288 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
289 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
290 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
291 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
292 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
293 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere
294 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.53
Metatranscriptomes 1.4
Isolates 9.07

Biome Distribution

Category Percentage (%)
Aerial Root 0.47
Bulb 0
Endosphere 4.19
Nodule 0.7
Rhizoplane 6.74
Rhizosphere 75.58
Stem 0
Stem Tuber 0
Unclassified 1.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105251_10020785 3300009011 Bacteria 3442
2 JGI24751J29686_10004716 3300002459 Bacteria 2768
3 JGI25406J46586_10004752 3300003203 Bacteria 6315
4 JGI25406J46586_10005444 3300003203 Bacteria 5905
5 JGI25406J46586_10035024 3300003203 Bacteria 1836
6 rootH2_10036972 3300003320 Bacteria 5192
7 JGI25407J50210_10007473 3300003373 Bacteria 2739
8 Ga0070676_10010856 3300005328 Bacteria 4944
9 Ga0070676_10112136 3300005328 Bacteria 1700
10 Ga0070683_100059403 3300005329 Bacteria 3552
11 Ga0070683_100180004 3300005329 Bacteria 2006
12 Ga0070690_100028670 3300005330 Bacteria 3450
13 Ga0068869_100010113 3300005334 Bacteria 6139
14 Ga0070680_100014408 3300005336 Bacteria 6180
15 Ga0068868_100017060 3300005338 Bacteria 5403
16 Ga0068868_100133133 3300005338 Bacteria 2036
17 Ga0070689_100014471 3300005340 Bacteria 5731
18 Ga0070661_100005914 3300005344 Bacteria 8423
19 Ga0070692_10005162 3300005345 Bacteria 5530
20 Ga0070668_100000361 3300005347 Bacteria 30090
21 Ga0070669_100102542 3300005353 Bacteria 2160
22 Ga0070675_100033397 3300005354 Bacteria 4171
23 Ga0070674_100121457 3300005356 Bacteria 1934
24 Ga0070673_100008828 3300005364 Bacteria 6730
25 Ga0070709_10013923 3300005434 Bacteria 4535
26 Ga0070710_10011824 3300005437 Bacteria 4322
27 Ga0070701_10012072 3300005438 Bacteria 3883
28 Ga0070711_100018642 3300005439 Bacteria 4435
29 Ga0070700_100108157 3300005441 Bacteria 1844
30 Ga0070700_100130492 3300005441 Bacteria 1695
31 Ga0070678_100001955 3300005456 Bacteria 11120
32 Ga0068867_100054974 3300005459 Bacteria 2942
33 Ga0070685_10027053 3300005466 Bacteria 3167
34 Ga0070706_100258158 3300005467 Unclassified 1627
35 Ga0070699_100252765 3300005518 Unclassified 1575
36 Ga0070679_100043583 3300005530 Bacteria 4468
37 Ga0068853_100018552 3300005539 Bacteria 5759
38 Ga0070672_100018082 3300005543 Bacteria 5088
39 Ga0070686_100024217 3300005544 Bacteria 3637
40 Ga0070665_100013384 3300005548 Bacteria 8257
41 Ga0068855_100039088 3300005563 Bacteria 5633
42 Ga0068854_100017139 3300005578 Bacteria 4843
43 Ga0068856_100086113 3300005614 Bacteria 3122
44 Ga0068856_100103560 3300005614 Bacteria 2840
45 Ga0070702_100000868 3300005615 Bacteria 11711
46 Ga0070702_100016471 3300005615 Bacteria 3793
47 Ga0070702_100109236 3300005615 Bacteria 1711
48 Ga0070702_100130919 3300005615 Bacteria 1584
49 Ga0068864_100007828 3300005618 Bacteria 8806
50 Ga0068866_10020775 3300005718 Bacteria 3014
51 Ga0068861_100041490 3300005719 Bacteria 3447
52 Ga0068851_10001816 3300005834 Bacteria 9333
53 Ga0068851_10038388 3300005834 Bacteria 2402
54 Ga0068870_10003544 3300005840 Bacteria 6621
55 Ga0068870_10033631 3300005840 Bacteria 2618
56 Ga0068863_100019507 3300005841 Bacteria 6486
57 Ga0068863_100062078 3300005841 Bacteria 3534
58 Ga0068860_100079930 3300005843 Bacteria 3109
59 Ga0068862_100023169 3300005844 Bacteria 5199
60 Ga0081455_10017882 3300005937 Bacteria 6775
61 Ga0081538_10000210 3300005981 Bacteria 65100
62 Ga0081538_10011162 3300005981 Bacteria 7298
63 Ga0081538_10011946 3300005981 Bacteria 7001
64 Ga0081538_10051122 3300005981 Bacteria 2486
65 Ga0081538_10051605 3300005981 Bacteria 2467
66 Ga0081538_10052518 3300005981 Bacteria 2434
67 Ga0081540_1010875 3300005983 Bacteria 6112
68 Ga0081540_1023819 3300005983 Bacteria 3568
69 Ga0081539_10000031 3300005985 Bacteria 313232
70 Ga0081539_10001666 3300005985 Bacteria 35954
71 Ga0081539_10002841 3300005985 Bacteria 23101
72 Ga0081539_10007168 3300005985 Bacteria 10280
73 Ga0075364_10035929 3300006051 Bacteria 3202
74 Ga0070716_100003337 3300006173 Bacteria 7545
75 Ga0097621_100004988 3300006237 Bacteria 9306
76 Ga0075428_100144754 3300006844 Bacteria 2583
77 Ga0075428_100161968 3300006844 Bacteria 2428
78 Ga0075430_100046296 3300006846 Bacteria 3674
79 Ga0075431_100050294 3300006847 Bacteria 4297
80 Ga0075433_10016081 3300006852 Bacteria 6156
81 Ga0075429_100047119 3300006880 Bacteria 3750
82 Ga0075429_100066586 3300006880 Bacteria 3136
83 Ga0075436_100001550 3300006914 Bacteria 15696
84 Ga0075435_100140407 3300007076 Bacteria 2027
85 Ga0105240_10033487 3300009093 Bacteria 6638
86 Ga0111539_10032191 3300009094 Bacteria 6370
87 Ga0111539_10032404 3300009094 Bacteria 6345
88 Ga0105245_10034382 3300009098 Bacteria 4496
89 Ga0105245_10225258 3300009098 Bacteria 1811
90 Ga0105245_10338602 3300009098 Bacteria 1487
91 Ga0105247_10009132 3300009101 Bacteria 6033
92 Ga0114129_10299538 3300009147 Bacteria 2144
93 Ga0105243_10033880 3300009148 Bacteria 3950
94 Ga0105243_10051937 3300009148 Bacteria 3245
95 Ga0105241_10004181 3300009174 Bacteria 10655
96 Ga0105241_10159422 3300009174 Bacteria 1853
97 Ga0105242_10035349 3300009176 Bacteria 4008
98 Ga0105242_10045817 3300009176 Bacteria 3545
99 Ga0105242_10177551 3300009176 Bacteria 1877
100 Ga0105248_10100958 3300009177 Bacteria 3252
101 Ga0105237_10126423 3300009545 Bacteria 2551
102 Ga0105237_10149225 3300009545 Bacteria 2334
103 Ga0105238_10023357 3300009551 Bacteria 6304
104 Ga0105238_10157928 3300009551 Bacteria 2243
105 Ga0105239_10043877 3300010375 Bacteria 4903
106 Ga0105239_10267535 3300010375 Bacteria 1922
107 Ga0105246_10001370 3300011119 Bacteria 14367
108 Ga0157373_10012431 3300013100 Bacteria 6258
109 Ga0157371_10016463 3300013102 Bacteria 5518
110 Ga0157371_10113611 3300013102 Bacteria 1923
111 Ga0157370_10059995 3300013104 Bacteria 3613
112 Ga0157369_10051551 3300013105 Bacteria 4453
113 Ga0157369_10279263 3300013105 Bacteria 1740
114 Ga0157374_10015571 3300013296 Bacteria 6673
115 Ga0157378_10157570 3300013297 Bacteria 2121
116 Ga0157378_10273245 3300013297 Bacteria 1626
117 Ga0157375_10200537 3300013308 Bacteria 2151
118 Ga0157375_10224929 3300013308 Bacteria 2035
119 Ga0157377_10018432 3300014745 Bacteria 3627
120 Ga0157377_10047488 3300014745 Bacteria 2405
121 Ga0157379_10055853 3300014968 Bacteria 3528
122 Ga0163161_10051840 3300017792 Bacteria 2974
123 Ga0206350_11212979 3300020080 Bacteria 3661
124 Ga0206354_10276679 3300020081 Bacteria 4787
125 Ga0206354_11109311 3300020081 Bacteria 2008
126 Ga0206353_11876451 3300020082 Bacteria 4539
127 Ga0224712_10027401 3300022467 Bacteria 2027
128 Ga0207656_10073866 3300025321 Unclassified 1521
129 Ga0207713_1033417 3300025735 Bacteria 2247
130 Ga0207692_10019186 3300025898 Bacteria 3086
131 Ga0207642_10013311 3300025899 Bacteria 2999
132 Ga0207710_10007394 3300025900 Bacteria 4651
133 Ga0207710_10054294 3300025900 Bacteria 1804
134 Ga0207688_10001518 3300025901 Bacteria 12188
135 Ga0207688_10068463 3300025901 Bacteria 2010
136 Ga0207647_10041699 3300025904 Bacteria 2884
137 Ga0207699_10002139 3300025906 Bacteria 9345
138 Ga0207645_10023099 3300025907 Bacteria 4042
139 Ga0207643_10001003 3300025908 Bacteria 16820
140 Ga0207643_10015836 3300025908 Bacteria 4106
141 Ga0207705_10010997 3300025909 Bacteria 6573
142 Ga0207684_10104493 3300025910 Bacteria 2422
143 Ga0207654_10007123 3300025911 Bacteria 5632
144 Ga0207693_10022204 3300025915 Bacteria 5044
145 Ga0207693_10114840 3300025915 Bacteria 2113
146 Ga0207660_10032348 3300025917 Bacteria 3610
147 Ga0207662_10006003 3300025918 Bacteria 6525
148 Ga0207657_10023507 3300025919 Bacteria 5738
149 Ga0207657_10027094 3300025919 Bacteria 5254
150 Ga0207649_10055031 3300025920 Bacteria 2479
151 Ga0207652_10009746 3300025921 Bacteria 7728
152 Ga0207646_10096664 3300025922 Bacteria 2646
153 Ga0207694_10023773 3300025924 Bacteria 4653
154 Ga0207659_10012427 3300025926 Bacteria 5418
155 Ga0207687_10006498 3300025927 Bacteria 7720
156 Ga0207687_10013755 3300025927 Bacteria 5285
157 Ga0207700_10012872 3300025928 Bacteria 5414
158 Ga0207700_10016997 3300025928 Bacteria 4847
159 Ga0207664_10067038 3300025929 Bacteria 2879
160 Ga0207706_10117959 3300025933 Bacteria 2334
161 Ga0207686_10019010 3300025934 Bacteria 3899
162 Ga0207709_10023827 3300025935 Bacteria 3488
163 Ga0207670_10044341 3300025936 Bacteria 2942
164 Ga0207665_10004438 3300025939 Bacteria 9320
165 Ga0207691_10062866 3300025940 Bacteria 3367
166 Ga0207689_10004099 3300025942 Bacteria 13252
167 Ga0207661_10002759 3300025944 Bacteria 12093
168 Ga0207661_10037991 3300025944 Bacteria 3771
169 Ga0207679_10002808 3300025945 Bacteria 10805
170 Ga0207679_10143651 3300025945 Bacteria 1932
171 Ga0207667_10176731 3300025949 Bacteria 2193
172 Ga0207668_10001219 3300025972 Bacteria 15275
173 Ga0207640_10012801 3300025981 Bacteria 4791
174 Ga0207677_10001879 3300026023 Bacteria 11097
175 Ga0207703_10034611 3300026035 Bacteria 4009
176 Ga0207703_10128796 3300026035 Bacteria 2183
177 Ga0207678_10002022 3300026067 Bacteria 18417
178 Ga0207708_10002575 3300026075 Bacteria 13350
179 Ga0207708_10076576 3300026075 Bacteria 2566
180 Ga0207702_10010210 3300026078 Bacteria 7860
181 Ga0207702_10065877 3300026078 Bacteria 3103
182 Ga0207641_10044947 3300026088 Bacteria 3716
183 Ga0207648_10034170 3300026089 Bacteria 4483
184 Ga0207676_10020052 3300026095 Bacteria 4886
185 Ga0207676_10271476 3300026095 Bacteria 1536
186 Ga0207674_10159571 3300026116 Bacteria 2210
187 Ga0207675_100009833 3300026118 Bacteria 8949
188 Ga0207683_10001685 3300026121 Bacteria 19765
189 Ga0207683_10135039 3300026121 Bacteria 2220
190 Ga0207698_10100469 3300026142 Bacteria 2396
191 Ga0207428_10003343 3300027907 Bacteria 15596
192 Ga0207428_10107621 3300027907 Bacteria 2148
193 Ga0268265_10006260 3300028380 Bacteria 8062
194 Ga0307517_10032304 3300028786 Bacteria 6053
195 Ga0307517_10059961 3300028786 Bacteria 3633
196 Ga0307517_10160958 3300028786 Bacteria 1507
197 Ga0307515_10002074 3300028794 Bacteria 44147
198 Ga0307515_10002741 3300028794 Bacteria 37704
199 Ga0307515_10012302 3300028794 Bacteria 16103
200 Ga0307515_10037638 3300028794 Bacteria 7771
201 Ga0265338_10062281 3300028800 Bacteria 3261
202 Ga0307512_10002990 3300030522 Bacteria 20379
203 Ga0307512_10028103 3300030522 Bacteria 4936
204 Ga0307513_10000535 3300031456 Bacteria 54265
205 Ga0307513_10008641 3300031456 Bacteria 12979
206 Ga0307513_10063699 3300031456 Bacteria 3890
207 Ga0307509_10000403 3300031507 Bacteria 72510
208 Ga0307509_10016518 3300031507 Bacteria 8536
209 Ga0307509_10174557 3300031507 Bacteria 2023
210 Ga0307509_10257497 3300031507 Bacteria 1523
211 Ga0307408_100107639 3300031548 Bacteria 2135
212 Ga0307508_10002455 3300031616 Bacteria 19546
213 Ga0316576_10009907 3300031727 Bacteria 6167
214 Ga0316578_10037658 3300031728 Bacteria 2786
215 Ga0307516_10002634 3300031730 Bacteria 23764
216 Ga0307516_10037768 3300031730 Bacteria 4825
217 Ga0307516_10038009 3300031730 Bacteria 4807
218 Ga0307516_10106159 3300031730 Bacteria 2619
219 Ga0307516_10154984 3300031730 Bacteria 2047
220 Ga0307405_10012595 3300031731 Bacteria 4485
221 Ga0307405_10027654 3300031731 Bacteria 3292
222 Ga0307405_10048374 3300031731 Bacteria 2622
223 Ga0307413_10061711 3300031824 Bacteria 2315
224 Ga0307413_10111312 3300031824 Bacteria 1833
225 Ga0307410_10030848 3300031852 Bacteria 3431
226 Ga0307410_10030879 3300031852 Bacteria 3429
227 Ga0307410_10077878 3300031852 Bacteria 2319
228 Ga0307410_10118130 3300031852 Bacteria 1929
229 Ga0326468_10000564 3300031889 Bacteria 3858
230 Ga0307406_10148787 3300031901 Bacteria 1668
231 Ga0307407_10003320 3300031903 Bacteria 6572
232 Ga0307412_10028479 3300031911 Bacteria 3495
233 Ga0307412_10275933 3300031911 Bacteria 1318
234 Ga0307409_100002008 3300031995 Bacteria 10444
235 Ga0307409_100026167 3300031995 Bacteria 4110
236 Ga0307409_100026718 3300031995 Bacteria 4077
237 Ga0307409_100079159 3300031995 Bacteria 2647
238 Ga0307409_100090090 3300031995 Bacteria 2510
239 Ga0307409_100137711 3300031995 Bacteria 2098
240 Ga0307409_100226751 3300031995 Bacteria 1690
241 Ga0307416_100004444 3300032002 Bacteria 8452
242 Ga0307416_100028027 3300032002 Bacteria 4182
243 Ga0307416_100065219 3300032002 Bacteria 2991
244 Ga0307416_100098858 3300032002 Bacteria 2532
245 Ga0307416_100369760 3300032002 Bacteria 1459
246 Ga0307414_10018166 3300032004 Bacteria 4321
247 Ga0307414_10070866 3300032004 Bacteria 2512
248 Ga0307411_10004467 3300032005 Bacteria 6705
249 Ga0307415_100004956 3300032126 Bacteria 7006
250 Ga0307415_100010024 3300032126 Bacteria 5346
251 Ga0307415_100030321 3300032126 Bacteria 3469
252 Ga0307415_100045797 3300032126 Bacteria 2935
253 Ga0307415_100216778 3300032126 Bacteria 1531
254 Ga0316592_1018234 3300033524 Bacteria 1477
255 Ga0373934_0057834 3300035086 Unclassified 1543
256 Ga0373949_0000112 3300035090 Bacteria 30333
257 Ga0373951_0000178 3300035091 Bacteria 22849
258 Ga0373956_0031511 3300035119 Bacteria 2324
259 Ga0373955_0069294 3300035172 Bacteria 1967
260 Ga0373955_0096079 3300035172 Bacteria 1695
261 Ga0316574_0000753 3300035398 Bacteria 13935
262 Ga0316582_0048636 3300036647 Bacteria 2682
263 Ga0395899_0014713 3300037312 Bacteria 5972
264 Ga0395899_0185728 3300037312 Bacteria 1457
265 Ga0395900_0004418 3300037418 Bacteria 14911
266 Ga0395900_0058139 3300037418 Bacteria 3981
267 Ga0395900_0063517 3300037418 Bacteria 3796
268 Ga0395900_0130364 3300037418 Bacteria 2577
269 Ga0395900_0213109 3300037418 Bacteria 1950
270 Ga0395900_0302361 3300037418 Bacteria 1586
271 Ga0395898_0028186 3300037466 Bacteria 5631
272 Ga0395898_0035041 3300037466 Bacteria 4995
273 Ga0395898_0057194 3300037466 Bacteria 3801
274 Ga0395905_0039344 3300037471 Bacteria 4436
275 Ga0395905_0049457 3300037471 Bacteria 3940
276 Ga0395901_0018293 3300038443 Bacteria 7154
277 Ga0395901_0033043 3300038443 Bacteria 5339
278 Ga0395901_0223488 3300038443 Bacteria 1968
279 Ga0395901_0318921 3300038443 Bacteria 1608
280 Ga0451791_0126590 3300041451 Bacteria 3363
281 Ga0451791_0630906 3300041451 Bacteria 1219
282 Ga0451800_0536953 3300041459 Bacteria 1977
283 Ga0451853_0947883 3300041512 Bacteria 12529
284 Ga0439463_006094 3300042016 Bacteria 2994
285 Ga0439459_0007567 3300042438 Bacteria 1838
286 Ga0466963_0042234 3300044694 Bacteria 2993
287 Ga0466964_0053387 3300044706 Bacteria 1663
288 Ga0466967_0029675 3300045976 Bacteria 4580
289 Ga0466967_0038489 3300045976 Bacteria 4103
290 Ga0466967_0041126 3300045976 Bacteria 3982
291 Ga0466967_0150568 3300045976 Bacteria 2174
292 Ga0466967_0250314 3300045976 Bacteria 1692
293 Ga0495627_000522 3300046453 Bacteria 31814
294 Ga0495592_0039137 3300046454 Bacteria 3564
295 Ga0495651_0005711 3300046462 Bacteria 9482
296 Ga0495653_0007357 3300046463 Bacteria 9019
297 Ga0495664_0124521 3300046477 Bacteria 1559
298 Ga0495608_0006541 3300046511 Bacteria 8267
299 Ga0495608_0107687 3300046511 Bacteria 1793
300 Ga0495618_0070047 3300046514 Bacteria 2230
301 Ga0495632_0041552 3300046519 Bacteria 2310
302 Ga0495652_0025643 3300046529 Bacteria 5211
303 Ga0495587_0009175 3300046536 Bacteria 6347
304 Ga0495622_0087127 3300046557 Bacteria 1436
305 Ga0495667_0020730 3300046559 Bacteria 4435
306 Ga0495667_0046293 3300046559 Bacteria 2877
307 Ga0495656_0061839 3300046615 Bacteria 1637
308 Ga0495634_0068088 3300046642 Bacteria 2353
309 Ga0495635_0029928 3300046663 Bacteria 3785
310 Ga0495657_0028504 3300046675 Bacteria 3926
311 Ga0495600_0051855 3300046809 Unclassified 2678
312 Ga0495680_0003399 3300047322 Bacteria 15704
313 Ga0495680_0034901 3300047322 Bacteria 4056
314 Ga0495684_0026637 3300047471 Bacteria 4443
315 Ga0495602_0018647 3300048088 Bacteria 6920
316 Ga0496100_0007538 3300048903 Bacteria 6011
317 Ga0496101_0027333 3300048904 Bacteria 3974
318 Ga0496102_0008031 3300048905 Bacteria 9022
319 Ga0496102_0035544 3300048905 Bacteria 4485
320 Ga0496103_0060672 3300048906 Bacteria 2351
321 Ga0496104_0006770 3300048907 Bacteria 10093
322 Ga0496105_0004410 3300048908 Bacteria 10595
323 Ga0496105_0035755 3300048908 Bacteria 4090
324 Ga0496106_0000534 3300048909 Bacteria 26939
325 Ga0496106_0013338 3300048909 Bacteria 6065
326 Ga0496107_0013002 3300048910 Bacteria 5815
327 Ga0496107_0016876 3300048910 Bacteria 5132
328 Ga0496107_0099259 3300048910 Bacteria 2133
329 Ga0496108_0015350 3300048911 Bacteria 6247
330 Ga0496108_0163551 3300048911 Bacteria 1924
331 Ga0496109_0016275 3300048912 Bacteria 6500
332 Ga0496109_0147242 3300048912 Bacteria 2204
333 Ga0496110_0001752 3300048913 Bacteria 16001
334 Ga0496110_0254897 3300048913 Bacteria 1597
335 Ga0496111_0001060 3300048914 Bacteria 15162
336 Ga0496111_0069720 3300048914 Bacteria 2556
337 Ga0496113_0005246 3300048916 Bacteria 8067
338 Ga0496114_0052616 3300048917 Bacteria 3393
339 Ga0496114_0084771 3300048917 Bacteria 2683
340 Ga0496115_0004659 3300048918 Bacteria 9934
341 Ga0496115_0017605 3300048918 Bacteria 5469
342 Ga0496125_0003253 3300048928 Bacteria 20009
343 Ga0496125_0009984 3300048928 Bacteria 9649
344 Ga0496125_0092371 3300048928 Bacteria 2263
345 Ga0496126_0042601 3300048929 Bacteria 4192
346 Ga0496126_0074536 3300048929 Bacteria 3013
347 Ga0501032_0145908 3300049569 Bacteria 1557
348 Ga0501036_0011464 3300049572 Bacteria 7337
349 Ga0501036_0059749 3300049572 Bacteria 3230
350 Ga0501037_0174525 3300049573 Bacteria 1527
351 Ga0501039_0071925 3300049575 Bacteria 2687
352 Ga0501040_0086243 3300049576 Bacteria 2180
353 Ga0501041_0042331 3300049577 Bacteria 2768
354 Ga0501042_0006795 3300049578 Bacteria 7459
355 Ga0501042_0045219 3300049578 Bacteria 3138
356 Ga0501042_0067457 3300049578 Bacteria 2557
357 Ga0501048_0033097 3300049582 Bacteria 3736
358 Ga0501048_0159063 3300049582 Bacteria 1598
359 Ga0501071_0069542 3300049587 Bacteria 2564
360 Ga0501072_0023454 3300049588 Bacteria 4794
361 Ga0501072_0089856 3300049588 Bacteria 2438
362 Ga0501072_0120776 3300049588 Bacteria 2088
363 Ga0501075_0047697 3300049591 Bacteria 3219
364 Ga0501075_0177174 3300049591 Bacteria 1627
365 Ga0501077_0040730 3300049593 Bacteria 2959
366 Ga0501080_0122258 3300049742 Bacteria 2412
367 Ga0501045_0009520 3300049824 Bacteria 6798
368 nmdc:mga09592_75563_c1 3300050508 Bacteria 2864
369 nmdc:mga0rr50_281631_c1 3300050513 Bacteria 1387
370 nmdc:mga08x19_12426_c1 3300050514 Bacteria 5130
371 nmdc:mga0a205_3818_c1 3300050515 Bacteria 13503
372 Ga0495619_0017858 3300053085 Bacteria 4497
373 Ga0500646_0000194 3300053090 Bacteria 18285
374 Ga0500647_0031109 3300053091 Bacteria 2538
375 Ga0500583_0013286 3300053092 Bacteria 3180
376 Ga0500566_0001163 3300053094 Bacteria 15309
377 Ga0500566_0005980 3300053094 Bacteria 7236
378 Ga0500640_000069 3300053095 Bacteria 17053
379 Ga0500654_061028 3300053099 Bacteria 1930
380 Ga0500554_000278 3300053102 Bacteria 11043
381 Ga0500595_000076 3300053119 Bacteria 68602
382 Ga0500597_001381 3300053120 Bacteria 6119
383 Ga0500614_000382 3300053123 Bacteria 11559
384 Ga0500652_015488 3300053131 Bacteria 2753
385 Ga0500559_0004310 3300053136 Bacteria 6796
386 Ga0500600_0036134 3300053149 Bacteria 2873
387 Ga0500616_0000391 3300053153 Bacteria 60963
388 Ga0500636_0027616 3300053177 Bacteria 3353
389 Ga0500601_002254 3300053737 Bacteria 2072
390 Ga0501084_0197501 3300054114 Bacteria 1697
391 Ga0530510_0073349 3300061734 Bacteria 2484
392 2676483702 2675903059 Bacteria 8644972
393 2738698113 2738541272 Bacteria 6848551
394 2739328447 2738543027 Bacteria 6409078
395 2739604602 2739367654 Bacteria 6049412
396 2753073431 2751185734 Bacteria 8863695
397 2760308368 2758568522 Bacteria 5953541
398 2760622988 2758568621 Bacteria 5967089
399 2774394310 2773857762 Bacteria 5971770
400 2809027771 2808606394 Bacteria 6248540
401 2809194831 2808606439 Bacteria 5952208
402 2812352913 2811994878 Bacteria 5992952
403 2816506621 2816332139 Bacteria 9138787
404 2837270765 2837268691 Bacteria 7850704
405 2839986031 2839986021 Bacteria 3685650
406 2852663893 2852663356 Bacteria 4090475
407 2857726259 2857723135 Bacteria 4217853
408 2862384593 2862382967 Bacteria 10317375
409 2862710863 2862705112 Bacteria 6563286
410 2867302629 2867302475 Bacteria 7087181
411 2867314467 2867312974 Bacteria 7058875
412 2867323293 2867319477 Bacteria 7069771
413 2867352122 2867346516 Bacteria 7608576
414 2870721712 2870721527 Bacteria 9689237
415 2891972689 2891968417 Bacteria 5821697
416 2895428047 2895427314 Bacteria 13147766
417 2895437307 2895427314 Bacteria 13147766
418 2932434130 2932431166 Bacteria 4215299
419 2939585638 2939582691 Bacteria 7088898
420 2984579218 2984576629 Bacteria 4248407
421 2990047887 2990044586 Bacteria 6603797
422 2990259889 2990256926 Bacteria 4252839
423 8008491037 8008485437 Bacteria 7198341
424 8008564561 8008558824 Bacteria 10610750
425 8025530366 8025524527 Bacteria 7197316
426 8054610747 8054609563 Bacteria 5170090
427 8055066953 8055066027 Bacteria 9479577
428 8055181535 8055172936 Bacteria 9305943
429 8056214575 8056207758 Bacteria 8639239
430 8056581948 8056579771 Bacteria 5840325
431 Ga0105251_10020785
432 JGI24751J29686_10004716
433 JGI25406J46586_10004752
434 JGI25406J46586_10005444
435 JGI25406J46586_10035024
436 rootH2_10036972
437 JGI25407J50210_10007473
438 Ga0070676_10010856
439 Ga0070676_10112136
440 Ga0070683_100059403
441 Ga0070683_100180004
442 Ga0070690_100028670
443 Ga0068869_100010113
444 Ga0070680_100014408
445 Ga0068868_100017060
446 Ga0068868_100133133
447 Ga0070689_100014471
448 Ga0070661_100005914
449 Ga0070692_10005162
450 Ga0070668_100000361
451 Ga0070669_100102542
452 Ga0070675_100033397
453 Ga0070674_100121457
454 Ga0070673_100008828
455 Ga0070709_10013923
456 Ga0070710_10011824
457 Ga0070701_10012072
458 Ga0070711_100018642
459 Ga0070700_100108157
460 Ga0070700_100130492
461 Ga0070678_100001955
462 Ga0068867_100054974
463 Ga0070685_10027053
464 Ga0070706_100258158
465 Ga0070699_100252765
466 Ga0070679_100043583
467 Ga0068853_100018552
468 Ga0070672_100018082
469 Ga0070686_100024217
470 Ga0070665_100013384
471 Ga0068855_100039088
472 Ga0068854_100017139
473 Ga0068856_100086113
474 Ga0068856_100103560
475 Ga0070702_100000868
476 Ga0070702_100016471
477 Ga0070702_100109236
478 Ga0070702_100130919
479 Ga0068864_100007828
480 Ga0068866_10020775
481 Ga0068861_100041490
482 Ga0068851_10001816
483 Ga0068851_10038388
484 Ga0068870_10003544
485 Ga0068870_10033631
486 Ga0068863_100019507
487 Ga0068863_100062078
488 Ga0068860_100079930
489 Ga0068862_100023169
490 Ga0081455_10017882
491 Ga0081538_10000210
492 Ga0081538_10011162
493 Ga0081538_10011946
494 Ga0081538_10051122
495 Ga0081538_10051605
496 Ga0081538_10052518
497 Ga0081540_1010875
498 Ga0081540_1023819
499 Ga0081539_10000031
500 Ga0081539_10001666
501 Ga0081539_10002841
502 Ga0081539_10007168
503 Ga0075364_10035929
504 Ga0070716_100003337
505 Ga0097621_100004988
506 Ga0075428_100144754
507 Ga0075428_100161968
508 Ga0075430_100046296
509 Ga0075431_100050294
510 Ga0075433_10016081
511 Ga0075429_100047119
512 Ga0075429_100066586
513 Ga0075436_100001550
514 Ga0075435_100140407
515 Ga0105240_10033487
516 Ga0111539_10032191
517 Ga0111539_10032404
518 Ga0105245_10034382
519 Ga0105245_10225258
520 Ga0105245_10338602
521 Ga0105247_10009132
522 Ga0114129_10299538
523 Ga0105243_10033880
524 Ga0105243_10051937
525 Ga0105241_10004181
526 Ga0105241_10159422
527 Ga0105242_10035349
528 Ga0105242_10045817
529 Ga0105242_10177551
530 Ga0105248_10100958
531 Ga0105237_10126423
532 Ga0105237_10149225
533 Ga0105238_10023357
534 Ga0105238_10157928
535 Ga0105239_10043877
536 Ga0105239_10267535
537 Ga0105246_10001370
538 Ga0157373_10012431
539 Ga0157371_10016463
540 Ga0157371_10113611
541 Ga0157370_10059995
542 Ga0157369_10051551
543 Ga0157369_10279263
544 Ga0157374_10015571
545 Ga0157378_10157570
546 Ga0157378_10273245
547 Ga0157375_10200537
548 Ga0157375_10224929
549 Ga0157377_10018432
550 Ga0157377_10047488
551 Ga0157379_10055853
552 Ga0163161_10051840
553 Ga0206350_11212979
554 Ga0206354_10276679
555 Ga0206354_11109311
556 Ga0206353_11876451
557 Ga0224712_10027401
558 Ga0207656_10073866
559 Ga0207713_1033417
560 Ga0207692_10019186
561 Ga0207642_10013311
562 Ga0207710_10007394
563 Ga0207710_10054294
564 Ga0207688_10001518
565 Ga0207688_10068463
566 Ga0207647_10041699
567 Ga0207699_10002139
568 Ga0207645_10023099
569 Ga0207643_10001003
570 Ga0207643_10015836
571 Ga0207705_10010997
572 Ga0207684_10104493
573 Ga0207654_10007123
574 Ga0207693_10022204
575 Ga0207693_10114840
576 Ga0207660_10032348
577 Ga0207662_10006003
578 Ga0207657_10023507
579 Ga0207657_10027094
580 Ga0207649_10055031
581 Ga0207652_10009746
582 Ga0207646_10096664
583 Ga0207694_10023773
584 Ga0207659_10012427
585 Ga0207687_10006498
586 Ga0207687_10013755
587 Ga0207700_10012872
588 Ga0207700_10016997
589 Ga0207664_10067038
590 Ga0207706_10117959
591 Ga0207686_10019010
592 Ga0207709_10023827
593 Ga0207670_10044341
594 Ga0207665_10004438
595 Ga0207691_10062866
596 Ga0207689_10004099
597 Ga0207661_10002759
598 Ga0207661_10037991
599 Ga0207679_10002808
600 Ga0207679_10143651
601 Ga0207667_10176731
602 Ga0207668_10001219
603 Ga0207640_10012801
604 Ga0207677_10001879
605 Ga0207703_10034611
606 Ga0207703_10128796
607 Ga0207678_10002022
608 Ga0207708_10002575
609 Ga0207708_10076576
610 Ga0207702_10010210
611 Ga0207702_10065877
612 Ga0207641_10044947
613 Ga0207648_10034170
614 Ga0207676_10020052
615 Ga0207676_10271476
616 Ga0207674_10159571
617 Ga0207675_100009833
618 Ga0207683_10001685
619 Ga0207683_10135039
620 Ga0207698_10100469
621 Ga0207428_10003343
622 Ga0207428_10107621
623 Ga0268265_10006260
624 Ga0307517_10032304
625 Ga0307517_10059961
626 Ga0307517_10160958
627 Ga0307515_10002074
628 Ga0307515_10002741
629 Ga0307515_10012302
630 Ga0307515_10037638
631 Ga0265338_10062281
632 Ga0307512_10002990
633 Ga0307512_10028103
634 Ga0307513_10000535
635 Ga0307513_10008641
636 Ga0307513_10063699
637 Ga0307509_10000403
638 Ga0307509_10016518
639 Ga0307509_10174557
640 Ga0307509_10257497
641 Ga0307408_100107639
642 Ga0307508_10002455
643 Ga0316576_10009907
644 Ga0316578_10037658
645 Ga0307516_10002634
646 Ga0307516_10037768
647 Ga0307516_10038009
648 Ga0307516_10106159
649 Ga0307516_10154984
650 Ga0307405_10012595
651 Ga0307405_10027654
652 Ga0307405_10048374
653 Ga0307413_10061711
654 Ga0307413_10111312
655 Ga0307410_10030848
656 Ga0307410_10030879
657 Ga0307410_10077878
658 Ga0307410_10118130
659 Ga0326468_10000564
660 Ga0307406_10148787
661 Ga0307407_10003320
662 Ga0307412_10028479
663 Ga0307412_10275933
664 Ga0307409_100002008
665 Ga0307409_100026167
666 Ga0307409_100026718
667 Ga0307409_100079159
668 Ga0307409_100090090
669 Ga0307409_100137711
670 Ga0307409_100226751
671 Ga0307416_100004444
672 Ga0307416_100028027
673 Ga0307416_100065219
674 Ga0307416_100098858
675 Ga0307416_100369760
676 Ga0307414_10018166
677 Ga0307414_10070866
678 Ga0307411_10004467
679 Ga0307415_100004956
680 Ga0307415_100010024
681 Ga0307415_100030321
682 Ga0307415_100045797
683 Ga0307415_100216778
684 Ga0316592_1018234
685 Ga0373934_0057834
686 Ga0373949_0000112
687 Ga0373951_0000178
688 Ga0373956_0031511
689 Ga0373955_0069294
690 Ga0373955_0096079
691 Ga0316574_0000753
692 Ga0316582_0048636
693 Ga0395899_0014713
694 Ga0395899_0185728
695 Ga0395900_0004418
696 Ga0395900_0058139
697 Ga0395900_0063517
698 Ga0395900_0130364
699 Ga0395900_0213109
700 Ga0395900_0302361
701 Ga0395898_0028186
702 Ga0395898_0035041
703 Ga0395898_0057194
704 Ga0395905_0039344
705 Ga0395905_0049457
706 Ga0395901_0018293
707 Ga0395901_0033043
708 Ga0395901_0223488
709 Ga0395901_0318921
710 Ga0451791_0126590
711 Ga0451791_0630906
712 Ga0451800_0536953
713 Ga0451853_0947883
714 Ga0439463_006094
715 Ga0439459_0007567
716 Ga0466963_0042234
717 Ga0466964_0053387
718 Ga0466967_0029675
719 Ga0466967_0038489
720 Ga0466967_0041126
721 Ga0466967_0150568
722 Ga0466967_0250314
723 Ga0495627_000522
724 Ga0495592_0039137
725 Ga0495651_0005711
726 Ga0495653_0007357
727 Ga0495664_0124521
728 Ga0495608_0006541
729 Ga0495608_0107687
730 Ga0495618_0070047
731 Ga0495632_0041552
732 Ga0495652_0025643
733 Ga0495587_0009175
734 Ga0495622_0087127
735 Ga0495667_0020730
736 Ga0495667_0046293
737 Ga0495656_0061839
738 Ga0495634_0068088
739 Ga0495635_0029928
740 Ga0495657_0028504
741 Ga0495600_0051855
742 Ga0495680_0003399
743 Ga0495680_0034901
744 Ga0495684_0026637
745 Ga0495602_0018647
746 Ga0496100_0007538
747 Ga0496101_0027333
748 Ga0496102_0008031
749 Ga0496102_0035544
750 Ga0496103_0060672
751 Ga0496104_0006770
752 Ga0496105_0004410
753 Ga0496105_0035755
754 Ga0496106_0000534
755 Ga0496106_0013338
756 Ga0496107_0013002
757 Ga0496107_0016876
758 Ga0496107_0099259
759 Ga0496108_0015350
760 Ga0496108_0163551
761 Ga0496109_0016275
762 Ga0496109_0147242
763 Ga0496110_0001752
764 Ga0496110_0254897
765 Ga0496111_0001060
766 Ga0496111_0069720
767 Ga0496113_0005246
768 Ga0496114_0052616
769 Ga0496114_0084771
770 Ga0496115_0004659
771 Ga0496115_0017605
772 Ga0496125_0003253
773 Ga0496125_0009984
774 Ga0496125_0092371
775 Ga0496126_0042601
776 Ga0496126_0074536
777 Ga0501032_0145908
778 Ga0501036_0011464
779 Ga0501036_0059749
780 Ga0501037_0174525
781 Ga0501039_0071925
782 Ga0501040_0086243
783 Ga0501041_0042331
784 Ga0501042_0006795
785 Ga0501042_0045219
786 Ga0501042_0067457
787 Ga0501048_0033097
788 Ga0501048_0159063
789 Ga0501071_0069542
790 Ga0501072_0023454
791 Ga0501072_0089856
792 Ga0501072_0120776
793 Ga0501075_0047697
794 Ga0501075_0177174
795 Ga0501077_0040730
796 Ga0501080_0122258
797 Ga0501045_0009520
798 nmdc:mga09592_75563_c1
799 nmdc:mga0rr50_281631_c1
800 nmdc:mga08x19_12426_c1
801 nmdc:mga0a205_3818_c1
802 Ga0495619_0017858
803 Ga0500646_0000194
804 Ga0500647_0031109
805 Ga0500583_0013286
806 Ga0500566_0001163
807 Ga0500566_0005980
808 Ga0500640_000069
809 Ga0500654_061028
810 Ga0500554_000278
811 Ga0500595_000076
812 Ga0500597_001381
813 Ga0500614_000382
814 Ga0500652_015488
815 Ga0500559_0004310
816 Ga0500600_0036134
817 Ga0500616_0000391
818 Ga0500636_0027616
819 Ga0500601_002254
820 Ga0501084_0197501
821 Ga0530510_0073349
822 2676483702
823 2738698113
824 2739328447
825 2739604602
826 2753073431
827 2760308368
828 2760622988
829 2774394310
830 2809027771
831 2809194831
832 2812352913
833 2816506621
834 2837270765
835 2839986031
836 2852663893
837 2857726259
838 2862384593
839 2862710863
840 2867302629
841 2867314467
842 2867323293
843 2867352122
844 2870721712
845 2891972689
846 2895428047
847 2895437307
848 2932434130
849 2939585638
850 2984579218
851 2990047887
852 2990259889
853 8008491037
854 8008564561
855 8025530366
856 8054610747
857 8055066953
858 8055181535
859 8056214575
860 8056581948

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13458

Peripla_BP_6

Periplasmic binding protein

60

408

0.93

PF13433

Peripla_BP_5

Periplasmic binding protein domain

61

409

0.87

PF01094

ANF_receptor

Receptor family ligand binding region

88

384

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1z18-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8879 52 397
4n0q-assembly1.cif.gz_A crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic) 0.8862 54 397
3td9-assembly1.cif.gz_A-2 crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution 0.8765 54 404
1z18-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8759 52 397
4n0q-assembly1.cif.gz_A crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic) 0.8742 54 397
ID Description Score Start End Superfamily
af_Q9SHV1_60_153_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.926 95 167 3.40.50.2300
af_Q69L07_59_152_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9042 95 168 3.40.50.2300
af_A0A0R0JFH4_66_156_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9008 95 168 3.40.50.2300
af_P04816_25_358_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.887 54 393 3.40.190.10
af_P04816_25_358_3.40.190.10 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.882 54 393 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2W6E0J4-F1-model_v4 Leucine-binding protein domain-containing protein 0.9614 85 419
AF-A0A355H349-F1-model_v4 ABC transporter substrate-binding protein 0.9402 49 419 GO:0006865
AF-A0A535MBE2-F1-model_v4 ABC transporter substrate-binding protein 0.9379 100 419
AF-A0A2W6E0J4-F1-model_v4 Leucine-binding protein domain-containing protein 0.9263 85 419
AF-A0A352XVT3-F1-model_v4 Leucine-binding protein domain-containing protein 0.9246 42 325 GO:0016020

Map