F442109
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 430 | 306 | 422 | 85 |
Family's Representative Sequence
| Representative Sequence | 3300006178|Ga0075367_10114274|Ga0075367_101142743 |
| Length | 90 |
| Sequence | MNEKTEADTFPDRLSTNPSSPYYNEELLSRDVGIRFKGAEKTNVEEYCISEGWIRVTAGNAKDRHGKPLTIKLKGKVEPYFKTPDSSSTG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 2 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 3 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 4 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 5 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 6 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 7 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 8 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 9 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 44 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 48 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 49 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 50 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 51 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 52 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 55 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 56 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 60 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 61 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 62 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 84 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 85 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 86 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 133 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 134 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 135 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 137 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 139 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 140 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 141 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 142 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 145 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 147 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 148 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 149 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 150 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 151 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 153 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 154 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 155 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 158 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 159 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 160 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 161 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 162 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 164 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 165 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 166 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 167 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 168 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 170 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 171 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 172 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 173 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 174 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 175 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 176 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 177 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 178 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 179 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 182 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 183 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 184 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 185 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 186 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 187 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 188 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 189 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 190 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 191 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 246 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 247 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 248 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 249 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 250 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 255 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 256 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 257 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 258 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 259 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 260 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 261 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 262 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 280 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 284 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 285 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 286 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 287 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 288 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 289 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 290 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 292 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 297 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 298 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 299 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 300 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 301 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 302 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 303 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 304 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 305 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 8057529695 | Bosea vestrisii A18/4-2 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.44 |
| Metatranscriptomes | 0.47 |
| Isolates | 2.09 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 7.44 |
| Nodule | 1.16 |
| Rhizoplane | 8.37 |
| Rhizosphere | 76.28 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10010893 | 3300003203 | Bacteria | 4007 |
| 2 | rootH1_10043406 | 3300003316 | Bacteria | 2678 |
| 3 | rootH1_10053722 | 3300003316 | Bacteria | 1971 |
| 4 | rootH1_10053722 | 3300003323 | Bacteria | 1562 |
| 5 | rootL2_10166897 | 3300003322 | Bacteria | 2732 |
| 6 | Ga0070658_10630988 | 3300005327 | Bacteria | 929 |
| 7 | Ga0070683_100874740 | 3300005329 | Bacteria | 862 |
| 8 | Ga0070690_100403164 | 3300005330 | Bacteria | 1005 |
| 9 | Ga0070670_100406226 | 3300005331 | Bacteria | 1203 |
| 10 | Ga0070670_100719015 | 3300005331 | Bacteria | 899 |
| 11 | Ga0070670_100964071 | 3300005331 | Bacteria | 775 |
| 12 | Ga0070670_102113791 | 3300005331 | Bacteria | 519 |
| 13 | Ga0068869_101448898 | 3300005334 | Bacteria | 609 |
| 14 | Ga0070680_100025425 | 3300005336 | Bacteria | 4732 |
| 15 | Ga0070680_100820095 | 3300005336 | Bacteria | 802 |
| 16 | Ga0070660_100026119 | 3300005339 | Bacteria | 4347 |
| 17 | Ga0070689_102233043 | 3300005340 | Bacteria | 502 |
| 18 | Ga0070661_100000913 | 3300005344 | Bacteria | 21208 |
| 19 | Ga0070675_100574443 | 3300005354 | Bacteria | 1021 |
| 20 | Ga0070671_101082329 | 3300005355 | Bacteria | 704 |
| 21 | Ga0070674_100488039 | 3300005356 | Bacteria | 1024 |
| 22 | Ga0070659_100962568 | 3300005366 | Bacteria | 748 |
| 23 | Ga0070667_101295694 | 3300005367 | Bacteria | 682 |
| 24 | Ga0070663_101394044 | 3300005455 | Bacteria | 620 |
| 25 | Ga0070678_100563678 | 3300005456 | Bacteria | 1013 |
| 26 | Ga0070678_101348785 | 3300005456 | Bacteria | 665 |
| 27 | Ga0070678_101718355 | 3300005456 | Bacteria | 591 |
| 28 | Ga0070662_100107856 | 3300005457 | Bacteria | 2117 |
| 29 | Ga0070681_10332017 | 3300005458 | Bacteria | 1430 |
| 30 | Ga0068867_101124080 | 3300005459 | Bacteria | 718 |
| 31 | Ga0068867_101541566 | 3300005459 | Bacteria | 620 |
| 32 | Ga0070706_100115858 | 3300005467 | Bacteria | 2495 |
| 33 | Ga0070699_100227587 | 3300005518 | Bacteria | 1662 |
| 34 | Ga0070679_100019961 | 3300005530 | Bacteria | 6528 |
| 35 | Ga0070697_100053070 | 3300005536 | Bacteria | 3295 |
| 36 | Ga0068853_100003225 | 3300005539 | Bacteria | 12471 |
| 37 | Ga0068853_100988830 | 3300005539 | Bacteria | 810 |
| 38 | Ga0068853_102304120 | 3300005539 | Bacteria | 522 |
| 39 | Ga0070672_101375192 | 3300005543 | Bacteria | 631 |
| 40 | Ga0070686_100987551 | 3300005544 | Bacteria | 690 |
| 41 | Ga0070665_100072518 | 3300005548 | Bacteria | 3451 |
| 42 | Ga0070665_100688288 | 3300005548 | Bacteria | 1035 |
| 43 | Ga0070665_100849123 | 3300005548 | Bacteria | 926 |
| 44 | Ga0068855_100004282 | 3300005563 | Bacteria | 17432 |
| 45 | Ga0070664_100005480 | 3300005564 | Bacteria | 10189 |
| 46 | Ga0070664_101920552 | 3300005564 | Bacteria | 562 |
| 47 | Ga0068857_101461405 | 3300005577 | Bacteria | 666 |
| 48 | Ga0070702_101410503 | 3300005615 | Bacteria | 570 |
| 49 | Ga0068866_10813123 | 3300005718 | Bacteria | 651 |
| 50 | Ga0068870_10482577 | 3300005840 | Bacteria | 823 |
| 51 | Ga0068863_100008703 | 3300005841 | Bacteria | 9913 |
| 52 | Ga0068858_100163307 | 3300005842 | Bacteria | 2098 |
| 53 | Ga0068858_100766464 | 3300005842 | Bacteria | 940 |
| 54 | Ga0068862_101996572 | 3300005844 | Bacteria | 591 |
| 55 | Ga0081539_10002935 | 3300005985 | Bacteria | 22459 |
| 56 | Ga0075365_10130579 | 3300006038 | Bacteria | 1738 |
| 57 | Ga0075365_10407798 | 3300006038 | Bacteria | 959 |
| 58 | Ga0075365_10782741 | 3300006038 | Bacteria | 673 |
| 59 | Ga0075365_10787672 | 3300006038 | Bacteria | 671 |
| 60 | Ga0075368_10199858 | 3300006042 | Bacteria | 846 |
| 61 | Ga0075363_100064176 | 3300006048 | Bacteria | 1984 |
| 62 | Ga0075363_100763140 | 3300006048 | Bacteria | 587 |
| 63 | Ga0070715_10108372 | 3300006163 | Bacteria | 1307 |
| 64 | Ga0070712_100516972 | 3300006175 | Bacteria | 1002 |
| 65 | Ga0075367_10028768 | 3300006178 | Bacteria | 3173 |
| 66 | Ga0075367_10114274 | 3300006178 | Bacteria | 1659 |
| 67 | Ga0075369_10005952 | 3300006186 | Bacteria | 4589 |
| 68 | Ga0075366_10718067 | 3300006195 | Bacteria | 621 |
| 69 | Ga0097621_100728169 | 3300006237 | Bacteria | 915 |
| 70 | Ga0068871_100623111 | 3300006358 | Bacteria | 983 |
| 71 | Ga0068871_101455566 | 3300006358 | Bacteria | 647 |
| 72 | Ga0068871_102155187 | 3300006358 | Bacteria | 531 |
| 73 | Ga0075431_101181325 | 3300006847 | Bacteria | 728 |
| 74 | Ga0075434_100528558 | 3300006871 | Bacteria | 1200 |
| 75 | Ga0099795_10514366 | 3300007788 | Bacteria | 560 |
| 76 | Ga0105245_10490352 | 3300009098 | Bacteria | 1243 |
| 77 | Ga0105247_10112923 | 3300009101 | Bacteria | 1751 |
| 78 | Ga0105247_10524919 | 3300009101 | Bacteria | 866 |
| 79 | Ga0105247_11132883 | 3300009101 | Bacteria | 619 |
| 80 | Ga0105241_10142505 | 3300009174 | Bacteria | 1953 |
| 81 | Ga0105241_10247001 | 3300009174 | Bacteria | 1511 |
| 82 | Ga0105242_10000664 | 3300009176 | Bacteria | 26902 |
| 83 | Ga0105242_11108247 | 3300009176 | Bacteria | 806 |
| 84 | Ga0105242_11293146 | 3300009176 | Bacteria | 753 |
| 85 | Ga0105248_10128086 | 3300009177 | Bacteria | 2864 |
| 86 | Ga0105248_10468128 | 3300009177 | Bacteria | 1421 |
| 87 | Ga0105248_10847283 | 3300009177 | Bacteria | 1032 |
| 88 | Ga0105248_12774042 | 3300009177 | Bacteria | 559 |
| 89 | Ga0105237_10138347 | 3300009545 | Bacteria | 2429 |
| 90 | Ga0105237_10966062 | 3300009545 | Bacteria | 859 |
| 91 | Ga0105237_10966966 | 3300009545 | Bacteria | 858 |
| 92 | Ga0105237_12112891 | 3300009545 | Bacteria | 572 |
| 93 | Ga0105238_10302852 | 3300009551 | Bacteria | 1582 |
| 94 | Ga0105238_11039885 | 3300009551 | Bacteria | 840 |
| 95 | Ga0105249_10019455 | 3300009553 | Bacteria | 6059 |
| 96 | Ga0099796_10033479 | 3300010159 | Bacteria | 1691 |
| 97 | Ga0099796_10123512 | 3300010159 | Bacteria | 997 |
| 98 | Ga0105239_10003689 | 3300010375 | Bacteria | 18664 |
| 99 | Ga0105246_10805185 | 3300011119 | Bacteria | 834 |
| 100 | Ga0105246_11571494 | 3300011119 | Bacteria | 620 |
| 101 | Ga0157373_10519370 | 3300013100 | Bacteria | 861 |
| 102 | Ga0157374_10115074 | 3300013296 | Bacteria | 2590 |
| 103 | Ga0157378_11791776 | 3300013297 | Bacteria | 662 |
| 104 | Ga0157378_12917673 | 3300013297 | Bacteria | 530 |
| 105 | Ga0163162_10089882 | 3300013306 | Bacteria | 3152 |
| 106 | Ga0163162_11162948 | 3300013306 | Bacteria | 875 |
| 107 | Ga0163162_11255121 | 3300013306 | Bacteria | 841 |
| 108 | Ga0163162_11701451 | 3300013306 | Bacteria | 720 |
| 109 | Ga0163162_13457819 | 3300013306 | Bacteria | 503 |
| 110 | Ga0157375_10002699 | 3300013308 | Bacteria | 15369 |
| 111 | Ga0157375_11778593 | 3300013308 | Bacteria | 730 |
| 112 | Ga0157375_12569063 | 3300013308 | Bacteria | 608 |
| 113 | Ga0157375_12786495 | 3300013308 | Bacteria | 584 |
| 114 | Ga0163163_12120796 | 3300014325 | Bacteria | 622 |
| 115 | Ga0157380_10247869 | 3300014326 | Bacteria | 1610 |
| 116 | Ga0157380_10868938 | 3300014326 | Bacteria | 925 |
| 117 | Ga0157377_10687017 | 3300014745 | Bacteria | 741 |
| 118 | Ga0157379_10036753 | 3300014968 | Bacteria | 4367 |
| 119 | Ga0157379_11391491 | 3300014968 | Bacteria | 680 |
| 120 | Ga0163161_10213435 | 3300017792 | Bacteria | 1492 |
| 121 | Ga0163161_10614218 | 3300017792 | Bacteria | 898 |
| 122 | Ga0163161_11093251 | 3300017792 | Bacteria | 685 |
| 123 | Ga0213872_10288225 | 3300021361 | Bacteria | 684 |
| 124 | Ga0213876_10240954 | 3300021384 | Bacteria | 961 |
| 125 | Ga0224712_10366208 | 3300022467 | Bacteria | 683 |
| 126 | Ga0209564_1007718 | 3300025295 | Bacteria | 5478 |
| 127 | Ga0207697_10048136 | 3300025315 | Bacteria | 1758 |
| 128 | Ga0207697_10520874 | 3300025315 | Bacteria | 524 |
| 129 | Ga0207680_11028207 | 3300025903 | Bacteria | 590 |
| 130 | Ga0207685_10391751 | 3300025905 | Bacteria | 710 |
| 131 | Ga0207643_10362148 | 3300025908 | Bacteria | 912 |
| 132 | Ga0207705_10599518 | 3300025909 | Bacteria | 857 |
| 133 | Ga0207654_10290224 | 3300025911 | Bacteria | 1109 |
| 134 | Ga0207654_10995632 | 3300025911 | Bacteria | 609 |
| 135 | Ga0207654_11263608 | 3300025911 | Bacteria | 538 |
| 136 | Ga0207707_10327989 | 3300025912 | Bacteria | 1321 |
| 137 | Ga0207671_10159187 | 3300025914 | Bacteria | 1748 |
| 138 | Ga0207671_10588270 | 3300025914 | Bacteria | 887 |
| 139 | Ga0207671_10801851 | 3300025914 | Bacteria | 747 |
| 140 | Ga0207693_10574732 | 3300025915 | Bacteria | 878 |
| 141 | Ga0207660_10037239 | 3300025917 | Bacteria | 3388 |
| 142 | Ga0207657_10084991 | 3300025919 | Bacteria | 2651 |
| 143 | Ga0207649_10005436 | 3300025920 | Bacteria | 6893 |
| 144 | Ga0207649_10169999 | 3300025920 | Bacteria | 1517 |
| 145 | Ga0207652_10062676 | 3300025921 | Bacteria | 3213 |
| 146 | Ga0207694_10463502 | 3300025924 | Bacteria | 1059 |
| 147 | Ga0207650_10982160 | 3300025925 | Bacteria | 718 |
| 148 | Ga0207659_10127146 | 3300025926 | Bacteria | 1962 |
| 149 | Ga0207687_10407888 | 3300025927 | Bacteria | 1119 |
| 150 | Ga0207644_10795494 | 3300025931 | Bacteria | 791 |
| 151 | Ga0207690_10004882 | 3300025932 | Bacteria | 7909 |
| 152 | Ga0207690_11402729 | 3300025932 | Bacteria | 584 |
| 153 | Ga0207706_10105471 | 3300025933 | Bacteria | 2480 |
| 154 | Ga0207686_10004921 | 3300025934 | Bacteria | 7189 |
| 155 | Ga0207686_10041741 | 3300025934 | Bacteria | 2800 |
| 156 | Ga0207686_10054501 | 3300025934 | Bacteria | 2505 |
| 157 | Ga0207686_10316261 | 3300025934 | Bacteria | 1165 |
| 158 | Ga0207709_10941747 | 3300025935 | Bacteria | 704 |
| 159 | Ga0207709_11328737 | 3300025935 | Bacteria | 594 |
| 160 | Ga0207670_10841525 | 3300025936 | Bacteria | 766 |
| 161 | Ga0207669_10256628 | 3300025937 | Bacteria | 1305 |
| 162 | Ga0207704_10120419 | 3300025938 | Bacteria | 1795 |
| 163 | Ga0207704_10596650 | 3300025938 | Bacteria | 904 |
| 164 | Ga0207711_10509366 | 3300025941 | Bacteria | 1122 |
| 165 | Ga0207661_10961134 | 3300025944 | Bacteria | 787 |
| 166 | Ga0207679_10000225 | 3300025945 | Bacteria | 44668 |
| 167 | Ga0207667_10005407 | 3300025949 | Bacteria | 15575 |
| 168 | Ga0207712_10230623 | 3300025961 | Bacteria | 1486 |
| 169 | Ga0207668_10796499 | 3300025972 | Bacteria | 836 |
| 170 | Ga0207668_11427414 | 3300025972 | Bacteria | 624 |
| 171 | Ga0207658_11692660 | 3300025986 | Bacteria | 578 |
| 172 | Ga0207677_10646396 | 3300026023 | Bacteria | 933 |
| 173 | Ga0207677_11564162 | 3300026023 | Bacteria | 610 |
| 174 | Ga0207703_10384165 | 3300026035 | Bacteria | 1299 |
| 175 | Ga0207703_10849148 | 3300026035 | Bacteria | 873 |
| 176 | Ga0207639_10000690 | 3300026041 | Bacteria | 23246 |
| 177 | Ga0207639_10450435 | 3300026041 | Bacteria | 1168 |
| 178 | Ga0207678_10127084 | 3300026067 | Bacteria | 2174 |
| 179 | Ga0207678_10589113 | 3300026067 | Bacteria | 974 |
| 180 | Ga0207678_10729026 | 3300026067 | Bacteria | 873 |
| 181 | Ga0207641_11826677 | 3300026088 | Bacteria | 609 |
| 182 | Ga0207648_10862809 | 3300026089 | Bacteria | 844 |
| 183 | Ga0207676_10980969 | 3300026095 | Bacteria | 832 |
| 184 | Ga0207675_101252994 | 3300026118 | Bacteria | 762 |
| 185 | Ga0207675_101422610 | 3300026118 | Bacteria | 714 |
| 186 | Ga0207683_10194830 | 3300026121 | Bacteria | 1841 |
| 187 | Ga0207683_10779318 | 3300026121 | Bacteria | 887 |
| 188 | Ga0207683_11409742 | 3300026121 | Bacteria | 644 |
| 189 | Ga0207698_11583851 | 3300026142 | Bacteria | 670 |
| 190 | Ga0207698_12314957 | 3300026142 | Bacteria | 549 |
| 191 | Ga0209179_1139766 | 3300027512 | Bacteria | 541 |
| 192 | Ga0268266_10342564 | 3300028379 | Bacteria | 1403 |
| 193 | Ga0268266_10453261 | 3300028379 | Bacteria | 1220 |
| 194 | Ga0268266_11272915 | 3300028379 | Bacteria | 711 |
| 195 | Ga0268266_11822065 | 3300028379 | Bacteria | 583 |
| 196 | Ga0268265_11301714 | 3300028380 | Bacteria | 727 |
| 197 | Ga0265337_1095382 | 3300028556 | Bacteria | 810 |
| 198 | Ga0265326_10049477 | 3300028558 | Bacteria | 1191 |
| 199 | Ga0265319_1037075 | 3300028563 | Bacteria | 1664 |
| 200 | Ga0265334_10019489 | 3300028573 | Bacteria | 2790 |
| 201 | Ga0265323_10015921 | 3300028653 | Bacteria | 2946 |
| 202 | Ga0265336_10001725 | 3300028666 | Bacteria | 9598 |
| 203 | Ga0307517_10000248 | 3300028786 | Bacteria | 92084 |
| 204 | Ga0307515_10016931 | 3300028794 | Bacteria | 13324 |
| 205 | Ga0265338_10008662 | 3300028800 | Bacteria | 12306 |
| 206 | Ga0265338_10552473 | 3300028800 | Bacteria | 806 |
| 207 | Ga0265324_10079547 | 3300029957 | Bacteria | 1115 |
| 208 | Ga0265330_10000594 | 3300031235 | Bacteria | 23527 |
| 209 | Ga0265332_10001016 | 3300031238 | Bacteria | 16566 |
| 210 | Ga0265328_10100854 | 3300031239 | Bacteria | 1069 |
| 211 | Ga0265329_10009316 | 3300031242 | Bacteria | 3669 |
| 212 | Ga0265331_10000422 | 3300031250 | Bacteria | 42940 |
| 213 | Ga0265327_10007198 | 3300031251 | Bacteria | 8646 |
| 214 | Ga0265316_10127171 | 3300031344 | Bacteria | 1921 |
| 215 | Ga0307513_10286178 | 3300031456 | Bacteria | 1423 |
| 216 | Ga0307508_10023583 | 3300031616 | Bacteria | 5587 |
| 217 | Ga0307508_10031735 | 3300031616 | Bacteria | 4774 |
| 218 | Ga0265314_10012408 | 3300031711 | Bacteria | 6955 |
| 219 | Ga0307516_10023476 | 3300031730 | Bacteria | 6321 |
| 220 | Ga0307516_10164494 | 3300031730 | Bacteria | 1965 |
| 221 | Ga0307516_10395510 | 3300031730 | Bacteria | 1042 |
| 222 | Ga0307405_10090917 | 3300031731 | Bacteria | 2021 |
| 223 | Ga0307413_11886079 | 3300031824 | Bacteria | 537 |
| 224 | Ga0307406_10765182 | 3300031901 | Bacteria | 812 |
| 225 | Ga0307412_10601484 | 3300031911 | Bacteria | 931 |
| 226 | Ga0307416_102892571 | 3300032002 | Bacteria | 574 |
| 227 | Ga0307414_12203363 | 3300032004 | Bacteria | 515 |
| 228 | Ga0307510_10403869 | 3300033180 | Bacteria | 809 |
| 229 | Ga0307510_10421748 | 3300033180 | Bacteria | 776 |
| 230 | Ga0373928_0158136 | 3300035084 | Bacteria | 632 |
| 231 | Ga0373929_0072431 | 3300035085 | Bacteria | 826 |
| 232 | Ga0373949_0215927 | 3300035090 | Bacteria | 581 |
| 233 | Ga0373943_0313765 | 3300035170 | Bacteria | 893 |
| 234 | Ga0373946_0611905 | 3300035171 | Bacteria | 565 |
| 235 | Ga0373962_0111007 | 3300035242 | Bacteria | 865 |
| 236 | Ga0373927_0043019 | 3300035695 | Bacteria | 2926 |
| 237 | Ga0373927_0070175 | 3300035695 | Bacteria | 2268 |
| 238 | Ga0373947_0258533 | 3300035725 | Bacteria | 1153 |
| 239 | Ga0373937_0421529 | 3300036401 | Bacteria | 1267 |
| 240 | Ga0373925_0029655 | 3300037068 | Bacteria | 4014 |
| 241 | Ga0373925_0735221 | 3300037068 | Bacteria | 813 |
| 242 | Ga0373925_1632993 | 3300037068 | Bacteria | 527 |
| 243 | Ga0395899_0013514 | 3300037312 | Bacteria | 6241 |
| 244 | Ga0395900_0013552 | 3300037418 | Bacteria | 8327 |
| 245 | Ga0395900_0062620 | 3300037418 | Bacteria | 3824 |
| 246 | Ga0395900_0110906 | 3300037418 | Bacteria | 2818 |
| 247 | Ga0395898_0066817 | 3300037466 | Bacteria | 3482 |
| 248 | Ga0395905_0121603 | 3300037471 | Bacteria | 2454 |
| 249 | Ga0395905_0345630 | 3300037471 | Bacteria | 1379 |
| 250 | Ga0436364_0728813 | 3300037853 | Bacteria | 519 |
| 251 | Ga0395901_0054673 | 3300038443 | Bacteria | 4149 |
| 252 | Ga0436365_0620439 | 3300039437 | Bacteria | 790 |
| 253 | Ga0436365_1780836 | 3300039437 | Bacteria | 1972 |
| 254 | Ga0436361_1008973 | 3300039447 | Bacteria | 827 |
| 255 | Ga0439465_0141023 | 3300041413 | Bacteria | 856 |
| 256 | Ga0451793_0336403 | 3300041452 | Bacteria | 1138 |
| 257 | Ga0451793_1575468 | 3300041452 | Bacteria | 617 |
| 258 | Ga0451797_0432824 | 3300041453 | Bacteria | 542 |
| 259 | Ga0451800_0511826 | 3300041459 | Bacteria | 660 |
| 260 | Ga0451802_0941259 | 3300041460 | Bacteria | 562 |
| 261 | Ga0451802_1754088 | 3300041460 | Bacteria | 576 |
| 262 | Ga0451807_0031962 | 3300041486 | Bacteria | 579 |
| 263 | Ga0451843_0439534 | 3300041509 | Bacteria | 524 |
| 264 | Ga0451843_1048452 | 3300041509 | Bacteria | 507 |
| 265 | Ga0451853_1754813 | 3300041512 | Bacteria | 692 |
| 266 | Ga0451853_3497136 | 3300041512 | Bacteria | 685 |
| 267 | Ga0450919_000598 | 3300042121 | Bacteria | 4565 |
| 268 | Ga0450918_000139 | 3300042531 | Bacteria | 15860 |
| 269 | Ga0450893_0137059 | 3300042532 | Bacteria | 520 |
| 270 | Ga0466982_0146911 | 3300044672 | Bacteria | 1444 |
| 271 | Ga0466965_0032899 | 3300044683 | Bacteria | 2533 |
| 272 | Ga0466970_0047796 | 3300044765 | Bacteria | 2281 |
| 273 | Ga0466967_1050575 | 3300045976 | Bacteria | 811 |
| 274 | Ga0495590_0043238 | 3300046457 | Bacteria | 1571 |
| 275 | Ga0495629_0367713 | 3300046459 | Bacteria | 980 |
| 276 | Ga0495638_0504354 | 3300046460 | Bacteria | 609 |
| 277 | Ga0495580_0344446 | 3300046472 | Bacteria | 1010 |
| 278 | Ga0495580_0573339 | 3300046472 | Bacteria | 748 |
| 279 | Ga0495582_0135380 | 3300046473 | Bacteria | 1394 |
| 280 | Ga0495605_0055183 | 3300046474 | Bacteria | 1921 |
| 281 | Ga0495639_0528555 | 3300046475 | Bacteria | 603 |
| 282 | Ga0495664_0906603 | 3300046477 | Bacteria | 515 |
| 283 | Ga0495584_0078905 | 3300046491 | Bacteria | 1656 |
| 284 | Ga0495596_0207340 | 3300046500 | Bacteria | 761 |
| 285 | Ga0495607_0014959 | 3300046501 | Bacteria | 5044 |
| 286 | Ga0495583_0029901 | 3300046506 | Bacteria | 2660 |
| 287 | Ga0495616_0050104 | 3300046513 | Bacteria | 2089 |
| 288 | Ga0495616_0118457 | 3300046513 | Bacteria | 1224 |
| 289 | Ga0495616_0397343 | 3300046513 | Bacteria | 567 |
| 290 | Ga0495628_1218504 | 3300046516 | Bacteria | 510 |
| 291 | Ga0495630_0325185 | 3300046517 | Bacteria | 1176 |
| 292 | Ga0495632_0315008 | 3300046519 | Bacteria | 692 |
| 293 | Ga0495643_0014879 | 3300046522 | Bacteria | 4616 |
| 294 | Ga0495643_0198006 | 3300046522 | Bacteria | 966 |
| 295 | Ga0495642_0032629 | 3300046528 | Bacteria | 2090 |
| 296 | Ga0495652_0988850 | 3300046529 | Bacteria | 551 |
| 297 | Ga0495640_0807949 | 3300046533 | Bacteria | 559 |
| 298 | Ga0495586_0309746 | 3300046535 | Bacteria | 905 |
| 299 | Ga0495598_0161174 | 3300046537 | Bacteria | 789 |
| 300 | Ga0495609_0000250 | 3300046538 | Bacteria | 50865 |
| 301 | Ga0495609_0126800 | 3300046538 | Bacteria | 1095 |
| 302 | Ga0495597_0103454 | 3300046542 | Bacteria | 1199 |
| 303 | Ga0495656_0251836 | 3300046615 | Bacteria | 892 |
| 304 | Ga0495668_0007063 | 3300046616 | Bacteria | 7232 |
| 305 | Ga0495668_0278599 | 3300046616 | Bacteria | 916 |
| 306 | Ga0495625_0004342 | 3300046660 | Bacteria | 13462 |
| 307 | Ga0495635_0544889 | 3300046663 | Bacteria | 761 |
| 308 | Ga0495659_0002327 | 3300046664 | Bacteria | 6143 |
| 309 | Ga0495661_0037047 | 3300046665 | Bacteria | 3047 |
| 310 | Ga0495661_0622385 | 3300046665 | Bacteria | 506 |
| 311 | Ga0495588_0344101 | 3300046674 | Bacteria | 784 |
| 312 | Ga0495658_0157130 | 3300046683 | Bacteria | 1400 |
| 313 | Ga0495658_0312283 | 3300046683 | Bacteria | 995 |
| 314 | Ga0495669_0006526 | 3300046684 | Bacteria | 4877 |
| 315 | Ga0495613_0452238 | 3300046689 | Bacteria | 870 |
| 316 | Ga0495624_0370665 | 3300046690 | Bacteria | 861 |
| 317 | Ga0495649_0048100 | 3300046694 | Bacteria | 2318 |
| 318 | Ga0495649_0141041 | 3300046694 | Bacteria | 1268 |
| 319 | Ga0495589_0201908 | 3300046794 | Bacteria | 938 |
| 320 | Ga0495660_0017643 | 3300046810 | Bacteria | 4107 |
| 321 | Ga0495581_0254416 | 3300047315 | Bacteria | 1027 |
| 322 | Ga0495636_0054681 | 3300047318 | Bacteria | 1677 |
| 323 | Ga0495674_0060099 | 3300047319 | Bacteria | 3317 |
| 324 | Ga0495672_0005757 | 3300047320 | Bacteria | 9760 |
| 325 | Ga0495672_0014599 | 3300047320 | Bacteria | 5370 |
| 326 | Ga0495687_010538 | 3300047443 | Bacteria | 5062 |
| 327 | Ga0495677_0004241 | 3300047445 | Bacteria | 5521 |
| 328 | Ga0495677_0447468 | 3300047445 | Bacteria | 512 |
| 329 | Ga0495685_022954 | 3300047447 | Bacteria | 2146 |
| 330 | Ga0495681_0002977 | 3300047470 | Bacteria | 11929 |
| 331 | Ga0495686_0469622 | 3300047472 | Bacteria | 666 |
| 332 | Ga0495602_0632271 | 3300048088 | Bacteria | 733 |
| 333 | Ga0495626_0171027 | 3300048091 | Bacteria | 906 |
| 334 | Ga0496100_0234847 | 3300048903 | Bacteria | 1350 |
| 335 | Ga0496101_0156508 | 3300048904 | Bacteria | 1746 |
| 336 | Ga0496101_0227990 | 3300048904 | Bacteria | 1447 |
| 337 | Ga0496101_1234763 | 3300048904 | Bacteria | 585 |
| 338 | Ga0496102_1000166 | 3300048905 | Bacteria | 757 |
| 339 | Ga0496102_1797321 | 3300048905 | Bacteria | 530 |
| 340 | Ga0496103_0013657 | 3300048906 | Bacteria | 4818 |
| 341 | Ga0496104_0195365 | 3300048907 | Bacteria | 1935 |
| 342 | Ga0496104_0616555 | 3300048907 | Bacteria | 995 |
| 343 | Ga0496104_1878457 | 3300048907 | Bacteria | 501 |
| 344 | Ga0496105_0437659 | 3300048908 | Bacteria | 1033 |
| 345 | Ga0496106_0306860 | 3300048909 | Bacteria | 1273 |
| 346 | Ga0496106_1519211 | 3300048909 | Bacteria | 515 |
| 347 | Ga0496107_0072472 | 3300048910 | Bacteria | 2504 |
| 348 | Ga0496108_0041859 | 3300048911 | Bacteria | 3825 |
| 349 | Ga0496108_0414968 | 3300048911 | Bacteria | 1176 |
| 350 | Ga0496108_0978137 | 3300048911 | Bacteria | 724 |
| 351 | Ga0496109_0681399 | 3300048912 | Bacteria | 965 |
| 352 | Ga0496109_1184969 | 3300048912 | Bacteria | 701 |
| 353 | Ga0496110_0189545 | 3300048913 | Bacteria | 1867 |
| 354 | Ga0496110_0369947 | 3300048913 | Bacteria | 1306 |
| 355 | Ga0496111_0029844 | 3300048914 | Bacteria | 3874 |
| 356 | Ga0496112_0247730 | 3300048915 | Bacteria | 1733 |
| 357 | Ga0496113_0295947 | 3300048916 | Bacteria | 1295 |
| 358 | Ga0496114_0018797 | 3300048917 | Bacteria | 5592 |
| 359 | Ga0496114_0068642 | 3300048917 | Bacteria | 2976 |
| 360 | Ga0496114_0426274 | 3300048917 | Bacteria | 1175 |
| 361 | Ga0496115_0036050 | 3300048918 | Bacteria | 3915 |
| 362 | Ga0496116_0003489 | 3300048919 | Bacteria | 15474 |
| 363 | Ga0496118_0172260 | 3300048921 | Bacteria | 1320 |
| 364 | Ga0496121_0447776 | 3300048924 | Bacteria | 833 |
| 365 | Ga0496126_0543787 | 3300048929 | Bacteria | 923 |
| 366 | Ga0501031_0320547 | 3300049568 | Bacteria | 1004 |
| 367 | Ga0501032_0006487 | 3300049569 | Bacteria | 8605 |
| 368 | Ga0501033_0216377 | 3300049570 | Bacteria | 1365 |
| 369 | Ga0501034_0000031 | 3300049571 | Bacteria | 244022 |
| 370 | Ga0501036_0422550 | 3300049572 | Bacteria | 1111 |
| 371 | Ga0501036_0565241 | 3300049572 | Bacteria | 944 |
| 372 | Ga0501037_0015345 | 3300049573 | Bacteria | 5636 |
| 373 | Ga0501038_0206615 | 3300049574 | Bacteria | 1573 |
| 374 | Ga0501039_0016592 | 3300049575 | Bacteria | 5641 |
| 375 | Ga0501039_0624973 | 3300049575 | Bacteria | 844 |
| 376 | Ga0501042_0958756 | 3300049578 | Bacteria | 623 |
| 377 | Ga0501043_0027504 | 3300049579 | Bacteria | 4464 |
| 378 | Ga0501047_0001332 | 3300049581 | Bacteria | 24241 |
| 379 | Ga0501047_0162771 | 3300049581 | Bacteria | 2103 |
| 380 | Ga0501048_0553662 | 3300049582 | Bacteria | 825 |
| 381 | Ga0501067_0002583 | 3300049583 | Bacteria | 10003 |
| 382 | Ga0501067_0463811 | 3300049583 | Bacteria | 708 |
| 383 | Ga0501070_0041408 | 3300049586 | Bacteria | 3838 |
| 384 | Ga0501073_0013629 | 3300049589 | Bacteria | 5915 |
| 385 | Ga0501073_0698430 | 3300049589 | Bacteria | 700 |
| 386 | Ga0501080_0000483 | 3300049742 | Bacteria | 30977 |
| 387 | Ga0501083_0090604 | 3300049744 | Bacteria | 2020 |
| 388 | Ga0501241_137253 | 3300049758 | Bacteria | 555 |
| 389 | Ga0501035_0001140 | 3300049822 | Bacteria | 27786 |
| 390 | Ga0501035_0096031 | 3300049822 | Bacteria | 2605 |
| 391 | Ga0501044_0000013 | 3300049823 | Bacteria | 248795 |
| 392 | Ga0501044_0681424 | 3300049823 | Bacteria | 915 |
| 393 | Ga0501045_0019419 | 3300049824 | Bacteria | 4845 |
| 394 | nmdc:mga03683_322505_c1 | 3300050489 | Bacteria | 727 |
| 395 | nmdc:mga03n38_45608_c1 | 3300050490 | Bacteria | 1931 |
| 396 | nmdc:mga03n38_532418_c1 | 3300050490 | Bacteria | 663 |
| 397 | nmdc:mga00v17_537460_c1 | 3300050491 | Bacteria | 756 |
| 398 | nmdc:mga00v17_756965_c1 | 3300050491 | Bacteria | 621 |
| 399 | nmdc:mga0yw44_232942_c1 | 3300050492 | Bacteria | 1223 |
| 400 | nmdc:mga0k408_765129_c1 | 3300050493 | Bacteria | 564 |
| 401 | nmdc:mga06z11_409692_c1 | 3300050494 | Bacteria | 816 |
| 402 | nmdc:mga06z11_461817_c1 | 3300050494 | Bacteria | 768 |
| 403 | nmdc:mga07m45_335172_c1 | 3300050496 | Bacteria | 879 |
| 404 | nmdc:mga06r32_158354_c1 | 3300050510 | Bacteria | 2246 |
| 405 | nmdc:mga0sz30_10704_c1 | 3300050516 | Bacteria | 3520 |
| 406 | Ga0495601_0353022 | 3300053077 | Bacteria | 956 |
| 407 | Ga0495601_0736450 | 3300053077 | Bacteria | 628 |
| 408 | Ga0495612_0155108 | 3300053078 | Bacteria | 998 |
| 409 | Ga0495595_0158073 | 3300053084 | Bacteria | 1117 |
| 410 | Ga0495595_0699226 | 3300053084 | Bacteria | 520 |
| 411 | Ga0495619_0139735 | 3300053085 | Bacteria | 1667 |
| 412 | Ga0500647_0139182 | 3300053091 | Bacteria | 1140 |
| 413 | Ga0500572_134246 | 3300053111 | Bacteria | 805 |
| 414 | Ga0500607_062335 | 3300053121 | Bacteria | 1949 |
| 415 | Ga0500573_0214965 | 3300053140 | Bacteria | 1012 |
| 416 | Ga0500573_0296097 | 3300053140 | Bacteria | 811 |
| 417 | Ga0500604_0174305 | 3300053151 | Bacteria | 736 |
| 418 | Ga0500616_0033482 | 3300053153 | Bacteria | 2804 |
| 419 | Ga0500570_068143 | 3300053724 | Bacteria | 1677 |
| 420 | Ga0500645_060294 | 3300053730 | Bacteria | 1098 |
| 421 | Ga0587088_209674 | 3300059508 | Bacteria | 502 |
| 422 | Ga0501082_0003443 | 3300060353 | Bacteria | 13811 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053084 | Ga0495595_0699226 | Ga0495595_0699226_276_479 | 67 |
| 2 | 3300025935 | Ga0207709_11328737 | Ga0207709_113287371 | 69 |
| 3 | 3300003316 | rootH1_10053722 | rootH1_100537222 | 71 |
| 4 | 3300013296 | Ga0157374_10115074 | Ga0157374_101150742 | 72 |
| 5 | 3300005339 | Ga0070660_100026119 | Ga0070660_1000261194 | 73 |
| 6 | 3300005344 | Ga0070661_100000913 | Ga0070661_10000091311 | 73 |
| 7 | 3300005457 | Ga0070662_100107856 | Ga0070662_1001078561 | 73 |
| 8 | 3300005564 | Ga0070664_100005480 | Ga0070664_10000548010 | 73 |
| 9 | 3300025919 | Ga0207657_10084991 | Ga0207657_100849914 | 73 |
| 10 | 3300025920 | Ga0207649_10005436 | Ga0207649_100054362 | 73 |
| 11 | 3300025932 | Ga0207690_10004882 | Ga0207690_100048828 | 73 |
| 12 | 3300025933 | Ga0207706_10105471 | Ga0207706_101054711 | 73 |
| 13 | 3300025945 | Ga0207679_10000225 | Ga0207679_1000022521 | 73 |
| 14 | 3300026067 | Ga0207678_10127084 | Ga0207678_101270842 | 73 |
| 15 | 3300026118 | Ga0207675_101252994 | Ga0207675_1012529942 | 73 |
| 16 | 3300041486 | Ga0451807_0031962 | Ga0451807_0031962_19_240 | 73 |
| 17 | 3300042121 | Ga0450919_000598 | Ga0450919_000598_3042_3263 | 73 |
| 18 | 3300042531 | Ga0450918_000139 | Ga0450918_000139_1650_1871 | 73 |
| 19 | 3300048904 | Ga0496101_0156508 | Ga0496101_0156508_653_874 | 73 |
| 20 | 3300048907 | Ga0496104_0616555 | Ga0496104_0616555_278_499 | 73 |
| 21 | 3300048908 | Ga0496105_0437659 | Ga0496105_0437659_616_837 | 73 |
| 22 | 3300048913 | Ga0496110_0369947 | Ga0496110_0369947_1073_1294 | 73 |
| 23 | 3300048917 | Ga0496114_0068642 | Ga0496114_0068642_1457_1678 | 73 |
| 24 | iso_pu_bacteria | 2643221733 | 2644729651 | 73 |
| 25 | iso_pu_bacteria | 2841760612 | 2841764657 | 73 |
| 26 | iso_pu_bacteria | 2844104063 | 2844107895 | 73 |
| 27 | iso_pu_bacteria | 2851182111 | 2851183897 | 73 |
| 28 | iso_pu_bacteria | 2851246043 | 2851250001 | 73 |
| 29 | iso_pu_bacteria | 2894817345 | 2894820970 | 73 |
| 30 | iso_pu_bacteria | 8057529695 | 8057533271 | 73 |
| 31 | 3300009177 | Ga0105248_10128086 | Ga0105248_101280865 | 74 |
| 32 | 3300013306 | Ga0163162_10089882 | Ga0163162_100898823 | 74 |
| 33 | 3300013308 | Ga0157375_10002699 | Ga0157375_1000269911 | 74 |
| 34 | 3300048907 | Ga0496104_1878457 | Ga0496104_1878457_95_388 | 74 |
| 35 | iso_pu_bacteria | 2842747753 | 2842750350 | 74 |
| 36 | 3300005543 | Ga0070672_101375192 | Ga0070672_1013751922 | 75 |
| 37 | 3300005548 | Ga0070665_100849123 | Ga0070665_1008491232 | 75 |
| 38 | 3300025972 | Ga0207668_11427414 | Ga0207668_114274141 | 75 |
| 39 | 3300028379 | Ga0268266_10453261 | Ga0268266_104532612 | 75 |
| 40 | 3300005356 | Ga0070674_100488039 | Ga0070674_1004880392 | 76 |
| 41 | 3300005367 | Ga0070667_101295694 | Ga0070667_1012956941 | 76 |
| 42 | 3300005455 | Ga0070663_101394044 | Ga0070663_1013940442 | 76 |
| 43 | 3300005615 | Ga0070702_101410503 | Ga0070702_1014105032 | 76 |
| 44 | 3300006038 | Ga0075365_10407798 | Ga0075365_104077982 | 76 |
| 45 | 3300006038 | Ga0075365_10782741 | Ga0075365_107827412 | 76 |
| 46 | 3300014326 | Ga0157380_10868938 | Ga0157380_108689381 | 76 |
| 47 | 3300014968 | Ga0157379_10036753 | Ga0157379_100367533 | 76 |
| 48 | 3300025315 | Ga0207697_10048136 | Ga0207697_100481362 | 76 |
| 49 | 3300025931 | Ga0207644_10795494 | Ga0207644_107954942 | 76 |
| 50 | 3300025935 | Ga0207709_10941747 | Ga0207709_109417472 | 76 |
| 51 | 3300025941 | Ga0207711_10509366 | Ga0207711_105093662 | 76 |
| 52 | 3300025986 | Ga0207658_11692660 | Ga0207658_116926602 | 76 |
| 53 | 3300026023 | Ga0207677_11564162 | Ga0207677_115641622 | 76 |
| 54 | 3300026067 | Ga0207678_10729026 | Ga0207678_107290262 | 76 |
| 55 | 3300026095 | Ga0207676_10980969 | Ga0207676_109809691 | 76 |
| 56 | 3300026121 | Ga0207683_10779318 | Ga0207683_107793182 | 76 |
| 57 | 3300031456 | Ga0307513_10286178 | Ga0307513_102861782 | 76 |
| 58 | 3300031730 | Ga0307516_10395510 | Ga0307516_103955101 | 76 |
| 59 | 3300031824 | Ga0307413_11886079 | Ga0307413_118860791 | 76 |
| 60 | 3300032002 | Ga0307416_102892571 | Ga0307416_1028925712 | 76 |
| 61 | 3300032004 | Ga0307414_12203363 | Ga0307414_122033632 | 76 |
| 62 | 3300035170 | Ga0373943_0313765 | Ga0373943_0313765_118_384 | 76 |
| 63 | 3300037068 | Ga0373925_0735221 | Ga0373925_0735221_39_305 | 76 |
| 64 | 3300046472 | Ga0495580_0573339 | Ga0495580_0573339_262_528 | 76 |
| 65 | 3300046473 | Ga0495582_0135380 | Ga0495582_0135380_713_979 | 76 |
| 66 | 3300046475 | Ga0495639_0528555 | Ga0495639_0528555_53_319 | 76 |
| 67 | 3300046513 | Ga0495616_0397343 | Ga0495616_0397343_205_468 | 76 |
| 68 | 3300046538 | Ga0495609_0126800 | Ga0495609_0126800_64_327 | 76 |
| 69 | 3300046616 | Ga0495668_0278599 | Ga0495668_0278599_386_649 | 76 |
| 70 | 3300046683 | Ga0495658_0157130 | Ga0495658_0157130_1074_1340 | 76 |
| 71 | 3300046689 | Ga0495613_0452238 | Ga0495613_0452238_480_746 | 76 |
| 72 | 3300047315 | Ga0495581_0254416 | Ga0495581_0254416_208_474 | 76 |
| 73 | 3300047445 | Ga0495677_0447468 | Ga0495677_0447468_44_307 | 76 |
| 74 | 3300048909 | Ga0496106_1519211 | Ga0496106_1519211_31_294 | 76 |
| 75 | 3300048917 | Ga0496114_0426274 | Ga0496114_0426274_696_959 | 76 |
| 76 | 3300050494 | nmdc:mga06z11_409692_c1 | nmdc:mga06z11_409692_c1_46_309 | 76 |
| 77 | iso_pu_bacteria | 2602042107 | 2603862504 | 76 |
| 78 | 3300003203 | JGI25406J46586_10010893 | JGI25406J46586_100108931 | 77 |
| 79 | 3300003316 | rootH1_10043406 | rootH1_100434061 | 77 |
| 80 | 3300003322 | rootL2_10166897 | rootL2_101668972 | 77 |
| 81 | 3300005327 | Ga0070658_10630988 | Ga0070658_106309882 | 77 |
| 82 | 3300005329 | Ga0070683_100874740 | Ga0070683_1008747401 | 77 |
| 83 | 3300005330 | Ga0070690_100403164 | Ga0070690_1004031642 | 77 |
| 84 | 3300005331 | Ga0070670_100406226 | Ga0070670_1004062263 | 77 |
| 85 | 3300005331 | Ga0070670_100719015 | Ga0070670_1007190151 | 77 |
| 86 | 3300005331 | Ga0070670_100964071 | Ga0070670_1009640712 | 77 |
| 87 | 3300005331 | Ga0070670_102113791 | Ga0070670_1021137911 | 77 |
| 88 | 3300005334 | Ga0068869_101448898 | Ga0068869_1014488981 | 77 |
| 89 | 3300005336 | Ga0070680_100025425 | Ga0070680_1000254253 | 77 |
| 90 | 3300005336 | Ga0070680_100820095 | Ga0070680_1008200951 | 77 |
| 91 | 3300005340 | Ga0070689_102233043 | Ga0070689_1022330432 | 77 |
| 92 | 3300005354 | Ga0070675_100574443 | Ga0070675_1005744432 | 77 |
| 93 | 3300005355 | Ga0070671_101082329 | Ga0070671_1010823291 | 77 |
| 94 | 3300005366 | Ga0070659_100962568 | Ga0070659_1009625681 | 77 |
| 95 | 3300005456 | Ga0070678_100563678 | Ga0070678_1005636782 | 77 |
| 96 | 3300005456 | Ga0070678_101348785 | Ga0070678_1013487852 | 77 |
| 97 | 3300005456 | Ga0070678_101718355 | Ga0070678_1017183552 | 77 |
| 98 | 3300005458 | Ga0070681_10332017 | Ga0070681_103320172 | 77 |
| 99 | 3300005459 | Ga0068867_101124080 | Ga0068867_1011240802 | 77 |
| 100 | 3300005459 | Ga0068867_101541566 | Ga0068867_1015415662 | 77 |
| 101 | 3300005467 | Ga0070706_100115858 | Ga0070706_1001158583 | 77 |
| 102 | 3300005518 | Ga0070699_100227587 | Ga0070699_1002275873 | 77 |
| 103 | 3300005530 | Ga0070679_100019961 | Ga0070679_1000199616 | 77 |
| 104 | 3300005536 | Ga0070697_100053070 | Ga0070697_1000530705 | 77 |
| 105 | 3300005539 | Ga0068853_100003225 | Ga0068853_10000322512 | 77 |
| 106 | 3300005539 | Ga0068853_100988830 | Ga0068853_1009888302 | 77 |
| 107 | 3300005539 | Ga0068853_102304120 | Ga0068853_1023041202 | 77 |
| 108 | 3300005544 | Ga0070686_100987551 | Ga0070686_1009875512 | 77 |
| 109 | 3300005548 | Ga0070665_100072518 | Ga0070665_1000725183 | 77 |
| 110 | 3300005548 | Ga0070665_100688288 | Ga0070665_1006882882 | 77 |
| 111 | 3300005563 | Ga0068855_100004282 | Ga0068855_1000042824 | 77 |
| 112 | 3300005564 | Ga0070664_101920552 | Ga0070664_1019205522 | 77 |
| 113 | 3300005577 | Ga0068857_101461405 | Ga0068857_1014614051 | 77 |
| 114 | 3300005718 | Ga0068866_10813123 | Ga0068866_108131231 | 77 |
| 115 | 3300005840 | Ga0068870_10482577 | Ga0068870_104825772 | 77 |
| 116 | 3300005841 | Ga0068863_100008703 | Ga0068863_1000087039 | 77 |
| 117 | 3300005842 | Ga0068858_100163307 | Ga0068858_1001633072 | 77 |
| 118 | 3300005842 | Ga0068858_100766464 | Ga0068858_1007664641 | 77 |
| 119 | 3300005844 | Ga0068862_101996572 | Ga0068862_1019965722 | 77 |
| 120 | 3300005985 | Ga0081539_10002935 | Ga0081539_100029357 | 77 |
| 121 | 3300006038 | Ga0075365_10130579 | Ga0075365_101305791 | 77 |
| 122 | 3300006038 | Ga0075365_10787672 | Ga0075365_107876722 | 77 |
| 123 | 3300006042 | Ga0075368_10199858 | Ga0075368_101998582 | 77 |
| 124 | 3300006048 | Ga0075363_100064176 | Ga0075363_1000641763 | 77 |
| 125 | 3300006048 | Ga0075363_100763140 | Ga0075363_1007631402 | 77 |
| 126 | 3300006163 | Ga0070715_10108372 | Ga0070715_101083721 | 77 |
| 127 | 3300006175 | Ga0070712_100516972 | Ga0070712_1005169722 | 77 |
| 128 | 3300006178 | Ga0075367_10028768 | Ga0075367_100287684 | 77 |
| 129 | 3300006178 | Ga0075367_10114274 | Ga0075367_101142743 | 77 |
| 130 | 3300006186 | Ga0075369_10005952 | Ga0075369_100059523 | 77 |
| 131 | 3300006195 | Ga0075366_10718067 | Ga0075366_107180672 | 77 |
| 132 | 3300006237 | Ga0097621_100728169 | Ga0097621_1007281692 | 77 |
| 133 | 3300006358 | Ga0068871_100623111 | Ga0068871_1006231112 | 77 |
| 134 | 3300006358 | Ga0068871_101455566 | Ga0068871_1014555662 | 77 |
| 135 | 3300006358 | Ga0068871_102155187 | Ga0068871_1021551872 | 77 |
| 136 | 3300006847 | Ga0075431_101181325 | Ga0075431_1011813252 | 77 |
| 137 | 3300006871 | Ga0075434_100528558 | Ga0075434_1005285582 | 77 |
| 138 | 3300007788 | Ga0099795_10514366 | Ga0099795_105143661 | 77 |
| 139 | 3300009098 | Ga0105245_10490352 | Ga0105245_104903522 | 77 |
| 140 | 3300009101 | Ga0105247_10112923 | Ga0105247_101129232 | 77 |
| 141 | 3300009101 | Ga0105247_10524919 | Ga0105247_105249192 | 77 |
| 142 | 3300009101 | Ga0105247_11132883 | Ga0105247_111328832 | 77 |
| 143 | 3300009174 | Ga0105241_10142505 | Ga0105241_101425053 | 77 |
| 144 | 3300009174 | Ga0105241_10247001 | Ga0105241_102470012 | 77 |
| 145 | 3300009176 | Ga0105242_10000664 | Ga0105242_1000066416 | 77 |
| 146 | 3300009176 | Ga0105242_11108247 | Ga0105242_111082472 | 77 |
| 147 | 3300009176 | Ga0105242_11293146 | Ga0105242_112931461 | 77 |
| 148 | 3300009177 | Ga0105248_10468128 | Ga0105248_104681282 | 77 |
| 149 | 3300009177 | Ga0105248_10847283 | Ga0105248_108472832 | 77 |
| 150 | 3300009177 | Ga0105248_12774042 | Ga0105248_127740422 | 77 |
| 151 | 3300009545 | Ga0105237_10138347 | Ga0105237_101383472 | 77 |
| 152 | 3300009545 | Ga0105237_10966062 | Ga0105237_109660621 | 77 |
| 153 | 3300009545 | Ga0105237_10966966 | Ga0105237_109669662 | 77 |
| 154 | 3300009545 | Ga0105237_12112891 | Ga0105237_121128912 | 77 |
| 155 | 3300009551 | Ga0105238_10302852 | Ga0105238_103028522 | 77 |
| 156 | 3300009551 | Ga0105238_11039885 | Ga0105238_110398851 | 77 |
| 157 | 3300009553 | Ga0105249_10019455 | Ga0105249_100194554 | 77 |
| 158 | 3300010159 | Ga0099796_10033479 | Ga0099796_100334793 | 77 |
| 159 | 3300010159 | Ga0099796_10123512 | Ga0099796_101235121 | 77 |
| 160 | 3300010375 | Ga0105239_10003689 | Ga0105239_1000368915 | 77 |
| 161 | 3300011119 | Ga0105246_10805185 | Ga0105246_108051852 | 77 |
| 162 | 3300011119 | Ga0105246_11571494 | Ga0105246_115714942 | 77 |
| 163 | 3300013100 | Ga0157373_10519370 | Ga0157373_105193702 | 77 |
| 164 | 3300013297 | Ga0157378_11791776 | Ga0157378_117917762 | 77 |
| 165 | 3300013297 | Ga0157378_12917673 | Ga0157378_129176731 | 77 |
| 166 | 3300013306 | Ga0163162_11162948 | Ga0163162_111629482 | 77 |
| 167 | 3300013306 | Ga0163162_11255121 | Ga0163162_112551212 | 77 |
| 168 | 3300013306 | Ga0163162_11701451 | Ga0163162_117014511 | 77 |
| 169 | 3300013306 | Ga0163162_13457819 | Ga0163162_134578191 | 77 |
| 170 | 3300013308 | Ga0157375_11778593 | Ga0157375_117785932 | 77 |
| 171 | 3300013308 | Ga0157375_12569063 | Ga0157375_125690631 | 77 |
| 172 | 3300013308 | Ga0157375_12786495 | Ga0157375_127864952 | 77 |
| 173 | 3300014325 | Ga0163163_12120796 | Ga0163163_121207962 | 77 |
| 174 | 3300014326 | Ga0157380_10247869 | Ga0157380_102478692 | 77 |
| 175 | 3300014745 | Ga0157377_10687017 | Ga0157377_106870172 | 77 |
| 176 | 3300014968 | Ga0157379_11391491 | Ga0157379_113914911 | 77 |
| 177 | 3300017792 | Ga0163161_10213435 | Ga0163161_102134353 | 77 |
| 178 | 3300017792 | Ga0163161_10614218 | Ga0163161_106142182 | 77 |
| 179 | 3300017792 | Ga0163161_11093251 | Ga0163161_110932511 | 77 |
| 180 | 3300021361 | Ga0213872_10288225 | Ga0213872_102882251 | 77 |
| 181 | 3300021384 | Ga0213876_10240954 | Ga0213876_102409542 | 77 |
| 182 | 3300022467 | Ga0224712_10366208 | Ga0224712_103662082 | 77 |
| 183 | 3300025295 | Ga0209564_1007718 | Ga0209564_10077186 | 77 |
| 184 | 3300025315 | Ga0207697_10520874 | Ga0207697_105208742 | 77 |
| 185 | 3300025903 | Ga0207680_11028207 | Ga0207680_110282071 | 77 |
| 186 | 3300025905 | Ga0207685_10391751 | Ga0207685_103917512 | 77 |
| 187 | 3300025908 | Ga0207643_10362148 | Ga0207643_103621482 | 77 |
| 188 | 3300025909 | Ga0207705_10599518 | Ga0207705_105995182 | 77 |
| 189 | 3300025911 | Ga0207654_10290224 | Ga0207654_102902242 | 77 |
| 190 | 3300025911 | Ga0207654_10995632 | Ga0207654_109956322 | 77 |
| 191 | 3300025911 | Ga0207654_11263608 | Ga0207654_112636082 | 77 |
| 192 | 3300025912 | Ga0207707_10327989 | Ga0207707_103279892 | 77 |
| 193 | 3300025914 | Ga0207671_10159187 | Ga0207671_101591872 | 77 |
| 194 | 3300025914 | Ga0207671_10588270 | Ga0207671_105882702 | 77 |
| 195 | 3300025914 | Ga0207671_10801851 | Ga0207671_108018511 | 77 |
| 196 | 3300025915 | Ga0207693_10574732 | Ga0207693_105747321 | 77 |
| 197 | 3300025917 | Ga0207660_10037239 | Ga0207660_100372392 | 77 |
| 198 | 3300025920 | Ga0207649_10169999 | Ga0207649_101699992 | 77 |
| 199 | 3300025921 | Ga0207652_10062676 | Ga0207652_100626763 | 77 |
| 200 | 3300025924 | Ga0207694_10463502 | Ga0207694_104635022 | 77 |
| 201 | 3300025925 | Ga0207650_10982160 | Ga0207650_109821601 | 77 |
| 202 | 3300025926 | Ga0207659_10127146 | Ga0207659_101271463 | 77 |
| 203 | 3300025927 | Ga0207687_10407888 | Ga0207687_104078883 | 77 |
| 204 | 3300025932 | Ga0207690_11402729 | Ga0207690_114027292 | 77 |
| 205 | 3300025934 | Ga0207686_10004921 | Ga0207686_100049218 | 77 |
| 206 | 3300025934 | Ga0207686_10041741 | Ga0207686_100417415 | 77 |
| 207 | 3300025934 | Ga0207686_10054501 | Ga0207686_100545013 | 77 |
| 208 | 3300025934 | Ga0207686_10316261 | Ga0207686_103162613 | 77 |
| 209 | 3300025936 | Ga0207670_10841525 | Ga0207670_108415251 | 77 |
| 210 | 3300025937 | Ga0207669_10256628 | Ga0207669_102566282 | 77 |
| 211 | 3300025938 | Ga0207704_10120419 | Ga0207704_101204192 | 77 |
| 212 | 3300025938 | Ga0207704_10596650 | Ga0207704_105966502 | 77 |
| 213 | 3300025944 | Ga0207661_10961134 | Ga0207661_109611342 | 77 |
| 214 | 3300025949 | Ga0207667_10005407 | Ga0207667_100054077 | 77 |
| 215 | 3300025961 | Ga0207712_10230623 | Ga0207712_102306233 | 77 |
| 216 | 3300025972 | Ga0207668_10796499 | Ga0207668_107964992 | 77 |
| 217 | 3300026023 | Ga0207677_10646396 | Ga0207677_106463962 | 77 |
| 218 | 3300026035 | Ga0207703_10384165 | Ga0207703_103841652 | 77 |
| 219 | 3300026035 | Ga0207703_10849148 | Ga0207703_108491482 | 77 |
| 220 | 3300026041 | Ga0207639_10000690 | Ga0207639_1000069015 | 77 |
| 221 | 3300026041 | Ga0207639_10450435 | Ga0207639_104504352 | 77 |
| 222 | 3300026067 | Ga0207678_10589113 | Ga0207678_105891132 | 77 |
| 223 | 3300026088 | Ga0207641_11826677 | Ga0207641_118266771 | 77 |
| 224 | 3300026089 | Ga0207648_10862809 | Ga0207648_108628092 | 77 |
| 225 | 3300026118 | Ga0207675_101422610 | Ga0207675_1014226102 | 77 |
| 226 | 3300026121 | Ga0207683_10194830 | Ga0207683_101948302 | 77 |
| 227 | 3300026121 | Ga0207683_11409742 | Ga0207683_114097422 | 77 |
| 228 | 3300026142 | Ga0207698_11583851 | Ga0207698_115838512 | 77 |
| 229 | 3300026142 | Ga0207698_12314957 | Ga0207698_123149571 | 77 |
| 230 | 3300027512 | Ga0209179_1139766 | Ga0209179_11397662 | 77 |
| 231 | 3300028379 | Ga0268266_10342564 | Ga0268266_103425642 | 77 |
| 232 | 3300028379 | Ga0268266_11272915 | Ga0268266_112729152 | 77 |
| 233 | 3300028379 | Ga0268266_11822065 | Ga0268266_118220652 | 77 |
| 234 | 3300028380 | Ga0268265_11301714 | Ga0268265_113017142 | 77 |
| 235 | 3300028556 | Ga0265337_1095382 | Ga0265337_10953821 | 77 |
| 236 | 3300028558 | Ga0265326_10049477 | Ga0265326_100494772 | 77 |
| 237 | 3300028563 | Ga0265319_1037075 | Ga0265319_10370751 | 77 |
| 238 | 3300028573 | Ga0265334_10019489 | Ga0265334_100194893 | 77 |
| 239 | 3300028653 | Ga0265323_10015921 | Ga0265323_100159213 | 77 |
| 240 | 3300028666 | Ga0265336_10001725 | Ga0265336_100017253 | 77 |
| 241 | 3300028786 | Ga0307517_10000248 | Ga0307517_1000024860 | 77 |
| 242 | 3300028794 | Ga0307515_10016931 | Ga0307515_1001693112 | 77 |
| 243 | 3300028800 | Ga0265338_10008662 | Ga0265338_100086623 | 77 |
| 244 | 3300028800 | Ga0265338_10552473 | Ga0265338_105524731 | 77 |
| 245 | 3300029957 | Ga0265324_10079547 | Ga0265324_100795473 | 77 |
| 246 | 3300031235 | Ga0265330_10000594 | Ga0265330_100005944 | 77 |
| 247 | 3300031238 | Ga0265332_10001016 | Ga0265332_100010164 | 77 |
| 248 | 3300031239 | Ga0265328_10100854 | Ga0265328_101008541 | 77 |
| 249 | 3300031242 | Ga0265329_10009316 | Ga0265329_100093164 | 77 |
| 250 | 3300031250 | Ga0265331_10000422 | Ga0265331_100004225 | 77 |
| 251 | 3300031251 | Ga0265327_10007198 | Ga0265327_100071984 | 77 |
| 252 | 3300031344 | Ga0265316_10127171 | Ga0265316_101271712 | 77 |
| 253 | 3300031616 | Ga0307508_10023583 | Ga0307508_100235833 | 77 |
| 254 | 3300031616 | Ga0307508_10031735 | Ga0307508_100317351 | 77 |
| 255 | 3300031711 | Ga0265314_10012408 | Ga0265314_100124084 | 77 |
| 256 | 3300031730 | Ga0307516_10023476 | Ga0307516_100234765 | 77 |
| 257 | 3300031730 | Ga0307516_10164494 | Ga0307516_101644943 | 77 |
| 258 | 3300031731 | Ga0307405_10090917 | Ga0307405_100909173 | 77 |
| 259 | 3300031901 | Ga0307406_10765182 | Ga0307406_107651822 | 77 |
| 260 | 3300031911 | Ga0307412_10601484 | Ga0307412_106014842 | 77 |
| 261 | 3300033180 | Ga0307510_10403869 | Ga0307510_104038692 | 77 |
| 262 | 3300033180 | Ga0307510_10421748 | Ga0307510_104217482 | 77 |
| 263 | 3300035084 | Ga0373928_0158136 | Ga0373928_0158136_15_284 | 77 |
| 264 | 3300035085 | Ga0373929_0072431 | Ga0373929_0072431_175_444 | 77 |
| 265 | 3300035090 | Ga0373949_0215927 | Ga0373949_0215927_273_542 | 77 |
| 266 | 3300035171 | Ga0373946_0611905 | Ga0373946_0611905_119_463 | 77 |
| 267 | 3300035242 | Ga0373962_0111007 | Ga0373962_0111007_96_365 | 77 |
| 268 | 3300035695 | Ga0373927_0043019 | Ga0373927_0043019_1889_2158 | 77 |
| 269 | 3300035695 | Ga0373927_0070175 | Ga0373927_0070175_1163_1426 | 77 |
| 270 | 3300035725 | Ga0373947_0258533 | Ga0373947_0258533_817_1086 | 77 |
| 271 | 3300036401 | Ga0373937_0421529 | Ga0373937_0421529_871_1140 | 77 |
| 272 | 3300037068 | Ga0373925_0029655 | Ga0373925_0029655_2903_3172 | 77 |
| 273 | 3300037068 | Ga0373925_1632993 | Ga0373925_1632993_21_365 | 77 |
| 274 | 3300037312 | Ga0395899_0013514 | Ga0395899_0013514_4614_4865 | 77 |
| 275 | 3300037418 | Ga0395900_0013552 | Ga0395900_0013552_1448_1699 | 77 |
| 276 | 3300037418 | Ga0395900_0062620 | Ga0395900_0062620_723_977 | 77 |
| 277 | 3300037418 | Ga0395900_0110906 | Ga0395900_0110906_1124_1378 | 77 |
| 278 | 3300037466 | Ga0395898_0066817 | Ga0395898_0066817_165_419 | 77 |
| 279 | 3300037471 | Ga0395905_0121603 | Ga0395905_0121603_1237_1488 | 77 |
| 280 | 3300037471 | Ga0395905_0345630 | Ga0395905_0345630_841_1083 | 77 |
| 281 | 3300037853 | Ga0436364_0728813 | Ga0436364_0728813_42_281 | 77 |
| 282 | 3300038443 | Ga0395901_0054673 | Ga0395901_0054673_2495_2746 | 77 |
| 283 | 3300039437 | Ga0436365_0620439 | Ga0436365_0620439_181_429 | 77 |
| 284 | 3300039437 | Ga0436365_1780836 | Ga0436365_1780836_1066_1317 | 77 |
| 285 | 3300039447 | Ga0436361_1008973 | Ga0436361_1008973_197_460 | 77 |
| 286 | 3300041413 | Ga0439465_0141023 | Ga0439465_0141023_600_842 | 77 |
| 287 | 3300041452 | Ga0451793_0336403 | Ga0451793_0336403_72_308 | 77 |
| 288 | 3300041452 | Ga0451793_1575468 | Ga0451793_1575468_259_522 | 77 |
| 289 | 3300041453 | Ga0451797_0432824 | Ga0451797_0432824_86_337 | 77 |
| 290 | 3300041459 | Ga0451800_0511826 | Ga0451800_0511826_322_576 | 77 |
| 291 | 3300041460 | Ga0451802_0941259 | Ga0451802_0941259_285_539 | 77 |
| 292 | 3300041460 | Ga0451802_1754088 | Ga0451802_1754088_227_496 | 77 |
| 293 | 3300041509 | Ga0451843_0439534 | Ga0451843_0439534_216_485 | 77 |
| 294 | 3300041509 | Ga0451843_1048452 | Ga0451843_1048452_88_351 | 77 |
| 295 | 3300041512 | Ga0451853_1754813 | Ga0451853_1754813_78_335 | 77 |
| 296 | 3300041512 | Ga0451853_3497136 | Ga0451853_3497136_54_317 | 77 |
| 297 | 3300042532 | Ga0450893_0137059 | Ga0450893_0137059_228_476 | 77 |
| 298 | 3300044672 | Ga0466982_0146911 | Ga0466982_0146911_939_1187 | 77 |
| 299 | 3300044683 | Ga0466965_0032899 | Ga0466965_0032899_1867_2121 | 77 |
| 300 | 3300044765 | Ga0466970_0047796 | Ga0466970_0047796_335_583 | 77 |
| 301 | 3300045976 | Ga0466967_1050575 | Ga0466967_1050575_424_678 | 77 |
| 302 | 3300046457 | Ga0495590_0043238 | Ga0495590_0043238_832_1089 | 77 |
| 303 | 3300046459 | Ga0495629_0367713 | Ga0495629_0367713_464_733 | 77 |
| 304 | 3300046460 | Ga0495638_0504354 | Ga0495638_0504354_62_319 | 77 |
| 305 | 3300046472 | Ga0495580_0344446 | Ga0495580_0344446_223_471 | 77 |
| 306 | 3300046474 | Ga0495605_0055183 | Ga0495605_0055183_604_861 | 77 |
| 307 | 3300046477 | Ga0495664_0906603 | Ga0495664_0906603_196_465 | 77 |
| 308 | 3300046491 | Ga0495584_0078905 | Ga0495584_0078905_1219_1476 | 77 |
| 309 | 3300046500 | Ga0495596_0207340 | Ga0495596_0207340_376_612 | 77 |
| 310 | 3300046501 | Ga0495607_0014959 | Ga0495607_0014959_4258_4515 | 77 |
| 311 | 3300046506 | Ga0495583_0029901 | Ga0495583_0029901_308_565 | 77 |
| 312 | 3300046513 | Ga0495616_0050104 | Ga0495616_0050104_1505_1756 | 77 |
| 313 | 3300046513 | Ga0495616_0118457 | Ga0495616_0118457_808_1065 | 77 |
| 314 | 3300046516 | Ga0495628_1218504 | Ga0495628_1218504_166_435 | 77 |
| 315 | 3300046517 | Ga0495630_0325185 | Ga0495630_0325185_469_738 | 77 |
| 316 | 3300046519 | Ga0495632_0315008 | Ga0495632_0315008_151_420 | 77 |
| 317 | 3300046522 | Ga0495643_0014879 | Ga0495643_0014879_447_698 | 77 |
| 318 | 3300046522 | Ga0495643_0198006 | Ga0495643_0198006_392_640 | 77 |
| 319 | 3300046528 | Ga0495642_0032629 | Ga0495642_0032629_1338_1595 | 77 |
| 320 | 3300046529 | Ga0495652_0988850 | Ga0495652_0988850_96_347 | 77 |
| 321 | 3300046533 | Ga0495640_0807949 | Ga0495640_0807949_143_412 | 77 |
| 322 | 3300046535 | Ga0495586_0309746 | Ga0495586_0309746_578_814 | 77 |
| 323 | 3300046537 | Ga0495598_0161174 | Ga0495598_0161174_195_464 | 77 |
| 324 | 3300046538 | Ga0495609_0000250 | Ga0495609_0000250_44992_45249 | 77 |
| 325 | 3300046542 | Ga0495597_0103454 | Ga0495597_0103454_379_636 | 77 |
| 326 | 3300046615 | Ga0495656_0251836 | Ga0495656_0251836_568_825 | 77 |
| 327 | 3300046616 | Ga0495668_0007063 | Ga0495668_0007063_1557_1814 | 77 |
| 328 | 3300046660 | Ga0495625_0004342 | Ga0495625_0004342_6313_6570 | 77 |
| 329 | 3300046663 | Ga0495635_0544889 | Ga0495635_0544889_37_306 | 77 |
| 330 | 3300046664 | Ga0495659_0002327 | Ga0495659_0002327_1411_1668 | 77 |
| 331 | 3300046665 | Ga0495661_0037047 | Ga0495661_0037047_300_551 | 77 |
| 332 | 3300046665 | Ga0495661_0622385 | Ga0495661_0622385_111_362 | 77 |
| 333 | 3300046674 | Ga0495588_0344101 | Ga0495588_0344101_430_699 | 77 |
| 334 | 3300046683 | Ga0495658_0312283 | Ga0495658_0312283_197_541 | 77 |
| 335 | 3300046684 | Ga0495669_0006526 | Ga0495669_0006526_4303_4560 | 77 |
| 336 | 3300046690 | Ga0495624_0370665 | Ga0495624_0370665_426_695 | 77 |
| 337 | 3300046694 | Ga0495649_0048100 | Ga0495649_0048100_575_823 | 77 |
| 338 | 3300046694 | Ga0495649_0141041 | Ga0495649_0141041_975_1232 | 77 |
| 339 | 3300046794 | Ga0495589_0201908 | Ga0495589_0201908_283_519 | 77 |
| 340 | 3300046810 | Ga0495660_0017643 | Ga0495660_0017643_824_1081 | 77 |
| 341 | 3300047318 | Ga0495636_0054681 | Ga0495636_0054681_1407_1664 | 77 |
| 342 | 3300047319 | Ga0495674_0060099 | Ga0495674_0060099_2517_2786 | 77 |
| 343 | 3300047320 | Ga0495672_0005757 | Ga0495672_0005757_8634_8876 | 77 |
| 344 | 3300047320 | Ga0495672_0014599 | Ga0495672_0014599_2281_2544 | 77 |
| 345 | 3300047443 | Ga0495687_010538 | Ga0495687_010538_4650_4907 | 77 |
| 346 | 3300047445 | Ga0495677_0004241 | Ga0495677_0004241_4732_4989 | 77 |
| 347 | 3300047447 | Ga0495685_022954 | Ga0495685_022954_601_858 | 77 |
| 348 | 3300047470 | Ga0495681_0002977 | Ga0495681_0002977_7661_7918 | 77 |
| 349 | 3300047472 | Ga0495686_0469622 | Ga0495686_0469622_165_434 | 77 |
| 350 | 3300048088 | Ga0495602_0632271 | Ga0495602_0632271_306_575 | 77 |
| 351 | 3300048091 | Ga0495626_0171027 | Ga0495626_0171027_159_428 | 77 |
| 352 | 3300048903 | Ga0496100_0234847 | Ga0496100_0234847_759_1028 | 77 |
| 353 | 3300048904 | Ga0496101_0227990 | Ga0496101_0227990_247_516 | 77 |
| 354 | 3300048904 | Ga0496101_1234763 | Ga0496101_1234763_283_552 | 77 |
| 355 | 3300048905 | Ga0496102_1000166 | Ga0496102_1000166_13_276 | 77 |
| 356 | 3300048905 | Ga0496102_1797321 | Ga0496102_1797321_59_328 | 77 |
| 357 | 3300048906 | Ga0496103_0013657 | Ga0496103_0013657_1853_2122 | 77 |
| 358 | 3300048907 | Ga0496104_0195365 | Ga0496104_0195365_441_710 | 77 |
| 359 | 3300048909 | Ga0496106_0306860 | Ga0496106_0306860_186_443 | 77 |
| 360 | 3300048910 | Ga0496107_0072472 | Ga0496107_0072472_760_1029 | 77 |
| 361 | 3300048911 | Ga0496108_0041859 | Ga0496108_0041859_2640_2909 | 77 |
| 362 | 3300048911 | Ga0496108_0414968 | Ga0496108_0414968_231_500 | 77 |
| 363 | 3300048911 | Ga0496108_0978137 | Ga0496108_0978137_147_416 | 77 |
| 364 | 3300048912 | Ga0496109_0681399 | Ga0496109_0681399_562_831 | 77 |
| 365 | 3300048912 | Ga0496109_1184969 | Ga0496109_1184969_167_436 | 77 |
| 366 | 3300048913 | Ga0496110_0189545 | Ga0496110_0189545_757_1026 | 77 |
| 367 | 3300048914 | Ga0496111_0029844 | Ga0496111_0029844_1938_2207 | 77 |
| 368 | 3300048915 | Ga0496112_0247730 | Ga0496112_0247730_239_508 | 77 |
| 369 | 3300048916 | Ga0496113_0295947 | Ga0496113_0295947_776_1045 | 77 |
| 370 | 3300048917 | Ga0496114_0018797 | Ga0496114_0018797_4220_4489 | 77 |
| 371 | 3300048918 | Ga0496115_0036050 | Ga0496115_0036050_2441_2710 | 77 |
| 372 | 3300048919 | Ga0496116_0003489 | Ga0496116_0003489_13170_13427 | 77 |
| 373 | 3300048921 | Ga0496118_0172260 | Ga0496118_0172260_789_1046 | 77 |
| 374 | 3300048924 | Ga0496121_0447776 | Ga0496121_0447776_250_519 | 77 |
| 375 | 3300048929 | Ga0496126_0543787 | Ga0496126_0543787_183_452 | 77 |
| 376 | 3300049568 | Ga0501031_0320547 | Ga0501031_0320547_571_807 | 77 |
| 377 | 3300049569 | Ga0501032_0006487 | Ga0501032_0006487_6241_6477 | 77 |
| 378 | 3300049570 | Ga0501033_0216377 | Ga0501033_0216377_848_1102 | 77 |
| 379 | 3300049571 | Ga0501034_0000031 | Ga0501034_0000031_21145_21381 | 77 |
| 380 | 3300049572 | Ga0501036_0422550 | Ga0501036_0422550_615_869 | 77 |
| 381 | 3300049572 | Ga0501036_0565241 | Ga0501036_0565241_324_560 | 77 |
| 382 | 3300049573 | Ga0501037_0015345 | Ga0501037_0015345_4504_4740 | 77 |
| 383 | 3300049574 | Ga0501038_0206615 | Ga0501038_0206615_201_437 | 77 |
| 384 | 3300049575 | Ga0501039_0016592 | Ga0501039_0016592_389_625 | 77 |
| 385 | 3300049575 | Ga0501039_0624973 | Ga0501039_0624973_243_497 | 77 |
| 386 | 3300049578 | Ga0501042_0958756 | Ga0501042_0958756_288_524 | 77 |
| 387 | 3300049579 | Ga0501043_0027504 | Ga0501043_0027504_1499_1735 | 77 |
| 388 | 3300049581 | Ga0501047_0001332 | Ga0501047_0001332_17760_17996 | 77 |
| 389 | 3300049581 | Ga0501047_0162771 | Ga0501047_0162771_1570_1824 | 77 |
| 390 | 3300049582 | Ga0501048_0553662 | Ga0501048_0553662_188_424 | 77 |
| 391 | 3300049583 | Ga0501067_0002583 | Ga0501067_0002583_6143_6379 | 77 |
| 392 | 3300049583 | Ga0501067_0463811 | Ga0501067_0463811_428_679 | 77 |
| 393 | 3300049586 | Ga0501070_0041408 | Ga0501070_0041408_402_638 | 77 |
| 394 | 3300049589 | Ga0501073_0013629 | Ga0501073_0013629_69_305 | 77 |
| 395 | 3300049589 | Ga0501073_0698430 | Ga0501073_0698430_426_680 | 77 |
| 396 | 3300049742 | Ga0501080_0000483 | Ga0501080_0000483_6257_6493 | 77 |
| 397 | 3300049744 | Ga0501083_0090604 | Ga0501083_0090604_125_367 | 77 |
| 398 | 3300049758 | Ga0501241_137253 | Ga0501241_137253_280_531 | 77 |
| 399 | 3300049822 | Ga0501035_0001140 | Ga0501035_0001140_6249_6485 | 77 |
| 400 | 3300049822 | Ga0501035_0096031 | Ga0501035_0096031_1081_1335 | 77 |
| 401 | 3300049823 | Ga0501044_0000013 | Ga0501044_0000013_25052_25288 | 77 |
| 402 | 3300049823 | Ga0501044_0681424 | Ga0501044_0681424_17_271 | 77 |
| 403 | 3300049824 | Ga0501045_0019419 | Ga0501045_0019419_760_996 | 77 |
| 404 | 3300050489 | nmdc:mga03683_322505_c1 | nmdc:mga03683_322505_c1_34_291 | 77 |
| 405 | 3300050490 | nmdc:mga03n38_45608_c1 | nmdc:mga03n38_45608_c1_670_933 | 77 |
| 406 | 3300050490 | nmdc:mga03n38_532418_c1 | nmdc:mga03n38_532418_c1_41_298 | 77 |
| 407 | 3300050491 | nmdc:mga00v17_537460_c1 | nmdc:mga00v17_537460_c1_352_621 | 77 |
| 408 | 3300050491 | nmdc:mga00v17_756965_c1 | nmdc:mga00v17_756965_c1_301_558 | 77 |
| 409 | 3300050492 | nmdc:mga0yw44_232942_c1 | nmdc:mga0yw44_232942_c1_704_961 | 77 |
| 410 | 3300050493 | nmdc:mga0k408_765129_c1 | nmdc:mga0k408_765129_c1_180_449 | 77 |
| 411 | 3300050494 | nmdc:mga06z11_461817_c1 | nmdc:mga06z11_461817_c1_249_506 | 77 |
| 412 | 3300050496 | nmdc:mga07m45_335172_c1 | nmdc:mga07m45_335172_c1_184_441 | 77 |
| 413 | 3300050510 | nmdc:mga06r32_158354_c1 | nmdc:mga06r32_158354_c1_1073_1315 | 77 |
| 414 | 3300050516 | nmdc:mga0sz30_10704_c1 | nmdc:mga0sz30_10704_c1_2163_2420 | 77 |
| 415 | 3300053077 | Ga0495601_0353022 | Ga0495601_0353022_232_501 | 77 |
| 416 | 3300053077 | Ga0495601_0736450 | Ga0495601_0736450_368_610 | 77 |
| 417 | 3300053078 | Ga0495612_0155108 | Ga0495612_0155108_66_335 | 77 |
| 418 | 3300053084 | Ga0495595_0158073 | Ga0495595_0158073_224_493 | 77 |
| 419 | 3300053085 | Ga0495619_0139735 | Ga0495619_0139735_601_870 | 77 |
| 420 | 3300053091 | Ga0500647_0139182 | Ga0500647_0139182_766_1008 | 77 |
| 421 | 3300053111 | Ga0500572_134246 | Ga0500572_134246_452_700 | 77 |
| 422 | 3300053121 | Ga0500607_062335 | Ga0500607_062335_1325_1573 | 77 |
| 423 | 3300053140 | Ga0500573_0214965 | Ga0500573_0214965_47_286 | 77 |
| 424 | 3300053140 | Ga0500573_0296097 | Ga0500573_0296097_36_272 | 77 |
| 425 | 3300053151 | Ga0500604_0174305 | Ga0500604_0174305_220_489 | 77 |
| 426 | 3300053153 | Ga0500616_0033482 | Ga0500616_0033482_275_514 | 77 |
| 427 | 3300053724 | Ga0500570_068143 | Ga0500570_068143_1362_1619 | 77 |
| 428 | 3300053730 | Ga0500645_060294 | Ga0500645_060294_776_1024 | 77 |
| 429 | 3300059508 | Ga0587088_209674 | Ga0587088_209674_130_384 | 77 |
| 430 | 3300060353 | Ga0501082_0003443 | Ga0501082_0003443_3159_3395 | 77 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2icg-assembly1.cif.gz_A | crystal structure of a protein of unknown function (np_472245.1) from listeria innocua at 1.65 a resolution | 0.6182 | 39 | 69 |
| 1qez-assembly1.cif.gz_F | sulfolobus acidocaldarius inorganic pyrophosphatase: an archael pyrophosphatase. | 0.5168 | 48 | 74 |
| 7yta-assembly1.cif.gz_A | crystal structure of ntagdp3 agd1-2 in complex with an h3k9me2 peptide | 0.4451 | 28 | 77 |
| 3mp6-assembly1.cif.gz_A | complex structure of sgf29 and dimethylated h3k4 | 0.4448 | 25 | 76 |
| 3mp1-assembly1.cif.gz_A | complex structure of sgf29 and trimethylated h3k4 | 0.4396 | 25 | 76 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q4DCU2_5_434_3.50.50.100 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; | 0.6154 | 44 | 70 | 3.50.50.100 |
| af_A0A1D6LPC7_51_198_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.5731 | 45 | 70 | 3.50.50.60 |
| af_Q8H5X6_117_561_3.50.50.100 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; | 0.5588 | 44 | 70 | 3.50.50.100 |
| af_Q9BL48_11_358_3.90.1410.10 | Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 1;set domain protein methyltransferase, domain 1 | 0.5203 | 44 | 72 | 3.90.1410.10 |
| af_P11875_109_453_3.40.50.620 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs | 0.4981 | 46 | 67 | 3.40.50.620 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4D7CC05-F1-model_v4 | DUF3297 family protein | 1.001 | 3 | 77 |
|
| AF-A0A846MW21-F1-model_v4 | Glutathione peroxidase | 1.001 | 3 | 77 |
|
| AF-A0A0Q7TP90-F1-model_v4 | Glutathione peroxidase | 1.001 | 6 | 77 |
GO:0004601
|
| AF-A0A7U1HSS0-F1-model_v4 | deleted | 1.001 | 6 | 77 |
|
| AF-A0A1T4SYZ1-F1-model_v4 | Glutathione peroxidase | 0.999 | 3 | 77 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar