F442109

General Info

Members Datasets Scaffolds Average Seq Length
430 306 422 85

Family's Representative Sequence

Representative Sequence 3300006178|Ga0075367_10114274|Ga0075367_101142743
Length 90
Sequence MNEKTEADTFPDRLSTNPSSPYYNEELLSRDVGIRFKGAEKTNVEEYCISEGWIRVTAGNAKDRHGKPLTIKLKGKVEPYFKTPDSSSTG

Samples

Sample ID Description Type Environment
1 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
2 2643221733 Bosea sp. Root381 Isolate Unclassified
3 2841760612 Bosea sp. Tri-49 Isolate Nodule
4 2842747753 Variovorax sp. R-72060 Isolate Unclassified
5 2844104063 Bosea sp. Tri-39 Isolate Nodule
6 2851182111 Bosea sp. Tri-44 Isolate Nodule
7 2851246043 Bosea sp. Tri-54 Isolate Nodule
8 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
9 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
55 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
56 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
62 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
63 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
83 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
84 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
85 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
133 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
134 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
137 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
138 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
139 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
142 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
145 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
146 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
147 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
153 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
160 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
161 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
178 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
179 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
180 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
181 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
182 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
185 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
186 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
187 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
188 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
189 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
190 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
194 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
202 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
209 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
210 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
215 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
216 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
217 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
218 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
219 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
220 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
221 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
222 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
223 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
229 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
230 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
231 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
232 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
233 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
234 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
235 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
236 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
237 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
238 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
239 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
240 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
241 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
242 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
243 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
244 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
245 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
259 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
260 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
261 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
262 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
269 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
278 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
279 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
284 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
285 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
286 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
287 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
288 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
289 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
290 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
291 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
292 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
293 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
294 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
297 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
298 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
299 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
300 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
301 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
302 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
303 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
304 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 8057529695 Bosea vestrisii A18/4-2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.44
Metatranscriptomes 0.47
Isolates 2.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.44
Nodule 1.16
Rhizoplane 8.37
Rhizosphere 76.28
Stem 0
Stem Tuber 0
Unclassified 6.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10010893 3300003203 Bacteria 4007
2 rootH1_10043406 3300003316 Bacteria 2678
3 rootH1_10053722 3300003316 Bacteria 1971
4 rootH1_10053722 3300003323 Bacteria 1562
5 rootL2_10166897 3300003322 Bacteria 2732
6 Ga0070658_10630988 3300005327 Bacteria 929
7 Ga0070683_100874740 3300005329 Bacteria 862
8 Ga0070690_100403164 3300005330 Bacteria 1005
9 Ga0070670_100406226 3300005331 Bacteria 1203
10 Ga0070670_100719015 3300005331 Bacteria 899
11 Ga0070670_100964071 3300005331 Bacteria 775
12 Ga0070670_102113791 3300005331 Bacteria 519
13 Ga0068869_101448898 3300005334 Bacteria 609
14 Ga0070680_100025425 3300005336 Bacteria 4732
15 Ga0070680_100820095 3300005336 Bacteria 802
16 Ga0070660_100026119 3300005339 Bacteria 4347
17 Ga0070689_102233043 3300005340 Bacteria 502
18 Ga0070661_100000913 3300005344 Bacteria 21208
19 Ga0070675_100574443 3300005354 Bacteria 1021
20 Ga0070671_101082329 3300005355 Bacteria 704
21 Ga0070674_100488039 3300005356 Bacteria 1024
22 Ga0070659_100962568 3300005366 Bacteria 748
23 Ga0070667_101295694 3300005367 Bacteria 682
24 Ga0070663_101394044 3300005455 Bacteria 620
25 Ga0070678_100563678 3300005456 Bacteria 1013
26 Ga0070678_101348785 3300005456 Bacteria 665
27 Ga0070678_101718355 3300005456 Bacteria 591
28 Ga0070662_100107856 3300005457 Bacteria 2117
29 Ga0070681_10332017 3300005458 Bacteria 1430
30 Ga0068867_101124080 3300005459 Bacteria 718
31 Ga0068867_101541566 3300005459 Bacteria 620
32 Ga0070706_100115858 3300005467 Bacteria 2495
33 Ga0070699_100227587 3300005518 Bacteria 1662
34 Ga0070679_100019961 3300005530 Bacteria 6528
35 Ga0070697_100053070 3300005536 Bacteria 3295
36 Ga0068853_100003225 3300005539 Bacteria 12471
37 Ga0068853_100988830 3300005539 Bacteria 810
38 Ga0068853_102304120 3300005539 Bacteria 522
39 Ga0070672_101375192 3300005543 Bacteria 631
40 Ga0070686_100987551 3300005544 Bacteria 690
41 Ga0070665_100072518 3300005548 Bacteria 3451
42 Ga0070665_100688288 3300005548 Bacteria 1035
43 Ga0070665_100849123 3300005548 Bacteria 926
44 Ga0068855_100004282 3300005563 Bacteria 17432
45 Ga0070664_100005480 3300005564 Bacteria 10189
46 Ga0070664_101920552 3300005564 Bacteria 562
47 Ga0068857_101461405 3300005577 Bacteria 666
48 Ga0070702_101410503 3300005615 Bacteria 570
49 Ga0068866_10813123 3300005718 Bacteria 651
50 Ga0068870_10482577 3300005840 Bacteria 823
51 Ga0068863_100008703 3300005841 Bacteria 9913
52 Ga0068858_100163307 3300005842 Bacteria 2098
53 Ga0068858_100766464 3300005842 Bacteria 940
54 Ga0068862_101996572 3300005844 Bacteria 591
55 Ga0081539_10002935 3300005985 Bacteria 22459
56 Ga0075365_10130579 3300006038 Bacteria 1738
57 Ga0075365_10407798 3300006038 Bacteria 959
58 Ga0075365_10782741 3300006038 Bacteria 673
59 Ga0075365_10787672 3300006038 Bacteria 671
60 Ga0075368_10199858 3300006042 Bacteria 846
61 Ga0075363_100064176 3300006048 Bacteria 1984
62 Ga0075363_100763140 3300006048 Bacteria 587
63 Ga0070715_10108372 3300006163 Bacteria 1307
64 Ga0070712_100516972 3300006175 Bacteria 1002
65 Ga0075367_10028768 3300006178 Bacteria 3173
66 Ga0075367_10114274 3300006178 Bacteria 1659
67 Ga0075369_10005952 3300006186 Bacteria 4589
68 Ga0075366_10718067 3300006195 Bacteria 621
69 Ga0097621_100728169 3300006237 Bacteria 915
70 Ga0068871_100623111 3300006358 Bacteria 983
71 Ga0068871_101455566 3300006358 Bacteria 647
72 Ga0068871_102155187 3300006358 Bacteria 531
73 Ga0075431_101181325 3300006847 Bacteria 728
74 Ga0075434_100528558 3300006871 Bacteria 1200
75 Ga0099795_10514366 3300007788 Bacteria 560
76 Ga0105245_10490352 3300009098 Bacteria 1243
77 Ga0105247_10112923 3300009101 Bacteria 1751
78 Ga0105247_10524919 3300009101 Bacteria 866
79 Ga0105247_11132883 3300009101 Bacteria 619
80 Ga0105241_10142505 3300009174 Bacteria 1953
81 Ga0105241_10247001 3300009174 Bacteria 1511
82 Ga0105242_10000664 3300009176 Bacteria 26902
83 Ga0105242_11108247 3300009176 Bacteria 806
84 Ga0105242_11293146 3300009176 Bacteria 753
85 Ga0105248_10128086 3300009177 Bacteria 2864
86 Ga0105248_10468128 3300009177 Bacteria 1421
87 Ga0105248_10847283 3300009177 Bacteria 1032
88 Ga0105248_12774042 3300009177 Bacteria 559
89 Ga0105237_10138347 3300009545 Bacteria 2429
90 Ga0105237_10966062 3300009545 Bacteria 859
91 Ga0105237_10966966 3300009545 Bacteria 858
92 Ga0105237_12112891 3300009545 Bacteria 572
93 Ga0105238_10302852 3300009551 Bacteria 1582
94 Ga0105238_11039885 3300009551 Bacteria 840
95 Ga0105249_10019455 3300009553 Bacteria 6059
96 Ga0099796_10033479 3300010159 Bacteria 1691
97 Ga0099796_10123512 3300010159 Bacteria 997
98 Ga0105239_10003689 3300010375 Bacteria 18664
99 Ga0105246_10805185 3300011119 Bacteria 834
100 Ga0105246_11571494 3300011119 Bacteria 620
101 Ga0157373_10519370 3300013100 Bacteria 861
102 Ga0157374_10115074 3300013296 Bacteria 2590
103 Ga0157378_11791776 3300013297 Bacteria 662
104 Ga0157378_12917673 3300013297 Bacteria 530
105 Ga0163162_10089882 3300013306 Bacteria 3152
106 Ga0163162_11162948 3300013306 Bacteria 875
107 Ga0163162_11255121 3300013306 Bacteria 841
108 Ga0163162_11701451 3300013306 Bacteria 720
109 Ga0163162_13457819 3300013306 Bacteria 503
110 Ga0157375_10002699 3300013308 Bacteria 15369
111 Ga0157375_11778593 3300013308 Bacteria 730
112 Ga0157375_12569063 3300013308 Bacteria 608
113 Ga0157375_12786495 3300013308 Bacteria 584
114 Ga0163163_12120796 3300014325 Bacteria 622
115 Ga0157380_10247869 3300014326 Bacteria 1610
116 Ga0157380_10868938 3300014326 Bacteria 925
117 Ga0157377_10687017 3300014745 Bacteria 741
118 Ga0157379_10036753 3300014968 Bacteria 4367
119 Ga0157379_11391491 3300014968 Bacteria 680
120 Ga0163161_10213435 3300017792 Bacteria 1492
121 Ga0163161_10614218 3300017792 Bacteria 898
122 Ga0163161_11093251 3300017792 Bacteria 685
123 Ga0213872_10288225 3300021361 Bacteria 684
124 Ga0213876_10240954 3300021384 Bacteria 961
125 Ga0224712_10366208 3300022467 Bacteria 683
126 Ga0209564_1007718 3300025295 Bacteria 5478
127 Ga0207697_10048136 3300025315 Bacteria 1758
128 Ga0207697_10520874 3300025315 Bacteria 524
129 Ga0207680_11028207 3300025903 Bacteria 590
130 Ga0207685_10391751 3300025905 Bacteria 710
131 Ga0207643_10362148 3300025908 Bacteria 912
132 Ga0207705_10599518 3300025909 Bacteria 857
133 Ga0207654_10290224 3300025911 Bacteria 1109
134 Ga0207654_10995632 3300025911 Bacteria 609
135 Ga0207654_11263608 3300025911 Bacteria 538
136 Ga0207707_10327989 3300025912 Bacteria 1321
137 Ga0207671_10159187 3300025914 Bacteria 1748
138 Ga0207671_10588270 3300025914 Bacteria 887
139 Ga0207671_10801851 3300025914 Bacteria 747
140 Ga0207693_10574732 3300025915 Bacteria 878
141 Ga0207660_10037239 3300025917 Bacteria 3388
142 Ga0207657_10084991 3300025919 Bacteria 2651
143 Ga0207649_10005436 3300025920 Bacteria 6893
144 Ga0207649_10169999 3300025920 Bacteria 1517
145 Ga0207652_10062676 3300025921 Bacteria 3213
146 Ga0207694_10463502 3300025924 Bacteria 1059
147 Ga0207650_10982160 3300025925 Bacteria 718
148 Ga0207659_10127146 3300025926 Bacteria 1962
149 Ga0207687_10407888 3300025927 Bacteria 1119
150 Ga0207644_10795494 3300025931 Bacteria 791
151 Ga0207690_10004882 3300025932 Bacteria 7909
152 Ga0207690_11402729 3300025932 Bacteria 584
153 Ga0207706_10105471 3300025933 Bacteria 2480
154 Ga0207686_10004921 3300025934 Bacteria 7189
155 Ga0207686_10041741 3300025934 Bacteria 2800
156 Ga0207686_10054501 3300025934 Bacteria 2505
157 Ga0207686_10316261 3300025934 Bacteria 1165
158 Ga0207709_10941747 3300025935 Bacteria 704
159 Ga0207709_11328737 3300025935 Bacteria 594
160 Ga0207670_10841525 3300025936 Bacteria 766
161 Ga0207669_10256628 3300025937 Bacteria 1305
162 Ga0207704_10120419 3300025938 Bacteria 1795
163 Ga0207704_10596650 3300025938 Bacteria 904
164 Ga0207711_10509366 3300025941 Bacteria 1122
165 Ga0207661_10961134 3300025944 Bacteria 787
166 Ga0207679_10000225 3300025945 Bacteria 44668
167 Ga0207667_10005407 3300025949 Bacteria 15575
168 Ga0207712_10230623 3300025961 Bacteria 1486
169 Ga0207668_10796499 3300025972 Bacteria 836
170 Ga0207668_11427414 3300025972 Bacteria 624
171 Ga0207658_11692660 3300025986 Bacteria 578
172 Ga0207677_10646396 3300026023 Bacteria 933
173 Ga0207677_11564162 3300026023 Bacteria 610
174 Ga0207703_10384165 3300026035 Bacteria 1299
175 Ga0207703_10849148 3300026035 Bacteria 873
176 Ga0207639_10000690 3300026041 Bacteria 23246
177 Ga0207639_10450435 3300026041 Bacteria 1168
178 Ga0207678_10127084 3300026067 Bacteria 2174
179 Ga0207678_10589113 3300026067 Bacteria 974
180 Ga0207678_10729026 3300026067 Bacteria 873
181 Ga0207641_11826677 3300026088 Bacteria 609
182 Ga0207648_10862809 3300026089 Bacteria 844
183 Ga0207676_10980969 3300026095 Bacteria 832
184 Ga0207675_101252994 3300026118 Bacteria 762
185 Ga0207675_101422610 3300026118 Bacteria 714
186 Ga0207683_10194830 3300026121 Bacteria 1841
187 Ga0207683_10779318 3300026121 Bacteria 887
188 Ga0207683_11409742 3300026121 Bacteria 644
189 Ga0207698_11583851 3300026142 Bacteria 670
190 Ga0207698_12314957 3300026142 Bacteria 549
191 Ga0209179_1139766 3300027512 Bacteria 541
192 Ga0268266_10342564 3300028379 Bacteria 1403
193 Ga0268266_10453261 3300028379 Bacteria 1220
194 Ga0268266_11272915 3300028379 Bacteria 711
195 Ga0268266_11822065 3300028379 Bacteria 583
196 Ga0268265_11301714 3300028380 Bacteria 727
197 Ga0265337_1095382 3300028556 Bacteria 810
198 Ga0265326_10049477 3300028558 Bacteria 1191
199 Ga0265319_1037075 3300028563 Bacteria 1664
200 Ga0265334_10019489 3300028573 Bacteria 2790
201 Ga0265323_10015921 3300028653 Bacteria 2946
202 Ga0265336_10001725 3300028666 Bacteria 9598
203 Ga0307517_10000248 3300028786 Bacteria 92084
204 Ga0307515_10016931 3300028794 Bacteria 13324
205 Ga0265338_10008662 3300028800 Bacteria 12306
206 Ga0265338_10552473 3300028800 Bacteria 806
207 Ga0265324_10079547 3300029957 Bacteria 1115
208 Ga0265330_10000594 3300031235 Bacteria 23527
209 Ga0265332_10001016 3300031238 Bacteria 16566
210 Ga0265328_10100854 3300031239 Bacteria 1069
211 Ga0265329_10009316 3300031242 Bacteria 3669
212 Ga0265331_10000422 3300031250 Bacteria 42940
213 Ga0265327_10007198 3300031251 Bacteria 8646
214 Ga0265316_10127171 3300031344 Bacteria 1921
215 Ga0307513_10286178 3300031456 Bacteria 1423
216 Ga0307508_10023583 3300031616 Bacteria 5587
217 Ga0307508_10031735 3300031616 Bacteria 4774
218 Ga0265314_10012408 3300031711 Bacteria 6955
219 Ga0307516_10023476 3300031730 Bacteria 6321
220 Ga0307516_10164494 3300031730 Bacteria 1965
221 Ga0307516_10395510 3300031730 Bacteria 1042
222 Ga0307405_10090917 3300031731 Bacteria 2021
223 Ga0307413_11886079 3300031824 Bacteria 537
224 Ga0307406_10765182 3300031901 Bacteria 812
225 Ga0307412_10601484 3300031911 Bacteria 931
226 Ga0307416_102892571 3300032002 Bacteria 574
227 Ga0307414_12203363 3300032004 Bacteria 515
228 Ga0307510_10403869 3300033180 Bacteria 809
229 Ga0307510_10421748 3300033180 Bacteria 776
230 Ga0373928_0158136 3300035084 Bacteria 632
231 Ga0373929_0072431 3300035085 Bacteria 826
232 Ga0373949_0215927 3300035090 Bacteria 581
233 Ga0373943_0313765 3300035170 Bacteria 893
234 Ga0373946_0611905 3300035171 Bacteria 565
235 Ga0373962_0111007 3300035242 Bacteria 865
236 Ga0373927_0043019 3300035695 Bacteria 2926
237 Ga0373927_0070175 3300035695 Bacteria 2268
238 Ga0373947_0258533 3300035725 Bacteria 1153
239 Ga0373937_0421529 3300036401 Bacteria 1267
240 Ga0373925_0029655 3300037068 Bacteria 4014
241 Ga0373925_0735221 3300037068 Bacteria 813
242 Ga0373925_1632993 3300037068 Bacteria 527
243 Ga0395899_0013514 3300037312 Bacteria 6241
244 Ga0395900_0013552 3300037418 Bacteria 8327
245 Ga0395900_0062620 3300037418 Bacteria 3824
246 Ga0395900_0110906 3300037418 Bacteria 2818
247 Ga0395898_0066817 3300037466 Bacteria 3482
248 Ga0395905_0121603 3300037471 Bacteria 2454
249 Ga0395905_0345630 3300037471 Bacteria 1379
250 Ga0436364_0728813 3300037853 Bacteria 519
251 Ga0395901_0054673 3300038443 Bacteria 4149
252 Ga0436365_0620439 3300039437 Bacteria 790
253 Ga0436365_1780836 3300039437 Bacteria 1972
254 Ga0436361_1008973 3300039447 Bacteria 827
255 Ga0439465_0141023 3300041413 Bacteria 856
256 Ga0451793_0336403 3300041452 Bacteria 1138
257 Ga0451793_1575468 3300041452 Bacteria 617
258 Ga0451797_0432824 3300041453 Bacteria 542
259 Ga0451800_0511826 3300041459 Bacteria 660
260 Ga0451802_0941259 3300041460 Bacteria 562
261 Ga0451802_1754088 3300041460 Bacteria 576
262 Ga0451807_0031962 3300041486 Bacteria 579
263 Ga0451843_0439534 3300041509 Bacteria 524
264 Ga0451843_1048452 3300041509 Bacteria 507
265 Ga0451853_1754813 3300041512 Bacteria 692
266 Ga0451853_3497136 3300041512 Bacteria 685
267 Ga0450919_000598 3300042121 Bacteria 4565
268 Ga0450918_000139 3300042531 Bacteria 15860
269 Ga0450893_0137059 3300042532 Bacteria 520
270 Ga0466982_0146911 3300044672 Bacteria 1444
271 Ga0466965_0032899 3300044683 Bacteria 2533
272 Ga0466970_0047796 3300044765 Bacteria 2281
273 Ga0466967_1050575 3300045976 Bacteria 811
274 Ga0495590_0043238 3300046457 Bacteria 1571
275 Ga0495629_0367713 3300046459 Bacteria 980
276 Ga0495638_0504354 3300046460 Bacteria 609
277 Ga0495580_0344446 3300046472 Bacteria 1010
278 Ga0495580_0573339 3300046472 Bacteria 748
279 Ga0495582_0135380 3300046473 Bacteria 1394
280 Ga0495605_0055183 3300046474 Bacteria 1921
281 Ga0495639_0528555 3300046475 Bacteria 603
282 Ga0495664_0906603 3300046477 Bacteria 515
283 Ga0495584_0078905 3300046491 Bacteria 1656
284 Ga0495596_0207340 3300046500 Bacteria 761
285 Ga0495607_0014959 3300046501 Bacteria 5044
286 Ga0495583_0029901 3300046506 Bacteria 2660
287 Ga0495616_0050104 3300046513 Bacteria 2089
288 Ga0495616_0118457 3300046513 Bacteria 1224
289 Ga0495616_0397343 3300046513 Bacteria 567
290 Ga0495628_1218504 3300046516 Bacteria 510
291 Ga0495630_0325185 3300046517 Bacteria 1176
292 Ga0495632_0315008 3300046519 Bacteria 692
293 Ga0495643_0014879 3300046522 Bacteria 4616
294 Ga0495643_0198006 3300046522 Bacteria 966
295 Ga0495642_0032629 3300046528 Bacteria 2090
296 Ga0495652_0988850 3300046529 Bacteria 551
297 Ga0495640_0807949 3300046533 Bacteria 559
298 Ga0495586_0309746 3300046535 Bacteria 905
299 Ga0495598_0161174 3300046537 Bacteria 789
300 Ga0495609_0000250 3300046538 Bacteria 50865
301 Ga0495609_0126800 3300046538 Bacteria 1095
302 Ga0495597_0103454 3300046542 Bacteria 1199
303 Ga0495656_0251836 3300046615 Bacteria 892
304 Ga0495668_0007063 3300046616 Bacteria 7232
305 Ga0495668_0278599 3300046616 Bacteria 916
306 Ga0495625_0004342 3300046660 Bacteria 13462
307 Ga0495635_0544889 3300046663 Bacteria 761
308 Ga0495659_0002327 3300046664 Bacteria 6143
309 Ga0495661_0037047 3300046665 Bacteria 3047
310 Ga0495661_0622385 3300046665 Bacteria 506
311 Ga0495588_0344101 3300046674 Bacteria 784
312 Ga0495658_0157130 3300046683 Bacteria 1400
313 Ga0495658_0312283 3300046683 Bacteria 995
314 Ga0495669_0006526 3300046684 Bacteria 4877
315 Ga0495613_0452238 3300046689 Bacteria 870
316 Ga0495624_0370665 3300046690 Bacteria 861
317 Ga0495649_0048100 3300046694 Bacteria 2318
318 Ga0495649_0141041 3300046694 Bacteria 1268
319 Ga0495589_0201908 3300046794 Bacteria 938
320 Ga0495660_0017643 3300046810 Bacteria 4107
321 Ga0495581_0254416 3300047315 Bacteria 1027
322 Ga0495636_0054681 3300047318 Bacteria 1677
323 Ga0495674_0060099 3300047319 Bacteria 3317
324 Ga0495672_0005757 3300047320 Bacteria 9760
325 Ga0495672_0014599 3300047320 Bacteria 5370
326 Ga0495687_010538 3300047443 Bacteria 5062
327 Ga0495677_0004241 3300047445 Bacteria 5521
328 Ga0495677_0447468 3300047445 Bacteria 512
329 Ga0495685_022954 3300047447 Bacteria 2146
330 Ga0495681_0002977 3300047470 Bacteria 11929
331 Ga0495686_0469622 3300047472 Bacteria 666
332 Ga0495602_0632271 3300048088 Bacteria 733
333 Ga0495626_0171027 3300048091 Bacteria 906
334 Ga0496100_0234847 3300048903 Bacteria 1350
335 Ga0496101_0156508 3300048904 Bacteria 1746
336 Ga0496101_0227990 3300048904 Bacteria 1447
337 Ga0496101_1234763 3300048904 Bacteria 585
338 Ga0496102_1000166 3300048905 Bacteria 757
339 Ga0496102_1797321 3300048905 Bacteria 530
340 Ga0496103_0013657 3300048906 Bacteria 4818
341 Ga0496104_0195365 3300048907 Bacteria 1935
342 Ga0496104_0616555 3300048907 Bacteria 995
343 Ga0496104_1878457 3300048907 Bacteria 501
344 Ga0496105_0437659 3300048908 Bacteria 1033
345 Ga0496106_0306860 3300048909 Bacteria 1273
346 Ga0496106_1519211 3300048909 Bacteria 515
347 Ga0496107_0072472 3300048910 Bacteria 2504
348 Ga0496108_0041859 3300048911 Bacteria 3825
349 Ga0496108_0414968 3300048911 Bacteria 1176
350 Ga0496108_0978137 3300048911 Bacteria 724
351 Ga0496109_0681399 3300048912 Bacteria 965
352 Ga0496109_1184969 3300048912 Bacteria 701
353 Ga0496110_0189545 3300048913 Bacteria 1867
354 Ga0496110_0369947 3300048913 Bacteria 1306
355 Ga0496111_0029844 3300048914 Bacteria 3874
356 Ga0496112_0247730 3300048915 Bacteria 1733
357 Ga0496113_0295947 3300048916 Bacteria 1295
358 Ga0496114_0018797 3300048917 Bacteria 5592
359 Ga0496114_0068642 3300048917 Bacteria 2976
360 Ga0496114_0426274 3300048917 Bacteria 1175
361 Ga0496115_0036050 3300048918 Bacteria 3915
362 Ga0496116_0003489 3300048919 Bacteria 15474
363 Ga0496118_0172260 3300048921 Bacteria 1320
364 Ga0496121_0447776 3300048924 Bacteria 833
365 Ga0496126_0543787 3300048929 Bacteria 923
366 Ga0501031_0320547 3300049568 Bacteria 1004
367 Ga0501032_0006487 3300049569 Bacteria 8605
368 Ga0501033_0216377 3300049570 Bacteria 1365
369 Ga0501034_0000031 3300049571 Bacteria 244022
370 Ga0501036_0422550 3300049572 Bacteria 1111
371 Ga0501036_0565241 3300049572 Bacteria 944
372 Ga0501037_0015345 3300049573 Bacteria 5636
373 Ga0501038_0206615 3300049574 Bacteria 1573
374 Ga0501039_0016592 3300049575 Bacteria 5641
375 Ga0501039_0624973 3300049575 Bacteria 844
376 Ga0501042_0958756 3300049578 Bacteria 623
377 Ga0501043_0027504 3300049579 Bacteria 4464
378 Ga0501047_0001332 3300049581 Bacteria 24241
379 Ga0501047_0162771 3300049581 Bacteria 2103
380 Ga0501048_0553662 3300049582 Bacteria 825
381 Ga0501067_0002583 3300049583 Bacteria 10003
382 Ga0501067_0463811 3300049583 Bacteria 708
383 Ga0501070_0041408 3300049586 Bacteria 3838
384 Ga0501073_0013629 3300049589 Bacteria 5915
385 Ga0501073_0698430 3300049589 Bacteria 700
386 Ga0501080_0000483 3300049742 Bacteria 30977
387 Ga0501083_0090604 3300049744 Bacteria 2020
388 Ga0501241_137253 3300049758 Bacteria 555
389 Ga0501035_0001140 3300049822 Bacteria 27786
390 Ga0501035_0096031 3300049822 Bacteria 2605
391 Ga0501044_0000013 3300049823 Bacteria 248795
392 Ga0501044_0681424 3300049823 Bacteria 915
393 Ga0501045_0019419 3300049824 Bacteria 4845
394 nmdc:mga03683_322505_c1 3300050489 Bacteria 727
395 nmdc:mga03n38_45608_c1 3300050490 Bacteria 1931
396 nmdc:mga03n38_532418_c1 3300050490 Bacteria 663
397 nmdc:mga00v17_537460_c1 3300050491 Bacteria 756
398 nmdc:mga00v17_756965_c1 3300050491 Bacteria 621
399 nmdc:mga0yw44_232942_c1 3300050492 Bacteria 1223
400 nmdc:mga0k408_765129_c1 3300050493 Bacteria 564
401 nmdc:mga06z11_409692_c1 3300050494 Bacteria 816
402 nmdc:mga06z11_461817_c1 3300050494 Bacteria 768
403 nmdc:mga07m45_335172_c1 3300050496 Bacteria 879
404 nmdc:mga06r32_158354_c1 3300050510 Bacteria 2246
405 nmdc:mga0sz30_10704_c1 3300050516 Bacteria 3520
406 Ga0495601_0353022 3300053077 Bacteria 956
407 Ga0495601_0736450 3300053077 Bacteria 628
408 Ga0495612_0155108 3300053078 Bacteria 998
409 Ga0495595_0158073 3300053084 Bacteria 1117
410 Ga0495595_0699226 3300053084 Bacteria 520
411 Ga0495619_0139735 3300053085 Bacteria 1667
412 Ga0500647_0139182 3300053091 Bacteria 1140
413 Ga0500572_134246 3300053111 Bacteria 805
414 Ga0500607_062335 3300053121 Bacteria 1949
415 Ga0500573_0214965 3300053140 Bacteria 1012
416 Ga0500573_0296097 3300053140 Bacteria 811
417 Ga0500604_0174305 3300053151 Bacteria 736
418 Ga0500616_0033482 3300053153 Bacteria 2804
419 Ga0500570_068143 3300053724 Bacteria 1677
420 Ga0500645_060294 3300053730 Bacteria 1098
421 Ga0587088_209674 3300059508 Bacteria 502
422 Ga0501082_0003443 3300060353 Bacteria 13811

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053084 Ga0495595_0699226 Ga0495595_0699226_276_479 67
2 3300025935 Ga0207709_11328737 Ga0207709_113287371 69
3 3300003316 rootH1_10053722 rootH1_100537222 71
4 3300013296 Ga0157374_10115074 Ga0157374_101150742 72
5 3300005339 Ga0070660_100026119 Ga0070660_1000261194 73
6 3300005344 Ga0070661_100000913 Ga0070661_10000091311 73
7 3300005457 Ga0070662_100107856 Ga0070662_1001078561 73
8 3300005564 Ga0070664_100005480 Ga0070664_10000548010 73
9 3300025919 Ga0207657_10084991 Ga0207657_100849914 73
10 3300025920 Ga0207649_10005436 Ga0207649_100054362 73
11 3300025932 Ga0207690_10004882 Ga0207690_100048828 73
12 3300025933 Ga0207706_10105471 Ga0207706_101054711 73
13 3300025945 Ga0207679_10000225 Ga0207679_1000022521 73
14 3300026067 Ga0207678_10127084 Ga0207678_101270842 73
15 3300026118 Ga0207675_101252994 Ga0207675_1012529942 73
16 3300041486 Ga0451807_0031962 Ga0451807_0031962_19_240 73
17 3300042121 Ga0450919_000598 Ga0450919_000598_3042_3263 73
18 3300042531 Ga0450918_000139 Ga0450918_000139_1650_1871 73
19 3300048904 Ga0496101_0156508 Ga0496101_0156508_653_874 73
20 3300048907 Ga0496104_0616555 Ga0496104_0616555_278_499 73
21 3300048908 Ga0496105_0437659 Ga0496105_0437659_616_837 73
22 3300048913 Ga0496110_0369947 Ga0496110_0369947_1073_1294 73
23 3300048917 Ga0496114_0068642 Ga0496114_0068642_1457_1678 73
24 iso_pu_bacteria 2643221733 2644729651 73
25 iso_pu_bacteria 2841760612 2841764657 73
26 iso_pu_bacteria 2844104063 2844107895 73
27 iso_pu_bacteria 2851182111 2851183897 73
28 iso_pu_bacteria 2851246043 2851250001 73
29 iso_pu_bacteria 2894817345 2894820970 73
30 iso_pu_bacteria 8057529695 8057533271 73
31 3300009177 Ga0105248_10128086 Ga0105248_101280865 74
32 3300013306 Ga0163162_10089882 Ga0163162_100898823 74
33 3300013308 Ga0157375_10002699 Ga0157375_1000269911 74
34 3300048907 Ga0496104_1878457 Ga0496104_1878457_95_388 74
35 iso_pu_bacteria 2842747753 2842750350 74
36 3300005543 Ga0070672_101375192 Ga0070672_1013751922 75
37 3300005548 Ga0070665_100849123 Ga0070665_1008491232 75
38 3300025972 Ga0207668_11427414 Ga0207668_114274141 75
39 3300028379 Ga0268266_10453261 Ga0268266_104532612 75
40 3300005356 Ga0070674_100488039 Ga0070674_1004880392 76
41 3300005367 Ga0070667_101295694 Ga0070667_1012956941 76
42 3300005455 Ga0070663_101394044 Ga0070663_1013940442 76
43 3300005615 Ga0070702_101410503 Ga0070702_1014105032 76
44 3300006038 Ga0075365_10407798 Ga0075365_104077982 76
45 3300006038 Ga0075365_10782741 Ga0075365_107827412 76
46 3300014326 Ga0157380_10868938 Ga0157380_108689381 76
47 3300014968 Ga0157379_10036753 Ga0157379_100367533 76
48 3300025315 Ga0207697_10048136 Ga0207697_100481362 76
49 3300025931 Ga0207644_10795494 Ga0207644_107954942 76
50 3300025935 Ga0207709_10941747 Ga0207709_109417472 76
51 3300025941 Ga0207711_10509366 Ga0207711_105093662 76
52 3300025986 Ga0207658_11692660 Ga0207658_116926602 76
53 3300026023 Ga0207677_11564162 Ga0207677_115641622 76
54 3300026067 Ga0207678_10729026 Ga0207678_107290262 76
55 3300026095 Ga0207676_10980969 Ga0207676_109809691 76
56 3300026121 Ga0207683_10779318 Ga0207683_107793182 76
57 3300031456 Ga0307513_10286178 Ga0307513_102861782 76
58 3300031730 Ga0307516_10395510 Ga0307516_103955101 76
59 3300031824 Ga0307413_11886079 Ga0307413_118860791 76
60 3300032002 Ga0307416_102892571 Ga0307416_1028925712 76
61 3300032004 Ga0307414_12203363 Ga0307414_122033632 76
62 3300035170 Ga0373943_0313765 Ga0373943_0313765_118_384 76
63 3300037068 Ga0373925_0735221 Ga0373925_0735221_39_305 76
64 3300046472 Ga0495580_0573339 Ga0495580_0573339_262_528 76
65 3300046473 Ga0495582_0135380 Ga0495582_0135380_713_979 76
66 3300046475 Ga0495639_0528555 Ga0495639_0528555_53_319 76
67 3300046513 Ga0495616_0397343 Ga0495616_0397343_205_468 76
68 3300046538 Ga0495609_0126800 Ga0495609_0126800_64_327 76
69 3300046616 Ga0495668_0278599 Ga0495668_0278599_386_649 76
70 3300046683 Ga0495658_0157130 Ga0495658_0157130_1074_1340 76
71 3300046689 Ga0495613_0452238 Ga0495613_0452238_480_746 76
72 3300047315 Ga0495581_0254416 Ga0495581_0254416_208_474 76
73 3300047445 Ga0495677_0447468 Ga0495677_0447468_44_307 76
74 3300048909 Ga0496106_1519211 Ga0496106_1519211_31_294 76
75 3300048917 Ga0496114_0426274 Ga0496114_0426274_696_959 76
76 3300050494 nmdc:mga06z11_409692_c1 nmdc:mga06z11_409692_c1_46_309 76
77 iso_pu_bacteria 2602042107 2603862504 76
78 3300003203 JGI25406J46586_10010893 JGI25406J46586_100108931 77
79 3300003316 rootH1_10043406 rootH1_100434061 77
80 3300003322 rootL2_10166897 rootL2_101668972 77
81 3300005327 Ga0070658_10630988 Ga0070658_106309882 77
82 3300005329 Ga0070683_100874740 Ga0070683_1008747401 77
83 3300005330 Ga0070690_100403164 Ga0070690_1004031642 77
84 3300005331 Ga0070670_100406226 Ga0070670_1004062263 77
85 3300005331 Ga0070670_100719015 Ga0070670_1007190151 77
86 3300005331 Ga0070670_100964071 Ga0070670_1009640712 77
87 3300005331 Ga0070670_102113791 Ga0070670_1021137911 77
88 3300005334 Ga0068869_101448898 Ga0068869_1014488981 77
89 3300005336 Ga0070680_100025425 Ga0070680_1000254253 77
90 3300005336 Ga0070680_100820095 Ga0070680_1008200951 77
91 3300005340 Ga0070689_102233043 Ga0070689_1022330432 77
92 3300005354 Ga0070675_100574443 Ga0070675_1005744432 77
93 3300005355 Ga0070671_101082329 Ga0070671_1010823291 77
94 3300005366 Ga0070659_100962568 Ga0070659_1009625681 77
95 3300005456 Ga0070678_100563678 Ga0070678_1005636782 77
96 3300005456 Ga0070678_101348785 Ga0070678_1013487852 77
97 3300005456 Ga0070678_101718355 Ga0070678_1017183552 77
98 3300005458 Ga0070681_10332017 Ga0070681_103320172 77
99 3300005459 Ga0068867_101124080 Ga0068867_1011240802 77
100 3300005459 Ga0068867_101541566 Ga0068867_1015415662 77
101 3300005467 Ga0070706_100115858 Ga0070706_1001158583 77
102 3300005518 Ga0070699_100227587 Ga0070699_1002275873 77
103 3300005530 Ga0070679_100019961 Ga0070679_1000199616 77
104 3300005536 Ga0070697_100053070 Ga0070697_1000530705 77
105 3300005539 Ga0068853_100003225 Ga0068853_10000322512 77
106 3300005539 Ga0068853_100988830 Ga0068853_1009888302 77
107 3300005539 Ga0068853_102304120 Ga0068853_1023041202 77
108 3300005544 Ga0070686_100987551 Ga0070686_1009875512 77
109 3300005548 Ga0070665_100072518 Ga0070665_1000725183 77
110 3300005548 Ga0070665_100688288 Ga0070665_1006882882 77
111 3300005563 Ga0068855_100004282 Ga0068855_1000042824 77
112 3300005564 Ga0070664_101920552 Ga0070664_1019205522 77
113 3300005577 Ga0068857_101461405 Ga0068857_1014614051 77
114 3300005718 Ga0068866_10813123 Ga0068866_108131231 77
115 3300005840 Ga0068870_10482577 Ga0068870_104825772 77
116 3300005841 Ga0068863_100008703 Ga0068863_1000087039 77
117 3300005842 Ga0068858_100163307 Ga0068858_1001633072 77
118 3300005842 Ga0068858_100766464 Ga0068858_1007664641 77
119 3300005844 Ga0068862_101996572 Ga0068862_1019965722 77
120 3300005985 Ga0081539_10002935 Ga0081539_100029357 77
121 3300006038 Ga0075365_10130579 Ga0075365_101305791 77
122 3300006038 Ga0075365_10787672 Ga0075365_107876722 77
123 3300006042 Ga0075368_10199858 Ga0075368_101998582 77
124 3300006048 Ga0075363_100064176 Ga0075363_1000641763 77
125 3300006048 Ga0075363_100763140 Ga0075363_1007631402 77
126 3300006163 Ga0070715_10108372 Ga0070715_101083721 77
127 3300006175 Ga0070712_100516972 Ga0070712_1005169722 77
128 3300006178 Ga0075367_10028768 Ga0075367_100287684 77
129 3300006178 Ga0075367_10114274 Ga0075367_101142743 77
130 3300006186 Ga0075369_10005952 Ga0075369_100059523 77
131 3300006195 Ga0075366_10718067 Ga0075366_107180672 77
132 3300006237 Ga0097621_100728169 Ga0097621_1007281692 77
133 3300006358 Ga0068871_100623111 Ga0068871_1006231112 77
134 3300006358 Ga0068871_101455566 Ga0068871_1014555662 77
135 3300006358 Ga0068871_102155187 Ga0068871_1021551872 77
136 3300006847 Ga0075431_101181325 Ga0075431_1011813252 77
137 3300006871 Ga0075434_100528558 Ga0075434_1005285582 77
138 3300007788 Ga0099795_10514366 Ga0099795_105143661 77
139 3300009098 Ga0105245_10490352 Ga0105245_104903522 77
140 3300009101 Ga0105247_10112923 Ga0105247_101129232 77
141 3300009101 Ga0105247_10524919 Ga0105247_105249192 77
142 3300009101 Ga0105247_11132883 Ga0105247_111328832 77
143 3300009174 Ga0105241_10142505 Ga0105241_101425053 77
144 3300009174 Ga0105241_10247001 Ga0105241_102470012 77
145 3300009176 Ga0105242_10000664 Ga0105242_1000066416 77
146 3300009176 Ga0105242_11108247 Ga0105242_111082472 77
147 3300009176 Ga0105242_11293146 Ga0105242_112931461 77
148 3300009177 Ga0105248_10468128 Ga0105248_104681282 77
149 3300009177 Ga0105248_10847283 Ga0105248_108472832 77
150 3300009177 Ga0105248_12774042 Ga0105248_127740422 77
151 3300009545 Ga0105237_10138347 Ga0105237_101383472 77
152 3300009545 Ga0105237_10966062 Ga0105237_109660621 77
153 3300009545 Ga0105237_10966966 Ga0105237_109669662 77
154 3300009545 Ga0105237_12112891 Ga0105237_121128912 77
155 3300009551 Ga0105238_10302852 Ga0105238_103028522 77
156 3300009551 Ga0105238_11039885 Ga0105238_110398851 77
157 3300009553 Ga0105249_10019455 Ga0105249_100194554 77
158 3300010159 Ga0099796_10033479 Ga0099796_100334793 77
159 3300010159 Ga0099796_10123512 Ga0099796_101235121 77
160 3300010375 Ga0105239_10003689 Ga0105239_1000368915 77
161 3300011119 Ga0105246_10805185 Ga0105246_108051852 77
162 3300011119 Ga0105246_11571494 Ga0105246_115714942 77
163 3300013100 Ga0157373_10519370 Ga0157373_105193702 77
164 3300013297 Ga0157378_11791776 Ga0157378_117917762 77
165 3300013297 Ga0157378_12917673 Ga0157378_129176731 77
166 3300013306 Ga0163162_11162948 Ga0163162_111629482 77
167 3300013306 Ga0163162_11255121 Ga0163162_112551212 77
168 3300013306 Ga0163162_11701451 Ga0163162_117014511 77
169 3300013306 Ga0163162_13457819 Ga0163162_134578191 77
170 3300013308 Ga0157375_11778593 Ga0157375_117785932 77
171 3300013308 Ga0157375_12569063 Ga0157375_125690631 77
172 3300013308 Ga0157375_12786495 Ga0157375_127864952 77
173 3300014325 Ga0163163_12120796 Ga0163163_121207962 77
174 3300014326 Ga0157380_10247869 Ga0157380_102478692 77
175 3300014745 Ga0157377_10687017 Ga0157377_106870172 77
176 3300014968 Ga0157379_11391491 Ga0157379_113914911 77
177 3300017792 Ga0163161_10213435 Ga0163161_102134353 77
178 3300017792 Ga0163161_10614218 Ga0163161_106142182 77
179 3300017792 Ga0163161_11093251 Ga0163161_110932511 77
180 3300021361 Ga0213872_10288225 Ga0213872_102882251 77
181 3300021384 Ga0213876_10240954 Ga0213876_102409542 77
182 3300022467 Ga0224712_10366208 Ga0224712_103662082 77
183 3300025295 Ga0209564_1007718 Ga0209564_10077186 77
184 3300025315 Ga0207697_10520874 Ga0207697_105208742 77
185 3300025903 Ga0207680_11028207 Ga0207680_110282071 77
186 3300025905 Ga0207685_10391751 Ga0207685_103917512 77
187 3300025908 Ga0207643_10362148 Ga0207643_103621482 77
188 3300025909 Ga0207705_10599518 Ga0207705_105995182 77
189 3300025911 Ga0207654_10290224 Ga0207654_102902242 77
190 3300025911 Ga0207654_10995632 Ga0207654_109956322 77
191 3300025911 Ga0207654_11263608 Ga0207654_112636082 77
192 3300025912 Ga0207707_10327989 Ga0207707_103279892 77
193 3300025914 Ga0207671_10159187 Ga0207671_101591872 77
194 3300025914 Ga0207671_10588270 Ga0207671_105882702 77
195 3300025914 Ga0207671_10801851 Ga0207671_108018511 77
196 3300025915 Ga0207693_10574732 Ga0207693_105747321 77
197 3300025917 Ga0207660_10037239 Ga0207660_100372392 77
198 3300025920 Ga0207649_10169999 Ga0207649_101699992 77
199 3300025921 Ga0207652_10062676 Ga0207652_100626763 77
200 3300025924 Ga0207694_10463502 Ga0207694_104635022 77
201 3300025925 Ga0207650_10982160 Ga0207650_109821601 77
202 3300025926 Ga0207659_10127146 Ga0207659_101271463 77
203 3300025927 Ga0207687_10407888 Ga0207687_104078883 77
204 3300025932 Ga0207690_11402729 Ga0207690_114027292 77
205 3300025934 Ga0207686_10004921 Ga0207686_100049218 77
206 3300025934 Ga0207686_10041741 Ga0207686_100417415 77
207 3300025934 Ga0207686_10054501 Ga0207686_100545013 77
208 3300025934 Ga0207686_10316261 Ga0207686_103162613 77
209 3300025936 Ga0207670_10841525 Ga0207670_108415251 77
210 3300025937 Ga0207669_10256628 Ga0207669_102566282 77
211 3300025938 Ga0207704_10120419 Ga0207704_101204192 77
212 3300025938 Ga0207704_10596650 Ga0207704_105966502 77
213 3300025944 Ga0207661_10961134 Ga0207661_109611342 77
214 3300025949 Ga0207667_10005407 Ga0207667_100054077 77
215 3300025961 Ga0207712_10230623 Ga0207712_102306233 77
216 3300025972 Ga0207668_10796499 Ga0207668_107964992 77
217 3300026023 Ga0207677_10646396 Ga0207677_106463962 77
218 3300026035 Ga0207703_10384165 Ga0207703_103841652 77
219 3300026035 Ga0207703_10849148 Ga0207703_108491482 77
220 3300026041 Ga0207639_10000690 Ga0207639_1000069015 77
221 3300026041 Ga0207639_10450435 Ga0207639_104504352 77
222 3300026067 Ga0207678_10589113 Ga0207678_105891132 77
223 3300026088 Ga0207641_11826677 Ga0207641_118266771 77
224 3300026089 Ga0207648_10862809 Ga0207648_108628092 77
225 3300026118 Ga0207675_101422610 Ga0207675_1014226102 77
226 3300026121 Ga0207683_10194830 Ga0207683_101948302 77
227 3300026121 Ga0207683_11409742 Ga0207683_114097422 77
228 3300026142 Ga0207698_11583851 Ga0207698_115838512 77
229 3300026142 Ga0207698_12314957 Ga0207698_123149571 77
230 3300027512 Ga0209179_1139766 Ga0209179_11397662 77
231 3300028379 Ga0268266_10342564 Ga0268266_103425642 77
232 3300028379 Ga0268266_11272915 Ga0268266_112729152 77
233 3300028379 Ga0268266_11822065 Ga0268266_118220652 77
234 3300028380 Ga0268265_11301714 Ga0268265_113017142 77
235 3300028556 Ga0265337_1095382 Ga0265337_10953821 77
236 3300028558 Ga0265326_10049477 Ga0265326_100494772 77
237 3300028563 Ga0265319_1037075 Ga0265319_10370751 77
238 3300028573 Ga0265334_10019489 Ga0265334_100194893 77
239 3300028653 Ga0265323_10015921 Ga0265323_100159213 77
240 3300028666 Ga0265336_10001725 Ga0265336_100017253 77
241 3300028786 Ga0307517_10000248 Ga0307517_1000024860 77
242 3300028794 Ga0307515_10016931 Ga0307515_1001693112 77
243 3300028800 Ga0265338_10008662 Ga0265338_100086623 77
244 3300028800 Ga0265338_10552473 Ga0265338_105524731 77
245 3300029957 Ga0265324_10079547 Ga0265324_100795473 77
246 3300031235 Ga0265330_10000594 Ga0265330_100005944 77
247 3300031238 Ga0265332_10001016 Ga0265332_100010164 77
248 3300031239 Ga0265328_10100854 Ga0265328_101008541 77
249 3300031242 Ga0265329_10009316 Ga0265329_100093164 77
250 3300031250 Ga0265331_10000422 Ga0265331_100004225 77
251 3300031251 Ga0265327_10007198 Ga0265327_100071984 77
252 3300031344 Ga0265316_10127171 Ga0265316_101271712 77
253 3300031616 Ga0307508_10023583 Ga0307508_100235833 77
254 3300031616 Ga0307508_10031735 Ga0307508_100317351 77
255 3300031711 Ga0265314_10012408 Ga0265314_100124084 77
256 3300031730 Ga0307516_10023476 Ga0307516_100234765 77
257 3300031730 Ga0307516_10164494 Ga0307516_101644943 77
258 3300031731 Ga0307405_10090917 Ga0307405_100909173 77
259 3300031901 Ga0307406_10765182 Ga0307406_107651822 77
260 3300031911 Ga0307412_10601484 Ga0307412_106014842 77
261 3300033180 Ga0307510_10403869 Ga0307510_104038692 77
262 3300033180 Ga0307510_10421748 Ga0307510_104217482 77
263 3300035084 Ga0373928_0158136 Ga0373928_0158136_15_284 77
264 3300035085 Ga0373929_0072431 Ga0373929_0072431_175_444 77
265 3300035090 Ga0373949_0215927 Ga0373949_0215927_273_542 77
266 3300035171 Ga0373946_0611905 Ga0373946_0611905_119_463 77
267 3300035242 Ga0373962_0111007 Ga0373962_0111007_96_365 77
268 3300035695 Ga0373927_0043019 Ga0373927_0043019_1889_2158 77
269 3300035695 Ga0373927_0070175 Ga0373927_0070175_1163_1426 77
270 3300035725 Ga0373947_0258533 Ga0373947_0258533_817_1086 77
271 3300036401 Ga0373937_0421529 Ga0373937_0421529_871_1140 77
272 3300037068 Ga0373925_0029655 Ga0373925_0029655_2903_3172 77
273 3300037068 Ga0373925_1632993 Ga0373925_1632993_21_365 77
274 3300037312 Ga0395899_0013514 Ga0395899_0013514_4614_4865 77
275 3300037418 Ga0395900_0013552 Ga0395900_0013552_1448_1699 77
276 3300037418 Ga0395900_0062620 Ga0395900_0062620_723_977 77
277 3300037418 Ga0395900_0110906 Ga0395900_0110906_1124_1378 77
278 3300037466 Ga0395898_0066817 Ga0395898_0066817_165_419 77
279 3300037471 Ga0395905_0121603 Ga0395905_0121603_1237_1488 77
280 3300037471 Ga0395905_0345630 Ga0395905_0345630_841_1083 77
281 3300037853 Ga0436364_0728813 Ga0436364_0728813_42_281 77
282 3300038443 Ga0395901_0054673 Ga0395901_0054673_2495_2746 77
283 3300039437 Ga0436365_0620439 Ga0436365_0620439_181_429 77
284 3300039437 Ga0436365_1780836 Ga0436365_1780836_1066_1317 77
285 3300039447 Ga0436361_1008973 Ga0436361_1008973_197_460 77
286 3300041413 Ga0439465_0141023 Ga0439465_0141023_600_842 77
287 3300041452 Ga0451793_0336403 Ga0451793_0336403_72_308 77
288 3300041452 Ga0451793_1575468 Ga0451793_1575468_259_522 77
289 3300041453 Ga0451797_0432824 Ga0451797_0432824_86_337 77
290 3300041459 Ga0451800_0511826 Ga0451800_0511826_322_576 77
291 3300041460 Ga0451802_0941259 Ga0451802_0941259_285_539 77
292 3300041460 Ga0451802_1754088 Ga0451802_1754088_227_496 77
293 3300041509 Ga0451843_0439534 Ga0451843_0439534_216_485 77
294 3300041509 Ga0451843_1048452 Ga0451843_1048452_88_351 77
295 3300041512 Ga0451853_1754813 Ga0451853_1754813_78_335 77
296 3300041512 Ga0451853_3497136 Ga0451853_3497136_54_317 77
297 3300042532 Ga0450893_0137059 Ga0450893_0137059_228_476 77
298 3300044672 Ga0466982_0146911 Ga0466982_0146911_939_1187 77
299 3300044683 Ga0466965_0032899 Ga0466965_0032899_1867_2121 77
300 3300044765 Ga0466970_0047796 Ga0466970_0047796_335_583 77
301 3300045976 Ga0466967_1050575 Ga0466967_1050575_424_678 77
302 3300046457 Ga0495590_0043238 Ga0495590_0043238_832_1089 77
303 3300046459 Ga0495629_0367713 Ga0495629_0367713_464_733 77
304 3300046460 Ga0495638_0504354 Ga0495638_0504354_62_319 77
305 3300046472 Ga0495580_0344446 Ga0495580_0344446_223_471 77
306 3300046474 Ga0495605_0055183 Ga0495605_0055183_604_861 77
307 3300046477 Ga0495664_0906603 Ga0495664_0906603_196_465 77
308 3300046491 Ga0495584_0078905 Ga0495584_0078905_1219_1476 77
309 3300046500 Ga0495596_0207340 Ga0495596_0207340_376_612 77
310 3300046501 Ga0495607_0014959 Ga0495607_0014959_4258_4515 77
311 3300046506 Ga0495583_0029901 Ga0495583_0029901_308_565 77
312 3300046513 Ga0495616_0050104 Ga0495616_0050104_1505_1756 77
313 3300046513 Ga0495616_0118457 Ga0495616_0118457_808_1065 77
314 3300046516 Ga0495628_1218504 Ga0495628_1218504_166_435 77
315 3300046517 Ga0495630_0325185 Ga0495630_0325185_469_738 77
316 3300046519 Ga0495632_0315008 Ga0495632_0315008_151_420 77
317 3300046522 Ga0495643_0014879 Ga0495643_0014879_447_698 77
318 3300046522 Ga0495643_0198006 Ga0495643_0198006_392_640 77
319 3300046528 Ga0495642_0032629 Ga0495642_0032629_1338_1595 77
320 3300046529 Ga0495652_0988850 Ga0495652_0988850_96_347 77
321 3300046533 Ga0495640_0807949 Ga0495640_0807949_143_412 77
322 3300046535 Ga0495586_0309746 Ga0495586_0309746_578_814 77
323 3300046537 Ga0495598_0161174 Ga0495598_0161174_195_464 77
324 3300046538 Ga0495609_0000250 Ga0495609_0000250_44992_45249 77
325 3300046542 Ga0495597_0103454 Ga0495597_0103454_379_636 77
326 3300046615 Ga0495656_0251836 Ga0495656_0251836_568_825 77
327 3300046616 Ga0495668_0007063 Ga0495668_0007063_1557_1814 77
328 3300046660 Ga0495625_0004342 Ga0495625_0004342_6313_6570 77
329 3300046663 Ga0495635_0544889 Ga0495635_0544889_37_306 77
330 3300046664 Ga0495659_0002327 Ga0495659_0002327_1411_1668 77
331 3300046665 Ga0495661_0037047 Ga0495661_0037047_300_551 77
332 3300046665 Ga0495661_0622385 Ga0495661_0622385_111_362 77
333 3300046674 Ga0495588_0344101 Ga0495588_0344101_430_699 77
334 3300046683 Ga0495658_0312283 Ga0495658_0312283_197_541 77
335 3300046684 Ga0495669_0006526 Ga0495669_0006526_4303_4560 77
336 3300046690 Ga0495624_0370665 Ga0495624_0370665_426_695 77
337 3300046694 Ga0495649_0048100 Ga0495649_0048100_575_823 77
338 3300046694 Ga0495649_0141041 Ga0495649_0141041_975_1232 77
339 3300046794 Ga0495589_0201908 Ga0495589_0201908_283_519 77
340 3300046810 Ga0495660_0017643 Ga0495660_0017643_824_1081 77
341 3300047318 Ga0495636_0054681 Ga0495636_0054681_1407_1664 77
342 3300047319 Ga0495674_0060099 Ga0495674_0060099_2517_2786 77
343 3300047320 Ga0495672_0005757 Ga0495672_0005757_8634_8876 77
344 3300047320 Ga0495672_0014599 Ga0495672_0014599_2281_2544 77
345 3300047443 Ga0495687_010538 Ga0495687_010538_4650_4907 77
346 3300047445 Ga0495677_0004241 Ga0495677_0004241_4732_4989 77
347 3300047447 Ga0495685_022954 Ga0495685_022954_601_858 77
348 3300047470 Ga0495681_0002977 Ga0495681_0002977_7661_7918 77
349 3300047472 Ga0495686_0469622 Ga0495686_0469622_165_434 77
350 3300048088 Ga0495602_0632271 Ga0495602_0632271_306_575 77
351 3300048091 Ga0495626_0171027 Ga0495626_0171027_159_428 77
352 3300048903 Ga0496100_0234847 Ga0496100_0234847_759_1028 77
353 3300048904 Ga0496101_0227990 Ga0496101_0227990_247_516 77
354 3300048904 Ga0496101_1234763 Ga0496101_1234763_283_552 77
355 3300048905 Ga0496102_1000166 Ga0496102_1000166_13_276 77
356 3300048905 Ga0496102_1797321 Ga0496102_1797321_59_328 77
357 3300048906 Ga0496103_0013657 Ga0496103_0013657_1853_2122 77
358 3300048907 Ga0496104_0195365 Ga0496104_0195365_441_710 77
359 3300048909 Ga0496106_0306860 Ga0496106_0306860_186_443 77
360 3300048910 Ga0496107_0072472 Ga0496107_0072472_760_1029 77
361 3300048911 Ga0496108_0041859 Ga0496108_0041859_2640_2909 77
362 3300048911 Ga0496108_0414968 Ga0496108_0414968_231_500 77
363 3300048911 Ga0496108_0978137 Ga0496108_0978137_147_416 77
364 3300048912 Ga0496109_0681399 Ga0496109_0681399_562_831 77
365 3300048912 Ga0496109_1184969 Ga0496109_1184969_167_436 77
366 3300048913 Ga0496110_0189545 Ga0496110_0189545_757_1026 77
367 3300048914 Ga0496111_0029844 Ga0496111_0029844_1938_2207 77
368 3300048915 Ga0496112_0247730 Ga0496112_0247730_239_508 77
369 3300048916 Ga0496113_0295947 Ga0496113_0295947_776_1045 77
370 3300048917 Ga0496114_0018797 Ga0496114_0018797_4220_4489 77
371 3300048918 Ga0496115_0036050 Ga0496115_0036050_2441_2710 77
372 3300048919 Ga0496116_0003489 Ga0496116_0003489_13170_13427 77
373 3300048921 Ga0496118_0172260 Ga0496118_0172260_789_1046 77
374 3300048924 Ga0496121_0447776 Ga0496121_0447776_250_519 77
375 3300048929 Ga0496126_0543787 Ga0496126_0543787_183_452 77
376 3300049568 Ga0501031_0320547 Ga0501031_0320547_571_807 77
377 3300049569 Ga0501032_0006487 Ga0501032_0006487_6241_6477 77
378 3300049570 Ga0501033_0216377 Ga0501033_0216377_848_1102 77
379 3300049571 Ga0501034_0000031 Ga0501034_0000031_21145_21381 77
380 3300049572 Ga0501036_0422550 Ga0501036_0422550_615_869 77
381 3300049572 Ga0501036_0565241 Ga0501036_0565241_324_560 77
382 3300049573 Ga0501037_0015345 Ga0501037_0015345_4504_4740 77
383 3300049574 Ga0501038_0206615 Ga0501038_0206615_201_437 77
384 3300049575 Ga0501039_0016592 Ga0501039_0016592_389_625 77
385 3300049575 Ga0501039_0624973 Ga0501039_0624973_243_497 77
386 3300049578 Ga0501042_0958756 Ga0501042_0958756_288_524 77
387 3300049579 Ga0501043_0027504 Ga0501043_0027504_1499_1735 77
388 3300049581 Ga0501047_0001332 Ga0501047_0001332_17760_17996 77
389 3300049581 Ga0501047_0162771 Ga0501047_0162771_1570_1824 77
390 3300049582 Ga0501048_0553662 Ga0501048_0553662_188_424 77
391 3300049583 Ga0501067_0002583 Ga0501067_0002583_6143_6379 77
392 3300049583 Ga0501067_0463811 Ga0501067_0463811_428_679 77
393 3300049586 Ga0501070_0041408 Ga0501070_0041408_402_638 77
394 3300049589 Ga0501073_0013629 Ga0501073_0013629_69_305 77
395 3300049589 Ga0501073_0698430 Ga0501073_0698430_426_680 77
396 3300049742 Ga0501080_0000483 Ga0501080_0000483_6257_6493 77
397 3300049744 Ga0501083_0090604 Ga0501083_0090604_125_367 77
398 3300049758 Ga0501241_137253 Ga0501241_137253_280_531 77
399 3300049822 Ga0501035_0001140 Ga0501035_0001140_6249_6485 77
400 3300049822 Ga0501035_0096031 Ga0501035_0096031_1081_1335 77
401 3300049823 Ga0501044_0000013 Ga0501044_0000013_25052_25288 77
402 3300049823 Ga0501044_0681424 Ga0501044_0681424_17_271 77
403 3300049824 Ga0501045_0019419 Ga0501045_0019419_760_996 77
404 3300050489 nmdc:mga03683_322505_c1 nmdc:mga03683_322505_c1_34_291 77
405 3300050490 nmdc:mga03n38_45608_c1 nmdc:mga03n38_45608_c1_670_933 77
406 3300050490 nmdc:mga03n38_532418_c1 nmdc:mga03n38_532418_c1_41_298 77
407 3300050491 nmdc:mga00v17_537460_c1 nmdc:mga00v17_537460_c1_352_621 77
408 3300050491 nmdc:mga00v17_756965_c1 nmdc:mga00v17_756965_c1_301_558 77
409 3300050492 nmdc:mga0yw44_232942_c1 nmdc:mga0yw44_232942_c1_704_961 77
410 3300050493 nmdc:mga0k408_765129_c1 nmdc:mga0k408_765129_c1_180_449 77
411 3300050494 nmdc:mga06z11_461817_c1 nmdc:mga06z11_461817_c1_249_506 77
412 3300050496 nmdc:mga07m45_335172_c1 nmdc:mga07m45_335172_c1_184_441 77
413 3300050510 nmdc:mga06r32_158354_c1 nmdc:mga06r32_158354_c1_1073_1315 77
414 3300050516 nmdc:mga0sz30_10704_c1 nmdc:mga0sz30_10704_c1_2163_2420 77
415 3300053077 Ga0495601_0353022 Ga0495601_0353022_232_501 77
416 3300053077 Ga0495601_0736450 Ga0495601_0736450_368_610 77
417 3300053078 Ga0495612_0155108 Ga0495612_0155108_66_335 77
418 3300053084 Ga0495595_0158073 Ga0495595_0158073_224_493 77
419 3300053085 Ga0495619_0139735 Ga0495619_0139735_601_870 77
420 3300053091 Ga0500647_0139182 Ga0500647_0139182_766_1008 77
421 3300053111 Ga0500572_134246 Ga0500572_134246_452_700 77
422 3300053121 Ga0500607_062335 Ga0500607_062335_1325_1573 77
423 3300053140 Ga0500573_0214965 Ga0500573_0214965_47_286 77
424 3300053140 Ga0500573_0296097 Ga0500573_0296097_36_272 77
425 3300053151 Ga0500604_0174305 Ga0500604_0174305_220_489 77
426 3300053153 Ga0500616_0033482 Ga0500616_0033482_275_514 77
427 3300053724 Ga0500570_068143 Ga0500570_068143_1362_1619 77
428 3300053730 Ga0500645_060294 Ga0500645_060294_776_1024 77
429 3300059508 Ga0587088_209674 Ga0587088_209674_130_384 77
430 3300060353 Ga0501082_0003443 Ga0501082_0003443_3159_3395 77

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11730

DUF3297

Protein of unknown function (DUF3297)

11

81

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
2icg-assembly1.cif.gz_A crystal structure of a protein of unknown function (np_472245.1) from listeria innocua at 1.65 a resolution 0.6182 39 69
1qez-assembly1.cif.gz_F sulfolobus acidocaldarius inorganic pyrophosphatase: an archael pyrophosphatase. 0.5168 48 74
7yta-assembly1.cif.gz_A crystal structure of ntagdp3 agd1-2 in complex with an h3k9me2 peptide 0.4451 28 77
3mp6-assembly1.cif.gz_A complex structure of sgf29 and dimethylated h3k4 0.4448 25 76
3mp1-assembly1.cif.gz_A complex structure of sgf29 and trimethylated h3k4 0.4396 25 76
ID Description Score Start End Superfamily
af_Q4DCU2_5_434_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.6154 44 70 3.50.50.100
af_A0A1D6LPC7_51_198_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.5731 45 70 3.50.50.60
af_Q8H5X6_117_561_3.50.50.100 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain; 0.5588 44 70 3.50.50.100
af_Q9BL48_11_358_3.90.1410.10 Alpha Beta;Alpha-Beta Complex;set domain protein methyltransferase, domain 1;set domain protein methyltransferase, domain 1 0.5203 44 72 3.90.1410.10
af_P11875_109_453_3.40.50.620 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HUPs 0.4981 46 67 3.40.50.620
ID Description Score Start End GO Terms
AF-A0A4D7CC05-F1-model_v4 DUF3297 family protein 1.001 3 77
AF-A0A846MW21-F1-model_v4 Glutathione peroxidase 1.001 3 77
AF-A0A0Q7TP90-F1-model_v4 Glutathione peroxidase 1.001 6 77 GO:0004601
AF-A0A7U1HSS0-F1-model_v4 deleted 1.001 6 77
AF-A0A1T4SYZ1-F1-model_v4 Glutathione peroxidase 0.999 3 77

Feature Viewer

pLDDT pTM Quality
91.26 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map