F441937

General Info

Members Datasets Scaffolds Average Seq Length
429 259 429 513

Family's Representative Sequence

Representative Sequence 3300029957|Ga0265324_10001765|Ga0265324_100017655
Length 549
Sequence MPIKHPNLNLSRLTDALPAWTGDVSPDDLYDICQQVRDGGGRLVALWGSDPRLQGSGCDTLPTESADCGSRALAPPLASEGSAPPCRGRCFFLHVTLMNETGLVCLNVPLPSEHPNYPDISRIFPAANRMQRAAYDLLGIYAHDGHDHRKWLRHGAWHSGSFPLRKDFDAAASRTQDADDYPFVQVEGQGVHEIPVGPVHAGIIEPGHFRFSIIGERVLRLEERLGYVHKGIEKRFESMSLQQGAKLAGRVSGDSTVAYAWAYAMAAESVAKVTPPGRALWLRALLLERERIANHLGDLGYLGNDVALSFGFAQFWILKEQVLRNNAALFGHRYLMDKIVPGGVTVNLSLEGKSLIEQECDMLEQQVSILRGIYDEHAGVQDRFIATGRVEPALAAQLGLCGLAGRASAQAWDARVQFACAPYDKLDVQMATYRNGDVAARAIVRFDELFESLRLQRDILVNLIHEDEAPALLEKLPPNGFGIGMVEGWRGEVLVAIHTDAMGNLTRVHPHDPSWQNWPLLEHAVIDNIVPDFPLINKSFNLSYTGQDL

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
83 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
84 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
90 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
144 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
145 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
146 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
147 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
150 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
151 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
157 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
158 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
162 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
170 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
177 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
182 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
183 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
184 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
185 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
186 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
187 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
188 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
191 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
192 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
193 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
197 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
198 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
199 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
200 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
201 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
202 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
203 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
207 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
208 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
224 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
225 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
226 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
227 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
236 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
237 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
238 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
242 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
243 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
247 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
248 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
249 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
253 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
254 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
255 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
256 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
257 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
258 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.17
Nodule 0
Rhizoplane 2.1
Rhizosphere 95.8
Stem 0
Stem Tuber 0
Unclassified 0.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10068735 3300005290 Bacteria 9198
2 Ga0065707_10000604 3300005295 Bacteria 25275
3 Ga0070690_100135595 3300005330 Bacteria 1667
4 Ga0070670_100001928 3300005331 Bacteria 16975
5 Ga0070670_100065753 3300005331 Bacteria 3111
6 Ga0070670_100142902 3300005331 Bacteria 2070
7 Ga0070666_10009317 3300005335 Bacteria 6117
8 Ga0070666_10031572 3300005335 Bacteria 3497
9 Ga0070680_100024696 3300005336 Bacteria 4804
10 Ga0070682_100050808 3300005337 Bacteria 2590
11 Ga0070660_100000799 3300005339 Bacteria 20883
12 Ga0070660_100001577 3300005339 Bacteria 15675
13 Ga0070660_100008415 3300005339 Bacteria 7210
14 Ga0070689_100021096 3300005340 Bacteria 4844
15 Ga0070689_100123009 3300005340 Bacteria 2074
16 Ga0070687_100014277 3300005343 Bacteria 3565
17 Ga0070661_100003820 3300005344 Bacteria 10367
18 Ga0070661_100024877 3300005344 Bacteria 4298
19 Ga0070661_100031817 3300005344 Bacteria 3816
20 Ga0070668_100013956 3300005347 Bacteria 6006
21 Ga0070668_100100451 3300005347 Bacteria 2292
22 Ga0070669_100022933 3300005353 Bacteria 4465
23 Ga0070675_100008107 3300005354 Bacteria 8145
24 Ga0070675_100012249 3300005354 Bacteria 6722
25 Ga0070671_100007612 3300005355 Bacteria 8662
26 Ga0070671_100030387 3300005355 Bacteria 4458
27 Ga0070671_100154813 3300005355 Bacteria 1936
28 Ga0070674_100066444 3300005356 Bacteria 2534
29 Ga0070673_100009579 3300005364 Bacteria 6509
30 Ga0070673_100018365 3300005364 Bacteria 4993
31 Ga0070688_100003522 3300005365 Bacteria 8067
32 Ga0070688_100052238 3300005365 Bacteria 2552
33 Ga0070659_100000861 3300005366 Bacteria 22182
34 Ga0070659_100004899 3300005366 Bacteria 9570
35 Ga0070659_100055236 3300005366 Bacteria 3129
36 Ga0070667_100123875 3300005367 Bacteria 2251
37 Ga0070714_100053197 3300005435 Bacteria 3455
38 Ga0070713_100000230 3300005436 Bacteria 37150
39 Ga0070705_100069841 3300005440 Bacteria 2119
40 Ga0070700_100057096 3300005441 Bacteria 2449
41 Ga0070694_100014369 3300005444 Bacteria 4955
42 Ga0070663_100003808 3300005455 Bacteria 8777
43 Ga0070678_100004548 3300005456 Bacteria 7876
44 Ga0070678_100042498 3300005456 Bacteria 3231
45 Ga0070678_100068626 3300005456 Bacteria 2644
46 Ga0070662_100000104 3300005457 Bacteria 46608
47 Ga0070662_100026150 3300005457 Bacteria 4040
48 Ga0070681_10001793 3300005458 Bacteria 19292
49 Ga0070681_10011101 3300005458 Bacteria 8913
50 Ga0070681_10021299 3300005458 Bacteria 6498
51 Ga0070681_10106770 3300005458 Bacteria 2741
52 Ga0068867_100020703 3300005459 Bacteria 4688
53 Ga0068867_100023401 3300005459 Bacteria 4421
54 Ga0070685_10001069 3300005466 Bacteria 14684
55 Ga0070706_100124704 3300005467 Bacteria 2401
56 Ga0070698_100003359 3300005471 Bacteria 17613
57 Ga0070699_100025181 3300005518 Bacteria 5131
58 Ga0070679_100004207 3300005530 Bacteria 13276
59 Ga0070679_100056655 3300005530 Bacteria 3905
60 Ga0070697_100017678 3300005536 Bacteria 5617
61 Ga0068853_100016867 3300005539 Bacteria 6018
62 Ga0068853_100026709 3300005539 Bacteria 4850
63 Ga0070672_100015872 3300005543 Bacteria 5377
64 Ga0070672_100029187 3300005543 Bacteria 4134
65 Ga0070665_100039670 3300005548 Bacteria 4734
66 Ga0070665_100070638 3300005548 Bacteria 3498
67 Ga0068855_100003706 3300005563 Bacteria 18680
68 Ga0070664_100001127 3300005564 Bacteria 21142
69 Ga0070664_100081187 3300005564 Bacteria 2794
70 Ga0070664_100109152 3300005564 Bacteria 2413
71 Ga0068857_100026787 3300005577 Bacteria 5083
72 Ga0068854_100011338 3300005578 Bacteria 5797
73 Ga0068856_100001177 3300005614 Bacteria 27521
74 Ga0068856_100003893 3300005614 Bacteria 14976
75 Ga0068856_100025087 3300005614 Bacteria 5810
76 Ga0068856_100045188 3300005614 Bacteria 4336
77 Ga0070702_100004689 3300005615 Bacteria 6271
78 Ga0068852_100057536 3300005616 Bacteria 3365
79 Ga0068859_100123655 3300005617 Bacteria 2655
80 Ga0068859_100139587 3300005617 Bacteria 2497
81 Ga0068859_100145782 3300005617 Bacteria 2442
82 Ga0068864_100008410 3300005618 Bacteria 8514
83 Ga0068866_10038088 3300005718 Bacteria 2365
84 Ga0068861_100075639 3300005719 Bacteria 2622
85 Ga0068851_10015007 3300005834 Bacteria 3685
86 Ga0068851_10066699 3300005834 Bacteria 1855
87 Ga0068863_100087137 3300005841 Bacteria 2958
88 Ga0068863_100129680 3300005841 Bacteria 2407
89 Ga0068863_100147250 3300005841 Bacteria 2252
90 Ga0068858_100014286 3300005842 Bacteria 7487
91 Ga0068858_100045158 3300005842 Bacteria 4083
92 Ga0068860_100025801 3300005843 Bacteria 5668
93 Ga0068862_100105027 3300005844 Bacteria 2475
94 Ga0097621_100005133 3300006237 Bacteria 9198
95 Ga0097621_100192147 3300006237 Bacteria 1768
96 Ga0068871_100051425 3300006358 Bacteria 3336
97 Ga0075428_100000165 3300006844 Bacteria 60894
98 Ga0075428_100008857 3300006844 Bacteria 11162
99 Ga0075428_100012410 3300006844 Bacteria 9476
100 Ga0075428_100038094 3300006844 Bacteria 5292
101 Ga0075430_100025118 3300006846 Bacteria 5068
102 Ga0075431_100010025 3300006847 Bacteria 9518
103 Ga0075431_100013529 3300006847 Bacteria 8245
104 Ga0075429_100000019 3300006880 Bacteria 70971
105 Ga0075429_100026718 3300006880 Bacteria 5012
106 Ga0075429_100076364 3300006880 Bacteria 2918
107 Ga0075429_100213183 3300006880 Bacteria 1692
108 Ga0075436_100000090 3300006914 Bacteria 52278
109 Ga0075436_100073977 3300006914 Bacteria 2359
110 Ga0097620_100123657 3300006931 Bacteria 2655
111 Ga0097620_100139585 3300006931 Bacteria 2497
112 Ga0097620_100145783 3300006931 Bacteria 2442
113 Ga0099794_10008049 3300007265 Bacteria 4362
114 Ga0099794_10024107 3300007265 Bacteria 2790
115 Ga0099794_10070733 3300007265 Bacteria 1708
116 Ga0105240_10059274 3300009093 Bacteria 4778
117 Ga0111539_10000660 3300009094 Bacteria 44559
118 Ga0111539_10005116 3300009094 Bacteria 17009
119 Ga0111539_10295517 3300009094 Bacteria 1885
120 Ga0105245_10149910 3300009098 Bacteria 2204
121 Ga0114129_10007801 3300009147 Bacteria 15231
122 Ga0114129_10011889 3300009147 Bacteria 12382
123 Ga0114129_10335383 3300009147 Bacteria 2007
124 Ga0105243_10229991 3300009148 Bacteria 1644
125 Ga0105242_10042706 3300009176 Bacteria 3663
126 Ga0105242_10074120 3300009176 Bacteria 2832
127 Ga0105248_10023081 3300009177 Bacteria 6909
128 Ga0105248_10030595 3300009177 Bacteria 6012
129 Ga0105248_10129275 3300009177 Bacteria 2849
130 Ga0105237_10049044 3300009545 Bacteria 4245
131 Ga0105237_10107241 3300009545 Bacteria 2785
132 Ga0099796_10004836 3300010159 Bacteria 3303
133 Ga0105239_10038319 3300010375 Bacteria 5253
134 Ga0157373_10000587 3300013100 Bacteria 28331
135 Ga0157371_10000292 3300013102 Bacteria 67427
136 Ga0157370_10004642 3300013104 Bacteria 15700
137 Ga0157370_10024505 3300013104 Bacteria 5977
138 Ga0157370_10038414 3300013104 Bacteria 4630
139 Ga0157370_10040931 3300013104 Bacteria 4472
140 Ga0157370_10165937 3300013104 Bacteria 2054
141 Ga0157374_10000145 3300013296 Bacteria 64560
142 Ga0157374_10008142 3300013296 Bacteria 8960
143 Ga0157374_10245856 3300013296 Bacteria 1760
144 Ga0163162_10026266 3300013306 Bacteria 5755
145 Ga0163162_10112069 3300013306 Bacteria 2826
146 Ga0163162_10151259 3300013306 Bacteria 2439
147 Ga0157372_10002571 3300013307 Bacteria 19669
148 Ga0157372_10098386 3300013307 Bacteria 3338
149 Ga0157372_10333090 3300013307 Bacteria 1768
150 Ga0157375_10001786 3300013308 Bacteria 18442
151 Ga0157375_10033235 3300013308 Bacteria 4899
152 Ga0157375_10042247 3300013308 Bacteria 4411
153 Ga0157375_10042813 3300013308 Bacteria 4386
154 Ga0157375_10095422 3300013308 Bacteria 3045
155 Ga0157375_10213789 3300013308 Bacteria 2086
156 Ga0163163_10035804 3300014325 Bacteria 4818
157 Ga0163163_10070037 3300014325 Bacteria 3493
158 Ga0163163_10170907 3300014325 Bacteria 2220
159 Ga0157380_10135331 3300014326 Bacteria 2108
160 Ga0157377_10003464 3300014745 Bacteria 7151
161 Ga0157379_10007469 3300014968 Bacteria 9465
162 Ga0157376_10024121 3300014969 Bacteria 4771
163 Ga0157376_10093419 3300014969 Bacteria 2611
164 Ga0157376_10100746 3300014969 Bacteria 2523
165 Ga0157376_10235547 3300014969 Bacteria 1703
166 Ga0163161_10019775 3300017792 Bacteria 4724
167 Ga0163161_10026156 3300017792 Bacteria 4134
168 Ga0163161_10118677 3300017792 Bacteria 1985
169 Ga0209025_1000115 3300025294 Bacteria 218871
170 Ga0209051_1001595 3300025303 Bacteria 18602
171 Ga0207697_10000065 3300025315 Bacteria 44779
172 Ga0207682_10011818 3300025893 Bacteria 3411
173 Ga0207642_10031638 3300025899 Bacteria 2218
174 Ga0207642_10041701 3300025899 Bacteria 2012
175 Ga0207688_10011496 3300025901 Bacteria 4818
176 Ga0207688_10071292 3300025901 Bacteria 1972
177 Ga0207680_10039241 3300025903 Bacteria 2746
178 Ga0207685_10026736 3300025905 Bacteria 2011
179 Ga0207643_10001550 3300025908 Bacteria 13102
180 Ga0207643_10055431 3300025908 Bacteria 2254
181 Ga0207684_10037182 3300025910 Bacteria 4131
182 Ga0207684_10147085 3300025910 Bacteria 2027
183 Ga0207707_10005840 3300025912 Bacteria 10757
184 Ga0207707_10005908 3300025912 Bacteria 10707
185 Ga0207707_10037659 3300025912 Bacteria 4226
186 Ga0207695_10048889 3300025913 Bacteria 4463
187 Ga0207671_10027246 3300025914 Bacteria 4272
188 Ga0207693_10145396 3300025915 Bacteria 1864
189 Ga0207660_10071076 3300025917 Bacteria 2531
190 Ga0207657_10001557 3300025919 Bacteria 24609
191 Ga0207657_10005143 3300025919 Bacteria 13712
192 Ga0207649_10016067 3300025920 Bacteria 4214
193 Ga0207649_10041344 3300025920 Bacteria 2806
194 Ga0207649_10054083 3300025920 Bacteria 2497
195 Ga0207652_10008490 3300025921 Bacteria 8268
196 Ga0207652_10049041 3300025921 Bacteria 3613
197 Ga0207681_10012058 3300025923 Bacteria 5325
198 Ga0207681_10059622 3300025923 Bacteria 2617
199 Ga0207650_10001922 3300025925 Bacteria 14637
200 Ga0207659_10002953 3300025926 Bacteria 10125
201 Ga0207659_10007377 3300025926 Bacteria 6757
202 Ga0207700_10000697 3300025928 Bacteria 19529
203 Ga0207664_10040452 3300025929 Bacteria 3626
204 Ga0207644_10000873 3300025931 Bacteria 19022
205 Ga0207644_10003451 3300025931 Bacteria 10220
206 Ga0207644_10020989 3300025931 Bacteria 4446
207 Ga0207644_10041111 3300025931 Bacteria 3269
208 Ga0207644_10074937 3300025931 Bacteria 2485
209 Ga0207690_10000545 3300025932 Bacteria 24599
210 Ga0207706_10000040 3300025933 Bacteria 132285
211 Ga0207706_10018911 3300025933 Bacteria 6195
212 Ga0207706_10036791 3300025933 Bacteria 4348
213 Ga0207686_10070035 3300025934 Bacteria 2252
214 Ga0207670_10061872 3300025936 Bacteria 2556
215 Ga0207670_10102362 3300025936 Bacteria 2048
216 Ga0207669_10029179 3300025937 Bacteria 3047
217 Ga0207691_10003580 3300025940 Bacteria 15123
218 Ga0207691_10005828 3300025940 Bacteria 11914
219 Ga0207691_10039422 3300025940 Bacteria 4371
220 Ga0207691_10110977 3300025940 Bacteria 2439
221 Ga0207689_10009430 3300025942 Bacteria 8429
222 Ga0207689_10033045 3300025942 Bacteria 4300
223 Ga0207679_10001055 3300025945 Bacteria 17541
224 Ga0207679_10006267 3300025945 Bacteria 7504
225 Ga0207679_10022730 3300025945 Bacteria 4275
226 Ga0207679_10084599 3300025945 Bacteria 2434
227 Ga0207679_10102200 3300025945 Bacteria 2244
228 Ga0207651_10003012 3300025960 Bacteria 8160
229 Ga0207651_10010241 3300025960 Bacteria 5186
230 Ga0207668_10005437 3300025972 Bacteria 7499
231 Ga0207668_10025565 3300025972 Bacteria 3823
232 Ga0207668_10097833 3300025972 Bacteria 2173
233 Ga0207658_10096573 3300025986 Bacteria 2305
234 Ga0207677_10007429 3300026023 Bacteria 6061
235 Ga0207677_10009605 3300026023 Bacteria 5445
236 Ga0207677_10047467 3300026023 Bacteria 2884
237 Ga0207703_10022926 3300026035 Bacteria 4903
238 Ga0207703_10106838 3300026035 Bacteria 2382
239 Ga0207703_10160225 3300026035 Bacteria 1970
240 Ga0207703_10242918 3300026035 Bacteria 1619
241 Ga0207639_10004783 3300026041 Bacteria 9132
242 Ga0207639_10009484 3300026041 Bacteria 6718
243 Ga0207678_10012329 3300026067 Bacteria 7506
244 Ga0207708_10050156 3300026075 Bacteria 3177
245 Ga0207702_10005806 3300026078 Bacteria 10735
246 Ga0207702_10007390 3300026078 Bacteria 9379
247 Ga0207641_10092987 3300026088 Bacteria 2642
248 Ga0207648_10013019 3300026089 Bacteria 7760
249 Ga0207648_10019355 3300026089 Bacteria 6145
250 Ga0207648_10070382 3300026089 Bacteria 3050
251 Ga0207648_10129043 3300026089 Bacteria 2225
252 Ga0207674_10007268 3300026116 Bacteria 12912
253 Ga0207675_100002063 3300026118 Bacteria 20031
254 Ga0207675_100018784 3300026118 Bacteria 6451
255 Ga0207683_10001488 3300026121 Bacteria 21128
256 Ga0207683_10006415 3300026121 Bacteria 10073
257 Ga0207683_10088708 3300026121 Bacteria 2752
258 Ga0207698_10110723 3300026142 Bacteria 2301
259 Ga0210000_1000386 3300027462 Bacteria 6206
260 Ga0209995_1001392 3300027471 Bacteria 3728
261 Ga0209588_1001503 3300027671 Bacteria 6142
262 Ga0209974_10006134 3300027876 Bacteria 4211
263 Ga0207428_10004725 3300027907 Bacteria 12885
264 Ga0268266_10133560 3300028379 Bacteria 2222
265 Ga0268265_10137132 3300028380 Bacteria 2043
266 Ga0268264_10010585 3300028381 Bacteria 7624
267 Ga0268264_10162159 3300028381 Bacteria 2015
268 Ga0265336_10000151 3300028666 Bacteria 49239
269 Ga0307517_10000024 3300028786 Bacteria 185597
270 Ga0307515_10000043 3300028794 Bacteria 304612
271 Ga0265324_10000001 3300029957 Bacteria 562975
272 Ga0265324_10001765 3300029957 Bacteria 11863
273 Ga0265324_10027562 3300029957 Bacteria 2006
274 Ga0265328_10000050 3300031239 Bacteria 79086
275 Ga0265325_10000046 3300031241 Bacteria 83850
276 Ga0265325_10027370 3300031241 Bacteria 3081
277 Ga0265331_10047800 3300031250 Bacteria 2059
278 Ga0265327_10010823 3300031251 Bacteria 6358
279 Ga0265327_10024921 3300031251 Bacteria 3500
280 Ga0265316_10057451 3300031344 Bacteria 3034
281 Ga0307508_10001454 3300031616 Bacteria 26572
282 Ga0265314_10001889 3300031711 Bacteria 22435
283 Ga0265314_10036493 3300031711 Bacteria 3571
284 Ga0307516_10000093 3300031730 Bacteria 100540
285 Ga0307410_10000805 3300031852 Bacteria 13277
286 Ga0307406_10002957 3300031901 Bacteria 9263
287 Ga0307407_10009249 3300031903 Bacteria 4578
288 Ga0307412_10005459 3300031911 Bacteria 7136
289 Ga0307411_10012356 3300032005 Bacteria 4656
290 Ga0307415_100003848 3300032126 Bacteria 7700
291 Ga0373926_0023997 3300035083 Bacteria 2121
292 Ga0373934_0000137 3300035086 Bacteria 26986
293 Ga0373934_0009643 3300035086 Bacteria 3619
294 Ga0373923_0012158 3300035111 Bacteria 3174
295 Ga0373936_0014235 3300035113 Bacteria 3039
296 Ga0373953_0001139 3300035117 Bacteria 7546
297 Ga0373956_0000018 3300035119 Bacteria 50671
298 Ga0373957_0001455 3300035120 Bacteria 6413
299 Ga0373955_0004003 3300035172 Bacteria 6508
300 Ga0373955_0006996 3300035172 Bacteria 5164
301 Ga0373955_0013953 3300035172 Bacteria 3899
302 Ga0373942_0005755 3300035207 Bacteria 2869
303 Ga0373924_0002265 3300035410 Bacteria 6455
304 Ga0373935_0027504 3300035692 Bacteria 3514
305 Ga0373927_0017543 3300035695 Bacteria 4710
306 Ga0373933_0000035 3300035724 Bacteria 82702
307 Ga0373933_0048677 3300035724 Bacteria 2524
308 Ga0373937_0001322 3300036401 Bacteria 20734
309 Ga0373937_0023151 3300036401 Bacteria 5590
310 Ga0373937_0077321 3300036401 Bacteria 3075
311 Ga0373925_0008462 3300037068 Bacteria 7497
312 Ga0373925_0009800 3300037068 Bacteria 6956
313 Ga0373925_0067280 3300037068 Bacteria 2702
314 Ga0395899_0154199 3300037312 Bacteria 1626
315 Ga0395900_0029810 3300037418 Bacteria 5600
316 Ga0395898_0007662 3300037466 Bacteria 11463
317 Ga0395898_0015889 3300037466 Bacteria 7713
318 Ga0395905_0113645 3300037471 Bacteria 2544
319 Ga0395901_0023249 3300038443 Bacteria 6354
320 Ga0439434_0000292 3300042435 Bacteria 14336
321 Ga0451577_0000013 3300042876 Bacteria 550689
322 Ga0451577_0004435 3300042876 Bacteria 14817
323 Ga0466969_0001856 3300044656 Bacteria 11299
324 Ga0453683_0000113 3300044673 Bacteria 121290
325 Ga0453683_0006373 3300044673 Bacteria 8104
326 Ga0453683_0032192 3300044673 Bacteria 3310
327 Ga0466966_0026667 3300044684 Bacteria 3772
328 Ga0466963_0084819 3300044694 Bacteria 2150
329 Ga0466963_0088749 3300044694 Bacteria 2103
330 Ga0453684_0000085 3300044712 Bacteria 397817
331 Ga0453684_0000348 3300044712 Bacteria 192530
332 Ga0451576_0000018 3300045051 Bacteria 550689
333 Ga0451576_0012318 3300045051 Bacteria 9616
334 Ga0451576_0013583 3300045051 Bacteria 9103
335 Ga0451576_0050877 3300045051 Bacteria 4345
336 Ga0466967_0194804 3300045976 Bacteria 1917
337 Ga0495592_0000673 3300046454 Bacteria 23788
338 Ga0495638_0010227 3300046460 Bacteria 6530
339 Ga0495651_0000350 3300046462 Bacteria 35585
340 Ga0495653_0007068 3300046463 Bacteria 9210
341 Ga0495580_0008595 3300046472 Bacteria 8101
342 Ga0495580_0009699 3300046472 Bacteria 7552
343 Ga0495639_0001641 3300046475 Bacteria 9963
344 Ga0495662_0026079 3300046476 Bacteria 2823
345 Ga0495664_0000685 3300046477 Bacteria 17239
346 Ga0495594_0034275 3300046499 Bacteria 2761
347 Ga0495608_0006821 3300046511 Bacteria 8096
348 Ga0495616_0008295 3300046513 Bacteria 6166
349 Ga0495618_0014062 3300046514 Bacteria 4872
350 Ga0495628_0001118 3300046516 Bacteria 24530
351 Ga0495628_0002610 3300046516 Bacteria 16183
352 Ga0495628_0043143 3300046516 Bacteria 3594
353 Ga0495630_0010229 3300046517 Bacteria 6768
354 Ga0495666_0002906 3300046526 Bacteria 8583
355 Ga0495666_0017428 3300046526 Bacteria 3577
356 Ga0495652_0000469 3300046529 Bacteria 47242
357 Ga0495640_0048220 3300046533 Bacteria 2944
358 Ga0495586_0013448 3300046535 Bacteria 4340
359 Ga0495586_0037554 3300046535 Bacteria 2600
360 Ga0495621_0032544 3300046539 Bacteria 1794
361 Ga0495645_0000044 3300046543 Bacteria 90950
362 Ga0495645_0001756 3300046543 Bacteria 14734
363 Ga0495634_0006920 3300046642 Bacteria 8571
364 Ga0495635_0031188 3300046663 Bacteria 3703
365 Ga0495635_0036201 3300046663 Bacteria 3421
366 Ga0495657_0074001 3300046675 Bacteria 2217
367 Ga0495657_0130909 3300046675 Bacteria 1571
368 Ga0495599_0000684 3300046678 Bacteria 19253
369 Ga0495623_0094289 3300046679 Bacteria 1831
370 Ga0495647_0001672 3300046681 Bacteria 6867
371 Ga0495658_0007709 3300046683 Bacteria 5334
372 Ga0495613_0049297 3300046689 Bacteria 3108
373 Ga0495600_0012641 3300046809 Bacteria 5284
374 Ga0495674_0008528 3300047319 Bacteria 9755
375 Ga0495675_0019343 3300047444 Bacteria 4325
376 Ga0495684_0031212 3300047471 Bacteria 4090
377 Ga0496101_0143863 3300048904 Bacteria 1820
378 Ga0496102_0001647 3300048905 Bacteria 19659
379 Ga0496102_0088656 3300048905 Bacteria 2861
380 Ga0496102_0180461 3300048905 Bacteria 1989
381 Ga0496103_0143156 3300048906 Bacteria 1530
382 Ga0496105_0006960 3300048908 Bacteria 8712
383 Ga0496106_0058103 3300048909 Bacteria 2927
384 Ga0496109_0002930 3300048912 Bacteria 14265
385 Ga0496112_0001941 3300048915 Bacteria 16333
386 Ga0501034_0016259 3300049571 Bacteria 7637
387 Ga0501034_0023355 3300049571 Bacteria 6301
388 Ga0501036_0085296 3300049572 Bacteria 2669
389 Ga0501039_0010297 3300049575 Bacteria 7132
390 Ga0501040_0108416 3300049576 Bacteria 1941
391 Ga0501041_0002039 3300049577 Bacteria 11366
392 Ga0501047_0004510 3300049581 Bacteria 13101
393 Ga0501047_0014855 3300049581 Bacteria 7411
394 Ga0501047_0055441 3300049581 Bacteria 3833
395 Ga0501047_0066158 3300049581 Bacteria 3484
396 Ga0501067_0001455 3300049583 Bacteria 12873
397 Ga0501070_0048415 3300049586 Bacteria 3531
398 Ga0501073_0006686 3300049589 Bacteria 8586
399 Ga0501076_0004088 3300049592 Bacteria 10316
400 Ga0501079_0019118 3300049741 Bacteria 5234
401 Ga0501079_0147636 3300049741 Bacteria 1833
402 Ga0501080_0000303 3300049742 Bacteria 37542
403 Ga0501080_0004563 3300049742 Bacteria 12345
404 Ga0501080_0006561 3300049742 Bacteria 10458
405 Ga0501080_0008076 3300049742 Bacteria 9539
406 Ga0501080_0014737 3300049742 Bacteria 7199
407 Ga0501081_0003238 3300049743 Bacteria 10359
408 Ga0501083_0065829 3300049744 Bacteria 2414
409 Ga0501035_0065494 3300049822 Bacteria 3227
410 Ga0501035_0178832 3300049822 Bacteria 1829
411 Ga0501044_0011796 3300049823 Bacteria 9467
412 nmdc:mga05p37_67_c1 3300050507 Bacteria 91619
413 nmdc:mga09592_18083_c1 3300050508 Bacteria 5779
414 nmdc:mga09592_45_c1 3300050508 Bacteria 69144
415 nmdc:mga0qj67_35234_c1 3300050509 Bacteria 3912
416 nmdc:mga06r32_43413_c1 3300050510 Bacteria 4278
417 nmdc:mga08y16_1100_c1 3300050511 Bacteria 26629
418 nmdc:mga08y16_6448_c1 3300050511 Bacteria 12306
419 nmdc:mga08x19_81_c1 3300050514 Bacteria 87015
420 nmdc:mga0a205_75073_c1 3300050515 Bacteria 3266
421 Ga0495601_0003295 3300053077 Bacteria 9233
422 Ga0500610_0000061 3300053079 Bacteria 34215
423 Ga0495595_0008394 3300053084 Bacteria 4239
424 Ga0495619_0038598 3300053085 Bacteria 3115
425 Ga0500608_000226 3300053122 Bacteria 22247
426 Ga0500574_001470 3300053141 Bacteria 3530
427 Ga0501084_0033155 3300054114 Bacteria 4320
428 Ga0501082_0018136 3300060353 Bacteria 6061
429 Ga0501082_0029722 3300060353 Bacteria 4708

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026035 Ga0207703_10242918 Ga0207703_102429181 393
2 3300049822 Ga0501035_0178832 Ga0501035_0178832_448_1797 410
3 3300048906 Ga0496103_0143156 Ga0496103_0143156_17_1285 414
4 3300046675 Ga0495657_0130909 Ga0495657_0130909_18_1346 438
5 3300046689 Ga0495613_0049297 Ga0495613_0049297_1763_3091 438
6 3300053085 Ga0495619_0038598 Ga0495619_0038598_18_1346 438
7 3300046539 Ga0495621_0032544 Ga0495621_0032544_20_1366 439
8 3300037312 Ga0395899_0154199 Ga0395899_0154199_235_1608 449
9 3300049742 Ga0501080_0000303 Ga0501080_0000303_35395_36933 451
10 3300049571 Ga0501034_0023355 Ga0501034_0023355_3163_4734 461
11 3300049581 Ga0501047_0055441 Ga0501047_0055441_2228_3799 461
12 3300048904 Ga0496101_0143863 Ga0496101_0143863_80_1498 465
13 3300049571 Ga0501034_0016259 Ga0501034_0016259_4452_5996 466
14 3300049581 Ga0501047_0066158 Ga0501047_0066158_941_2485 466
15 3300049589 Ga0501073_0006686 Ga0501073_0006686_358_1902 466
16 3300049583 Ga0501067_0001455 Ga0501067_0001455_7885_9429 473
17 3300049586 Ga0501070_0048415 Ga0501070_0048415_812_2356 473
18 3300013104 Ga0157370_10040931 Ga0157370_100409312 475
19 3300025899 Ga0207642_10041701 Ga0207642_100417012 475
20 3300031250 Ga0265331_10047800 Ga0265331_100478002 477
21 3300031251 Ga0265327_10024921 Ga0265327_100249212 479
22 3300025915 Ga0207693_10145396 Ga0207693_101453962 480
23 3300006844 Ga0075428_100008857 Ga0075428_1000088572 481
24 3300006880 Ga0075429_100213183 Ga0075429_1002131832 481
25 3300009094 Ga0111539_10000660 Ga0111539_1000066027 481
26 3300050511 nmdc:mga08y16_1100_c1 nmdc:mga08y16_1100_c1_14090_15565 481
27 3300035207 Ga0373942_0005755 Ga0373942_0005755_212_1747 483
28 3300005337 Ga0070682_100050808 Ga0070682_1000508082 484
29 3300005458 Ga0070681_10011101 Ga0070681_100111013 484
30 3300005530 Ga0070679_100056655 Ga0070679_1000566553 484
31 3300005539 Ga0068853_100026709 Ga0068853_1000267092 484
32 3300013104 Ga0157370_10038414 Ga0157370_100384144 484
33 3300025912 Ga0207707_10005908 Ga0207707_100059084 484
34 3300025921 Ga0207652_10049041 Ga0207652_100490412 484
35 3300026041 Ga0207639_10009484 Ga0207639_100094843 484
36 3300028379 Ga0268266_10133560 Ga0268266_101335602 485
37 3300026035 Ga0207703_10160225 Ga0207703_101602252 486
38 3300049742 Ga0501080_0008076 Ga0501080_0008076_6653_8197 487
39 3300049581 Ga0501047_0014855 Ga0501047_0014855_5206_6774 488
40 3300049742 Ga0501080_0014737 Ga0501080_0014737_5373_6941 488
41 3300054114 Ga0501084_0033155 Ga0501084_0033155_319_1887 488
42 3300060353 Ga0501082_0018136 Ga0501082_0018136_762_2330 488
43 3300013104 Ga0157370_10024505 Ga0157370_100245054 489
44 3300049742 Ga0501080_0006561 Ga0501080_0006561_205_1683 489
45 3300007265 Ga0099794_10008049 Ga0099794_100080494 490
46 3300005617 Ga0068859_100123655 Ga0068859_1001236552 491
47 3300005617 Ga0068859_100145782 Ga0068859_1001457823 491
48 3300006931 Ga0097620_100123657 Ga0097620_1001236572 491
49 3300006931 Ga0097620_100145783 Ga0097620_1001457832 491
50 3300009094 Ga0111539_10295517 Ga0111539_102955172 491
51 3300005617 Ga0068859_100139587 Ga0068859_1001395872 493
52 3300005843 Ga0068860_100025801 Ga0068860_1000258012 493
53 3300006931 Ga0097620_100139585 Ga0097620_1001395852 493
54 3300026035 Ga0207703_10106838 Ga0207703_101068381 493
55 3300028381 Ga0268264_10010585 Ga0268264_100105855 493
56 3300006914 Ga0075436_100073977 Ga0075436_1000739772 494
57 3300044656 Ga0466969_0001856 Ga0466969_0001856_4108_5595 494
58 3300044684 Ga0466966_0026667 Ga0466966_0026667_743_2230 494
59 3300005364 Ga0070673_100009579 Ga0070673_1000095795 495
60 3300005841 Ga0068863_100129680 Ga0068863_1001296802 495
61 3300005842 Ga0068858_100045158 Ga0068858_1000451584 495
62 3300006237 Ga0097621_100005133 Ga0097621_1000051335 495
63 3300009177 Ga0105248_10030595 Ga0105248_100305954 495
64 3300014325 Ga0163163_10170907 Ga0163163_101709071 495
65 3300014969 Ga0157376_10100746 Ga0157376_101007462 495
66 3300025942 Ga0207689_10009430 Ga0207689_100094304 495
67 3300025960 Ga0207651_10010241 Ga0207651_100102413 495
68 3300026023 Ga0207677_10007429 Ga0207677_100074294 495
69 3300026118 Ga0207675_100018784 Ga0207675_1000187845 495
70 3300028381 Ga0268264_10162159 Ga0268264_101621591 495
71 3300044712 Ga0453684_0000348 Ga0453684_0000348_150954_152525 495
72 3300045051 Ga0451576_0013583 Ga0451576_0013583_542_2113 495
73 3300037418 Ga0395900_0029810 Ga0395900_0029810_1075_2592 496
74 3300037466 Ga0395898_0007662 Ga0395898_0007662_9258_10775 496
75 3300005330 Ga0070690_100135595 Ga0070690_1001355951 497
76 3300005841 Ga0068863_100147250 Ga0068863_1001472502 497
77 3300013306 Ga0163162_10026266 Ga0163162_100262662 497
78 3300013308 Ga0157375_10001786 Ga0157375_1000178615 497
79 3300025940 Ga0207691_10110977 Ga0207691_101109772 497
80 3300005441 Ga0070700_100057096 Ga0070700_1000570962 498
81 3300026075 Ga0207708_10050156 Ga0207708_100501562 498
82 3300026089 Ga0207648_10129043 Ga0207648_101290432 498
83 3300035086 Ga0373934_0000137 Ga0373934_0000137_21499_23037 498
84 3300035119 Ga0373956_0000018 Ga0373956_0000018_18400_19938 498
85 3300035120 Ga0373957_0001455 Ga0373957_0001455_2520_4058 498
86 3300035172 Ga0373955_0004003 Ga0373955_0004003_527_2065 498
87 3300035724 Ga0373933_0000035 Ga0373933_0000035_20245_21783 498
88 3300036401 Ga0373937_0001322 Ga0373937_0001322_18631_20169 498
89 3300046462 Ga0495651_0000350 Ga0495651_0000350_28127_29665 498
90 3300046675 Ga0495657_0074001 Ga0495657_0074001_46_1584 498
91 3300005336 Ga0070680_100024696 Ga0070680_1000246962 499
92 3300005339 Ga0070660_100008415 Ga0070660_1000084153 499
93 3300005344 Ga0070661_100031817 Ga0070661_1000318172 499
94 3300005347 Ga0070668_100013956 Ga0070668_1000139563 499
95 3300005365 Ga0070688_100052238 Ga0070688_1000522382 499
96 3300005366 Ga0070659_100055236 Ga0070659_1000552362 499
97 3300005435 Ga0070714_100053197 Ga0070714_1000531972 499
98 3300005458 Ga0070681_10001793 Ga0070681_100017936 499
99 3300005530 Ga0070679_100004207 Ga0070679_1000042077 499
100 3300005564 Ga0070664_100081187 Ga0070664_1000811872 499
101 3300005614 Ga0068856_100003893 Ga0068856_1000038939 499
102 3300005614 Ga0068856_100025087 Ga0068856_1000250876 499
103 3300006846 Ga0075430_100025118 Ga0075430_1000251184 499
104 3300006847 Ga0075431_100010025 Ga0075431_1000100257 499
105 3300006880 Ga0075429_100076364 Ga0075429_1000763642 499
106 3300007265 Ga0099794_10070733 Ga0099794_100707331 499
107 3300013104 Ga0157370_10165937 Ga0157370_101659372 499
108 3300013307 Ga0157372_10098386 Ga0157372_100983864 499
109 3300025901 Ga0207688_10071292 Ga0207688_100712922 499
110 3300025912 Ga0207707_10005840 Ga0207707_100058404 499
111 3300025917 Ga0207660_10071076 Ga0207660_100710762 499
112 3300025919 Ga0207657_10005143 Ga0207657_100051433 499
113 3300025920 Ga0207649_10016067 Ga0207649_100160673 499
114 3300025921 Ga0207652_10008490 Ga0207652_100084909 499
115 3300025929 Ga0207664_10040452 Ga0207664_100404522 499
116 3300025945 Ga0207679_10022730 Ga0207679_100227302 499
117 3300026078 Ga0207702_10005806 Ga0207702_100058066 499
118 3300027462 Ga0210000_1000386 Ga0210000_10003862 499
119 3300027471 Ga0209995_1001392 Ga0209995_10013923 499
120 3300031911 Ga0307412_10005459 Ga0307412_100054597 499
121 3300035695 Ga0373927_0017543 Ga0373927_0017543_1522_3063 499
122 3300044694 Ga0466963_0088749 Ga0466963_0088749_514_2067 499
123 3300046454 Ga0495592_0000673 Ga0495592_0000673_4744_6285 499
124 3300046516 Ga0495628_0001118 Ga0495628_0001118_15904_17445 499
125 3300046529 Ga0495652_0000469 Ga0495652_0000469_12374_13915 499
126 3300046543 Ga0495645_0000044 Ga0495645_0000044_32607_34148 499
127 3300046678 Ga0495599_0000684 Ga0495599_0000684_10016_11557 499
128 3300048905 Ga0496102_0088656 Ga0496102_0088656_976_2505 499
129 3300050508 nmdc:mga09592_18083_c1 nmdc:mga09592_18083_c1_1423_2964 499
130 3300050509 nmdc:mga0qj67_35234_c1 nmdc:mga0qj67_35234_c1_1412_2953 499
131 3300050510 nmdc:mga06r32_43413_c1 nmdc:mga06r32_43413_c1_904_2445 499
132 3300005331 Ga0070670_100001928 Ga0070670_1000019286 500
133 3300005331 Ga0070670_100065753 Ga0070670_1000657532 500
134 3300005331 Ga0070670_100142902 Ga0070670_1001429022 500
135 3300005335 Ga0070666_10009317 Ga0070666_100093175 500
136 3300005335 Ga0070666_10031572 Ga0070666_100315722 500
137 3300005339 Ga0070660_100000799 Ga0070660_1000007993 500
138 3300005340 Ga0070689_100021096 Ga0070689_1000210962 500
139 3300005340 Ga0070689_100123009 Ga0070689_1001230091 500
140 3300005344 Ga0070661_100024877 Ga0070661_1000248774 500
141 3300005347 Ga0070668_100100451 Ga0070668_1001004512 500
142 3300005353 Ga0070669_100022933 Ga0070669_1000229331 500
143 3300005354 Ga0070675_100008107 Ga0070675_1000081076 500
144 3300005354 Ga0070675_100012249 Ga0070675_1000122492 500
145 3300005355 Ga0070671_100007612 Ga0070671_1000076122 500
146 3300005355 Ga0070671_100030387 Ga0070671_1000303872 500
147 3300005355 Ga0070671_100154813 Ga0070671_1001548131 500
148 3300005356 Ga0070674_100066444 Ga0070674_1000664442 500
149 3300005364 Ga0070673_100018365 Ga0070673_1000183654 500
150 3300005365 Ga0070688_100003522 Ga0070688_1000035226 500
151 3300005366 Ga0070659_100004899 Ga0070659_1000048992 500
152 3300005367 Ga0070667_100123875 Ga0070667_1001238752 500
153 3300005436 Ga0070713_100000230 Ga0070713_10000023027 500
154 3300005440 Ga0070705_100069841 Ga0070705_1000698412 500
155 3300005444 Ga0070694_100014369 Ga0070694_1000143692 500
156 3300005455 Ga0070663_100003808 Ga0070663_1000038084 500
157 3300005456 Ga0070678_100004548 Ga0070678_1000045482 500
158 3300005456 Ga0070678_100042498 Ga0070678_1000424982 500
159 3300005456 Ga0070678_100068626 Ga0070678_1000686262 500
160 3300005457 Ga0070662_100000104 Ga0070662_10000010421 500
161 3300005457 Ga0070662_100026150 Ga0070662_1000261503 500
162 3300005459 Ga0068867_100020703 Ga0068867_1000207034 500
163 3300005459 Ga0068867_100023401 Ga0068867_1000234012 500
164 3300005466 Ga0070685_10001069 Ga0070685_100010696 500
165 3300005467 Ga0070706_100124704 Ga0070706_1001247041 500
166 3300005471 Ga0070698_100003359 Ga0070698_10000335914 500
167 3300005536 Ga0070697_100017678 Ga0070697_1000176784 500
168 3300005543 Ga0070672_100015872 Ga0070672_1000158721 500
169 3300005543 Ga0070672_100029187 Ga0070672_1000291874 500
170 3300005548 Ga0070665_100039670 Ga0070665_1000396704 500
171 3300005548 Ga0070665_100070638 Ga0070665_1000706382 500
172 3300005563 Ga0068855_100003706 Ga0068855_1000037069 500
173 3300005564 Ga0070664_100001127 Ga0070664_1000011279 500
174 3300005564 Ga0070664_100109152 Ga0070664_1001091522 500
175 3300005578 Ga0068854_100011338 Ga0068854_1000113384 500
176 3300005614 Ga0068856_100001177 Ga0068856_1000011774 500
177 3300005614 Ga0068856_100045188 Ga0068856_1000451884 500
178 3300005615 Ga0070702_100004689 Ga0070702_1000046895 500
179 3300005616 Ga0068852_100057536 Ga0068852_1000575362 500
180 3300005618 Ga0068864_100008410 Ga0068864_1000084103 500
181 3300005718 Ga0068866_10038088 Ga0068866_100380882 500
182 3300005719 Ga0068861_100075639 Ga0068861_1000756392 500
183 3300005834 Ga0068851_10015007 Ga0068851_100150072 500
184 3300005834 Ga0068851_10066699 Ga0068851_100666992 500
185 3300005841 Ga0068863_100087137 Ga0068863_1000871372 500
186 3300005842 Ga0068858_100014286 Ga0068858_1000142866 500
187 3300005844 Ga0068862_100105027 Ga0068862_1001050272 500
188 3300006358 Ga0068871_100051425 Ga0068871_1000514252 500
189 3300006844 Ga0075428_100038094 Ga0075428_1000380942 500
190 3300006880 Ga0075429_100000019 Ga0075429_10000001943 500
191 3300009093 Ga0105240_10059274 Ga0105240_100592743 500
192 3300009147 Ga0114129_10007801 Ga0114129_100078015 500
193 3300009148 Ga0105243_10229991 Ga0105243_102299911 500
194 3300009176 Ga0105242_10042706 Ga0105242_100427063 500
195 3300009176 Ga0105242_10074120 Ga0105242_100741202 500
196 3300009177 Ga0105248_10023081 Ga0105248_100230812 500
197 3300009177 Ga0105248_10129275 Ga0105248_101292752 500
198 3300009545 Ga0105237_10049044 Ga0105237_100490442 500
199 3300013100 Ga0157373_10000587 Ga0157373_100005876 500
200 3300013102 Ga0157371_10000292 Ga0157371_1000029214 500
201 3300013104 Ga0157370_10004642 Ga0157370_100046426 500
202 3300013296 Ga0157374_10008142 Ga0157374_100081425 500
203 3300013296 Ga0157374_10245856 Ga0157374_102458562 500
204 3300013306 Ga0163162_10151259 Ga0163162_101512592 500
205 3300013307 Ga0157372_10002571 Ga0157372_100025714 500
206 3300013307 Ga0157372_10333090 Ga0157372_103330901 500
207 3300013308 Ga0157375_10033235 Ga0157375_100332352 500
208 3300013308 Ga0157375_10042247 Ga0157375_100422474 500
209 3300013308 Ga0157375_10042813 Ga0157375_100428133 500
210 3300013308 Ga0157375_10095422 Ga0157375_100954222 500
211 3300014325 Ga0163163_10035804 Ga0163163_100358043 500
212 3300014325 Ga0163163_10070037 Ga0163163_100700372 500
213 3300014326 Ga0157380_10135331 Ga0157380_101353312 500
214 3300014745 Ga0157377_10003464 Ga0157377_100034643 500
215 3300014968 Ga0157379_10007469 Ga0157379_100074692 500
216 3300014969 Ga0157376_10024121 Ga0157376_100241212 500
217 3300014969 Ga0157376_10093419 Ga0157376_100934192 500
218 3300014969 Ga0157376_10235547 Ga0157376_102355471 500
219 3300017792 Ga0163161_10019775 Ga0163161_100197752 500
220 3300017792 Ga0163161_10026156 Ga0163161_100261562 500
221 3300017792 Ga0163161_10118677 Ga0163161_101186772 500
222 3300025315 Ga0207697_10000065 Ga0207697_1000006517 500
223 3300025893 Ga0207682_10011818 Ga0207682_100118182 500
224 3300025899 Ga0207642_10031638 Ga0207642_100316382 500
225 3300025901 Ga0207688_10011496 Ga0207688_100114963 500
226 3300025903 Ga0207680_10039241 Ga0207680_100392412 500
227 3300025908 Ga0207643_10001550 Ga0207643_100015509 500
228 3300025908 Ga0207643_10055431 Ga0207643_100554312 500
229 3300025910 Ga0207684_10037182 Ga0207684_100371824 500
230 3300025910 Ga0207684_10147085 Ga0207684_101470852 500
231 3300025913 Ga0207695_10048889 Ga0207695_100488892 500
232 3300025920 Ga0207649_10041344 Ga0207649_100413442 500
233 3300025920 Ga0207649_10054083 Ga0207649_100540833 500
234 3300025923 Ga0207681_10012058 Ga0207681_100120585 500
235 3300025923 Ga0207681_10059622 Ga0207681_100596222 500
236 3300025925 Ga0207650_10001922 Ga0207650_100019226 500
237 3300025926 Ga0207659_10002953 Ga0207659_100029533 500
238 3300025926 Ga0207659_10007377 Ga0207659_100073772 500
239 3300025928 Ga0207700_10000697 Ga0207700_100006974 500
240 3300025931 Ga0207644_10000873 Ga0207644_1000087315 500
241 3300025931 Ga0207644_10003451 Ga0207644_100034515 500
242 3300025931 Ga0207644_10020989 Ga0207644_100209892 500
243 3300025931 Ga0207644_10041111 Ga0207644_100411112 500
244 3300025931 Ga0207644_10074937 Ga0207644_100749372 500
245 3300025932 Ga0207690_10000545 Ga0207690_100005452 500
246 3300025933 Ga0207706_10000040 Ga0207706_1000004072 500
247 3300025933 Ga0207706_10018911 Ga0207706_100189113 500
248 3300025933 Ga0207706_10036791 Ga0207706_100367912 500
249 3300025934 Ga0207686_10070035 Ga0207686_100700352 500
250 3300025937 Ga0207669_10029179 Ga0207669_100291792 500
251 3300025940 Ga0207691_10003580 Ga0207691_100035805 500
252 3300025940 Ga0207691_10005828 Ga0207691_100058281 500
253 3300025940 Ga0207691_10039422 Ga0207691_100394222 500
254 3300025945 Ga0207679_10001055 Ga0207679_100010553 500
255 3300025945 Ga0207679_10006267 Ga0207679_100062676 500
256 3300025945 Ga0207679_10084599 Ga0207679_100845992 500
257 3300025945 Ga0207679_10102200 Ga0207679_101022002 500
258 3300025960 Ga0207651_10003012 Ga0207651_100030123 500
259 3300025972 Ga0207668_10005437 Ga0207668_100054375 500
260 3300025972 Ga0207668_10025565 Ga0207668_100255652 500
261 3300025972 Ga0207668_10097833 Ga0207668_100978332 500
262 3300025986 Ga0207658_10096573 Ga0207658_100965732 500
263 3300026023 Ga0207677_10009605 Ga0207677_100096055 500
264 3300026067 Ga0207678_10012329 Ga0207678_100123293 500
265 3300026078 Ga0207702_10007390 Ga0207702_100073902 500
266 3300026088 Ga0207641_10092987 Ga0207641_100929872 500
267 3300026089 Ga0207648_10013019 Ga0207648_100130197 500
268 3300026089 Ga0207648_10019355 Ga0207648_100193555 500
269 3300026089 Ga0207648_10070382 Ga0207648_100703821 500
270 3300026116 Ga0207674_10007268 Ga0207674_100072689 500
271 3300026118 Ga0207675_100002063 Ga0207675_1000020633 500
272 3300026121 Ga0207683_10001488 Ga0207683_100014889 500
273 3300026121 Ga0207683_10006415 Ga0207683_100064152 500
274 3300026121 Ga0207683_10088708 Ga0207683_100887082 500
275 3300026142 Ga0207698_10110723 Ga0207698_101107231 500
276 3300027876 Ga0209974_10006134 Ga0209974_100061344 500
277 3300028380 Ga0268265_10137132 Ga0268265_101371322 500
278 3300031852 Ga0307410_10000805 Ga0307410_100008056 500
279 3300031901 Ga0307406_10002957 Ga0307406_100029574 500
280 3300031903 Ga0307407_10009249 Ga0307407_100092494 500
281 3300032005 Ga0307411_10012356 Ga0307411_100123563 500
282 3300032126 Ga0307415_100003848 Ga0307415_1000038485 500
283 3300035083 Ga0373926_0023997 Ga0373926_0023997_61_1605 500
284 3300035086 Ga0373934_0009643 Ga0373934_0009643_1488_3032 500
285 3300035111 Ga0373923_0012158 Ga0373923_0012158_70_1614 500
286 3300035113 Ga0373936_0014235 Ga0373936_0014235_984_2528 500
287 3300035117 Ga0373953_0001139 Ga0373953_0001139_2361_3905 500
288 3300035172 Ga0373955_0013953 Ga0373955_0013953_12_1556 500
289 3300035410 Ga0373924_0002265 Ga0373924_0002265_567_2111 500
290 3300035692 Ga0373935_0027504 Ga0373935_0027504_1175_2719 500
291 3300035724 Ga0373933_0048677 Ga0373933_0048677_883_2427 500
292 3300036401 Ga0373937_0077321 Ga0373937_0077321_767_2323 500
293 3300037068 Ga0373925_0009800 Ga0373925_0009800_1184_2728 500
294 3300037068 Ga0373925_0067280 Ga0373925_0067280_50_1594 500
295 3300037466 Ga0395898_0015889 Ga0395898_0015889_2944_4500 500
296 3300037471 Ga0395905_0113645 Ga0395905_0113645_865_2421 500
297 3300038443 Ga0395901_0023249 Ga0395901_0023249_1632_3188 500
298 3300044694 Ga0466963_0084819 Ga0466963_0084819_48_1604 500
299 3300045051 Ga0451576_0050877 Ga0451576_0050877_493_2049 500
300 3300045976 Ga0466967_0194804 Ga0466967_0194804_121_1677 500
301 3300046463 Ga0495653_0007068 Ga0495653_0007068_6690_8234 500
302 3300046472 Ga0495580_0009699 Ga0495580_0009699_4369_5913 500
303 3300046475 Ga0495639_0001641 Ga0495639_0001641_2007_3551 500
304 3300046476 Ga0495662_0026079 Ga0495662_0026079_52_1596 500
305 3300046477 Ga0495664_0000685 Ga0495664_0000685_9610_11154 500
306 3300046511 Ga0495608_0006821 Ga0495608_0006821_1182_2726 500
307 3300046514 Ga0495618_0014062 Ga0495618_0014062_588_2132 500
308 3300046516 Ga0495628_0002610 Ga0495628_0002610_1359_2903 500
309 3300046516 Ga0495628_0043143 Ga0495628_0043143_1182_2726 500
310 3300046517 Ga0495630_0010229 Ga0495630_0010229_1529_3073 500
311 3300046526 Ga0495666_0017428 Ga0495666_0017428_823_2367 500
312 3300046533 Ga0495640_0048220 Ga0495640_0048220_1175_2719 500
313 3300046535 Ga0495586_0013448 Ga0495586_0013448_1140_2684 500
314 3300046642 Ga0495634_0006920 Ga0495634_0006920_5371_6915 500
315 3300046663 Ga0495635_0036201 Ga0495635_0036201_1816_3360 500
316 3300046681 Ga0495647_0001672 Ga0495647_0001672_2482_4026 500
317 3300046683 Ga0495658_0007709 Ga0495658_0007709_1783_3327 500
318 3300046809 Ga0495600_0012641 Ga0495600_0012641_1047_2591 500
319 3300047319 Ga0495674_0008528 Ga0495674_0008528_5573_7117 500
320 3300047444 Ga0495675_0019343 Ga0495675_0019343_985_2529 500
321 3300047471 Ga0495684_0031212 Ga0495684_0031212_985_2529 500
322 3300048905 Ga0496102_0001647 Ga0496102_0001647_17269_18825 500
323 3300048908 Ga0496105_0006960 Ga0496105_0006960_5682_7238 500
324 3300048909 Ga0496106_0058103 Ga0496106_0058103_1333_2889 500
325 3300048912 Ga0496109_0002930 Ga0496109_0002930_7833_9389 500
326 3300049744 Ga0501083_0065829 Ga0501083_0065829_153_1697 500
327 3300050507 nmdc:mga05p37_67_c1 nmdc:mga05p37_67_c1_85026_86582 500
328 3300050508 nmdc:mga09592_45_c1 nmdc:mga09592_45_c1_36480_38036 500
329 3300053077 Ga0495601_0003295 Ga0495601_0003295_972_2516 500
330 3300053084 Ga0495595_0008394 Ga0495595_0008394_1521_3065 500
331 3300005295 Ga0065707_10000604 Ga0065707_1000060417 501
332 3300005339 Ga0070660_100001577 Ga0070660_1000015779 501
333 3300005343 Ga0070687_100014277 Ga0070687_1000142772 501
334 3300005366 Ga0070659_100000861 Ga0070659_1000008619 501
335 3300005458 Ga0070681_10021299 Ga0070681_100212993 501
336 3300005539 Ga0068853_100016867 Ga0068853_1000168673 501
337 3300005577 Ga0068857_100026787 Ga0068857_1000267873 501
338 3300006237 Ga0097621_100192147 Ga0097621_1001921472 501
339 3300006844 Ga0075428_100000165 Ga0075428_1000001652 501
340 3300006847 Ga0075431_100013529 Ga0075431_1000135294 501
341 3300006880 Ga0075429_100026718 Ga0075429_1000267183 501
342 3300007265 Ga0099794_10024107 Ga0099794_100241071 501
343 3300009094 Ga0111539_10005116 Ga0111539_100051165 501
344 3300009098 Ga0105245_10149910 Ga0105245_101499101 501
345 3300009147 Ga0114129_10335383 Ga0114129_103353832 501
346 3300009545 Ga0105237_10107241 Ga0105237_101072412 501
347 3300010159 Ga0099796_10004836 Ga0099796_100048362 501
348 3300010375 Ga0105239_10038319 Ga0105239_100383192 501
349 3300013296 Ga0157374_10000145 Ga0157374_1000014534 501
350 3300013306 Ga0163162_10112069 Ga0163162_101120693 501
351 3300013308 Ga0157375_10213789 Ga0157375_102137892 501
352 3300025905 Ga0207685_10026736 Ga0207685_100267362 501
353 3300025912 Ga0207707_10037659 Ga0207707_100376595 501
354 3300025914 Ga0207671_10027246 Ga0207671_100272462 501
355 3300025919 Ga0207657_10001557 Ga0207657_1000155717 501
356 3300025936 Ga0207670_10061872 Ga0207670_100618723 501
357 3300025936 Ga0207670_10102362 Ga0207670_101023622 501
358 3300025942 Ga0207689_10033045 Ga0207689_100330453 501
359 3300026023 Ga0207677_10047467 Ga0207677_100474673 501
360 3300026035 Ga0207703_10022926 Ga0207703_100229265 501
361 3300026041 Ga0207639_10004783 Ga0207639_100047833 501
362 3300027671 Ga0209588_1001503 Ga0209588_10015034 501
363 3300027907 Ga0207428_10004725 Ga0207428_1000472510 501
364 3300028666 Ga0265336_10000151 Ga0265336_1000015126 501
365 3300028794 Ga0307515_10000043 Ga0307515_10000043237 501
366 3300029957 Ga0265324_10000001 Ga0265324_10000001117 501
367 3300031239 Ga0265328_10000050 Ga0265328_100000508 501
368 3300031241 Ga0265325_10000046 Ga0265325_1000004620 501
369 3300031251 Ga0265327_10010823 Ga0265327_100108234 501
370 3300031344 Ga0265316_10057451 Ga0265316_100574512 501
371 3300031711 Ga0265314_10036493 Ga0265314_100364932 501
372 3300035172 Ga0373955_0006996 Ga0373955_0006996_1511_3061 501
373 3300036401 Ga0373937_0023151 Ga0373937_0023151_72_1622 501
374 3300042435 Ga0439434_0000292 Ga0439434_0000292_1553_3106 501
375 3300042876 Ga0451577_0000013 Ga0451577_0000013_113309_114859 501
376 3300044673 Ga0453683_0000113 Ga0453683_0000113_6432_7982 501
377 3300044712 Ga0453684_0000085 Ga0453684_0000085_282959_284509 501
378 3300045051 Ga0451576_0000018 Ga0451576_0000018_435831_437381 501
379 3300046472 Ga0495580_0008595 Ga0495580_0008595_5774_7321 501
380 3300046499 Ga0495594_0034275 Ga0495594_0034275_1048_2595 501
381 3300046526 Ga0495666_0002906 Ga0495666_0002906_2811_4358 501
382 3300046543 Ga0495645_0001756 Ga0495645_0001756_10679_12229 501
383 3300046663 Ga0495635_0031188 Ga0495635_0031188_1147_2697 501
384 3300046679 Ga0495623_0094289 Ga0495623_0094289_46_1596 501
385 3300048905 Ga0496102_0180461 Ga0496102_0180461_87_1634 501
386 3300049572 Ga0501036_0085296 Ga0501036_0085296_783_2420 501
387 3300049575 Ga0501039_0010297 Ga0501039_0010297_4484_6121 501
388 3300049576 Ga0501040_0108416 Ga0501040_0108416_19_1656 501
389 3300049577 Ga0501041_0002039 Ga0501041_0002039_5222_6859 501
390 3300049581 Ga0501047_0004510 Ga0501047_0004510_5695_7236 501
391 3300049592 Ga0501076_0004088 Ga0501076_0004088_5556_7193 501
392 3300049741 Ga0501079_0019118 Ga0501079_0019118_1033_2670 501
393 3300049741 Ga0501079_0147636 Ga0501079_0147636_178_1719 501
394 3300049742 Ga0501080_0004563 Ga0501080_0004563_8727_10364 501
395 3300049743 Ga0501081_0003238 Ga0501081_0003238_7978_9615 501
396 3300049822 Ga0501035_0065494 Ga0501035_0065494_944_2581 501
397 3300049823 Ga0501044_0011796 Ga0501044_0011796_6639_8180 501
398 3300050511 nmdc:mga08y16_6448_c1 nmdc:mga08y16_6448_c1_9463_11103 501
399 3300050515 nmdc:mga0a205_75073_c1 nmdc:mga0a205_75073_c1_430_1977 501
400 3300060353 Ga0501082_0029722 Ga0501082_0029722_1547_3184 501
401 3300005458 Ga0070681_10106770 Ga0070681_101067702 502
402 3300025294 Ga0209025_1000115 Ga0209025_1000115188 502
403 3300025303 Ga0209051_1001595 Ga0209051_100159515 502
404 3300029957 Ga0265324_10001765 Ga0265324_100017655 502
405 3300029957 Ga0265324_10027562 Ga0265324_100275622 502
406 3300031241 Ga0265325_10027370 Ga0265325_100273703 502
407 3300031616 Ga0307508_10001454 Ga0307508_100014542 502
408 3300031711 Ga0265314_10001889 Ga0265314_100018895 502
409 3300037068 Ga0373925_0008462 Ga0373925_0008462_1991_3541 502
410 3300042876 Ga0451577_0004435 Ga0451577_0004435_472_2052 502
411 3300044673 Ga0453683_0006373 Ga0453683_0006373_1248_2798 502
412 3300044673 Ga0453683_0032192 Ga0453683_0032192_480_2051 502
413 3300045051 Ga0451576_0012318 Ga0451576_0012318_2927_4498 502
414 3300046460 Ga0495638_0010227 Ga0495638_0010227_40_1590 502
415 3300046513 Ga0495616_0008295 Ga0495616_0008295_79_1629 502
416 3300046535 Ga0495586_0037554 Ga0495586_0037554_707_2257 502
417 3300048915 Ga0496112_0001941 Ga0496112_0001941_881_2431 502
418 3300053079 Ga0500610_0000061 Ga0500610_0000061_27891_29441 502
419 3300053122 Ga0500608_000226 Ga0500608_000226_16489_18039 502
420 3300053141 Ga0500574_001470 Ga0500574_001470_1322_2872 502
421 3300005518 Ga0070699_100025181 Ga0070699_1000251815 503
422 3300006914 Ga0075436_100000090 Ga0075436_10000009044 503
423 3300028786 Ga0307517_10000024 Ga0307517_1000002458 503
424 3300050514 nmdc:mga08x19_81_c1 nmdc:mga08x19_81_c1_85215_86765 503
425 3300005290 Ga0065712_10068735 Ga0065712_100687354 519
426 3300005344 Ga0070661_100003820 Ga0070661_1000038205 519
427 3300006844 Ga0075428_100012410 Ga0075428_1000124102 519
428 3300009147 Ga0114129_10011889 Ga0114129_100118894 519
429 3300031730 Ga0307516_10000093 Ga0307516_1000009319 519

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00346

Complex1_49kDa

Respiratory-chain NADH dehydrogenase, 49 Kd subunit

305

548

0.93

PF00329

Complex1_30kDa

Respiratory-chain NADH dehydrogenase, 30 Kd subunit

23

174

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zjl-assembly1.cif.gz_4 respiratory complex i from thermus thermophilus, nad+ dataset, major state 0.9436 195 514
6zkr-assembly1.cif.gz_4 native complex i, open3 0.9313 202 514
6x89-assembly1.cif.gz_S2 vigna radiata mitochondrial complex i* 0.9308 195 514
8bq6-assembly1.cif.gz_D cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (complete conformation 2 composition) 0.9303 195 514
6tjv-assembly1.cif.gz_H structure of the ndh-1ms complex from thermosynechococcus elongatus 0.9296 198 514
ID Description Score Start End Superfamily
af_P16431_180_537_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9584 198 519 1.10.645.10
af_Q57935_5_362_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9393 198 514 1.10.645.10
af_P33599_211_596_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9275 198 514 1.10.645.10
af_P9WJH5_38_440_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9223 198 514 1.10.645.10
af_Q23883_16_406_1.10.645.10 Mainly Alpha;Orthogonal Bundle;Cytochrome-c3 Hydrogenase; chain B;Cytochrome-c3 Hydrogenase, chain B 0.9179 195 514 1.10.645.10
ID Description Score Start End GO Terms
AF-T1B8V6-F1-model_v4 NADH dehydrogenase (Ubiquinone) 30 kDa subunit 0.9801 284 449 GO:0016651
GO:0048038
GO:0051287
AF-A0A6N9R9H2-F1-model_v4 Ni,Fe-hydrogenase III large subunit 0.9781 219 519 GO:0016651
GO:0048038
GO:0051287
AF-A0A6N9R9H2-F1-model_v4 Ni,Fe-hydrogenase III large subunit 0.9749 219 519 GO:0016651
GO:0048038
GO:0051287
AF-A0A662HYW0-F1-model_v4 Hydrogenase large subunit 0.9693 233 514 GO:0016020
GO:0016651
GO:0048038
GO:0051287
AF-A0A3D0LSC3-F1-model_v4 NADH-quinone oxidoreductase subunit D 0.9683 198 514 GO:0016151
GO:0016651
GO:0048038
GO:0051287

Feature Viewer

pLDDT pTM Quality
84.02 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map