F441875

General Info

Members Datasets Scaffolds Average Seq Length
429 242 858 370

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10025829|Ga0081455_100258295
Length 423
Sequence VILAVAAVPVKSRVLERRAGRERAAVTLDDRRGHAIESRVAGMRGRAGEMAIDERAIEPEDLEQLRAALAVRDLTDPTAGAHAIQSLVGLATDALVAAWACPTRSRPGPRIVPIADNYDNLGFTADAASRDSRYTRYVDANRMLRSHSSAMVPPALRSLAADPLDDVVLVCPGIVYRRDAIDRLHTGTPHQLDLWRVSRRPVTNADMDEMITLLVDALAPGRRWRAEPRIHPYTVDGRQVDVQDDHAWVEVWECGRAHPEVLARAGLAGWHGLALGMGLDRLLMLRKDIPDIRLLRSTDHRVAGQMLDLAPYRAVSTMPTVVRDLSVAVDAEDDVERLGDRVRDALGADADAVEEVTVLSETAYEQLPASAIARMGMHRRQKNVLLRVVLRHLERTLTDADANALRDRIYSALHAGDAHELTS

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
7 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
13 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
14 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
20 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
26 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
27 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
30 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
42 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
43 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
45 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
46 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
48 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
49 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
50 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
61 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
92 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
93 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
94 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
95 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
96 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
97 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
98 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
99 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
100 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
101 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
102 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
103 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
104 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
105 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
106 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
107 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
108 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
109 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
110 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
111 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
112 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
113 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
114 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
115 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
116 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
117 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
118 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
119 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
121 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
123 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
124 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
125 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
126 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
127 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
128 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
129 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
130 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
133 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
134 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
135 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
136 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
139 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
140 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
141 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
144 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
155 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
156 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
157 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
158 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
159 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
160 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
161 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
162 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
163 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
164 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
165 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
171 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
172 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
173 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
174 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
175 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
176 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
177 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
178 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
179 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
180 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
181 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
182 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
185 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
186 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
187 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
188 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
189 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
194 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
195 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
196 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
219 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
220 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
223 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
224 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
225 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
226 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
227 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
228 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
236 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
241 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
242 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.3
Metatranscriptomes 0.23
Isolates 0.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.99
Rhizosphere 90.91
Stem 0
Stem Tuber 0
Unclassified 3.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10025829 3300005937 Bacteria 5414
2 JGI25407J50210_10002495 3300003373 Bacteria 4340
3 JGI25407J50210_10009525 3300003373 Bacteria 2463
4 JGI25407J50210_10011876 3300003373 Bacteria 2230
5 JGI25407J50210_10013775 3300003373 Bacteria 2080
6 JGI25407J50210_10015532 3300003373 Bacteria 1967
7 Ga0070666_10156932 3300005335 Bacteria 1589
8 Ga0068868_100204527 3300005338 Bacteria 1648
9 Ga0070691_10061195 3300005341 Bacteria 1811
10 Ga0070668_100058796 3300005347 Bacteria 2975
11 Ga0070668_100098639 3300005347 Bacteria 2312
12 Ga0070667_100342091 3300005367 Bacteria 1353
13 Ga0070714_100094363 3300005435 Bacteria 2626
14 Ga0070714_100135560 3300005435 Bacteria 2204
15 Ga0070714_100198068 3300005435 Bacteria 1836
16 Ga0070714_100198530 3300005435 Bacteria 1834
17 Ga0070713_100018683 3300005436 Bacteria 5271
18 Ga0070713_100177287 3300005436 Bacteria 1913
19 Ga0070710_10061661 3300005437 Bacteria 2136
20 Ga0070710_10075873 3300005437 Bacteria 1949
21 Ga0070711_100061263 3300005439 Bacteria 2619
22 Ga0070711_100132944 3300005439 Bacteria 1855
23 Ga0070711_100212690 3300005439 Bacteria 1498
24 Ga0070708_100012829 3300005445 Bacteria 6844
25 Ga0070663_100000795 3300005455 Bacteria 17139
26 Ga0070663_100003457 3300005455 Bacteria 9104
27 Ga0070681_10037896 3300005458 Bacteria 4835
28 Ga0070706_100342253 3300005467 Bacteria 1394
29 Ga0070707_100005650 3300005468 Bacteria 11680
30 Ga0070707_100015035 3300005468 Bacteria 7262
31 Ga0070707_100027821 3300005468 Bacteria 5379
32 Ga0070698_100135157 3300005471 Bacteria 2420
33 Ga0070699_100059960 3300005518 Bacteria 3296
34 Ga0070699_100201300 3300005518 Bacteria 1771
35 Ga0070697_100000447 3300005536 Bacteria 31726
36 Ga0070686_100104301 3300005544 Bacteria 1920
37 Ga0070704_100135431 3300005549 Bacteria 1915
38 Ga0070704_100166938 3300005549 Bacteria 1746
39 Ga0068855_100180147 3300005563 Bacteria 2389
40 Ga0068855_100181572 3300005563 Bacteria 2379
41 Ga0070664_100085424 3300005564 Bacteria 2725
42 Ga0068857_100129618 3300005577 Bacteria 2274
43 Ga0068856_100065215 3300005614 Bacteria 3598
44 Ga0068859_100070795 3300005617 Bacteria 3523
45 Ga0068863_100050117 3300005841 Bacteria 3960
46 Ga0068858_100032830 3300005842 Bacteria 4821
47 Ga0068858_100067047 3300005842 Bacteria 3324
48 Ga0068862_100158022 3300005844 Bacteria 2022
49 Ga0068862_100159926 3300005844 Bacteria 2010
50 Ga0081455_10000332 3300005937 Bacteria 61974
51 Ga0081455_10037244 3300005937 Bacteria 4322
52 Ga0081538_10000655 3300005981 Bacteria 38278
53 Ga0081538_10001348 3300005981 Bacteria 25257
54 Ga0081538_10002297 3300005981 Bacteria 18890
55 Ga0081538_10002818 3300005981 Bacteria 16632
56 Ga0081538_10002914 3300005981 Bacteria 16314
57 Ga0081538_10005403 3300005981 Bacteria 11484
58 Ga0081538_10007125 3300005981 Bacteria 9714
59 Ga0081540_1007882 3300005983 Bacteria 7525
60 Ga0081539_10004997 3300005985 Bacteria 14019
61 Ga0070717_10008658 3300006028 Bacteria 7609
62 Ga0070717_10091599 3300006028 Bacteria 2567
63 Ga0070717_10150752 3300006028 Unclassified 2011
64 Ga0070715_10011859 3300006163 Bacteria 3151
65 Ga0070715_10018963 3300006163 Bacteria 2630
66 Ga0070712_100023865 3300006175 Bacteria 4044
67 Ga0070712_100042136 3300006175 Bacteria 3138
68 Ga0070712_100117348 3300006175 Bacteria 1997
69 Ga0075427_10000993 3300006194 Bacteria 3522
70 Ga0068871_100184357 3300006358 Bacteria 1795
71 Ga0075428_100010550 3300006844 Bacteria 10268
72 Ga0075428_100014437 3300006844 Bacteria 8774
73 Ga0075428_100117567 3300006844 Bacteria 2896
74 Ga0075430_100006333 3300006846 Bacteria 9986
75 Ga0075430_100037029 3300006846 Bacteria 4135
76 Ga0075431_100017600 3300006847 Bacteria 7265
77 Ga0075431_100063829 3300006847 Bacteria 3801
78 Ga0075431_100095417 3300006847 Bacteria 3070
79 Ga0075433_10040062 3300006852 Bacteria 4053
80 Ga0075429_100004099 3300006880 Bacteria 12482
81 Ga0075429_100025786 3300006880 Bacteria 5104
82 Ga0075429_100069377 3300006880 Bacteria 3069
83 Ga0075429_100186089 3300006880 Unclassified 1820
84 Ga0097620_100070787 3300006931 Bacteria 3523
85 Ga0075435_100057386 3300007076 Bacteria 3149
86 Ga0075435_100149790 3300007076 Bacteria 1961
87 Ga0075435_100157995 3300007076 Bacteria 1908
88 Ga0105251_10020886 3300009011 Bacteria 3432
89 Ga0111539_10014581 3300009094 Bacteria 9810
90 Ga0105245_10061776 3300009098 Bacteria 3378
91 Ga0105245_10082484 3300009098 Bacteria 2941
92 Ga0114129_10000906 3300009147 Bacteria 38579
93 Ga0114129_10005966 3300009147 Bacteria 17247
94 Ga0114129_10096272 3300009147 Bacteria 4098
95 Ga0114129_10178189 3300009147 Bacteria 2894
96 Ga0114129_10596494 3300009147 Bacteria 1432
97 Ga0105242_10073996 3300009176 Bacteria 2834
98 Ga0105248_10088116 3300009177 Bacteria 3493
99 Ga0105248_10110240 3300009177 Bacteria 3103
100 Ga0105239_10215569 3300010375 Bacteria 2152
101 Ga0157373_10048184 3300013100 Bacteria 3038
102 Ga0157370_10163430 3300013104 Bacteria 2071
103 Ga0157378_10264342 3300013297 Bacteria 1652
104 Ga0157375_10035582 3300013308 Bacteria 4755
105 Ga0163163_10054920 3300014325 Bacteria 3936
106 Ga0163163_10223400 3300014325 Bacteria 1932
107 Ga0157379_10004880 3300014968 Bacteria 11521
108 Ga0163161_10216228 3300017792 Bacteria 1482
109 Ga0206353_10954675 3300020082 Bacteria 3650
110 Ga0213875_10005152 3300021388 Bacteria 7071
111 Ga0213875_10026520 3300021388 Bacteria 2757
112 Ga0207653_10013175 3300025885 Bacteria 2588
113 Ga0207692_10011308 3300025898 Bacteria 3792
114 Ga0207692_10163963 3300025898 Bacteria 1283
115 Ga0207685_10004348 3300025905 Bacteria 3592
116 Ga0207699_10003284 3300025906 Bacteria 7708
117 Ga0207699_10006161 3300025906 Bacteria 5784
118 Ga0207645_10026259 3300025907 Bacteria 3764
119 Ga0207643_10040844 3300025908 Bacteria 2613
120 Ga0207684_10032135 3300025910 Bacteria 4463
121 Ga0207684_10274463 3300025910 Bacteria 1454
122 Ga0207693_10006608 3300025915 Bacteria 9583
123 Ga0207693_10043685 3300025915 Bacteria 3524
124 Ga0207693_10044295 3300025915 Bacteria 3498
125 Ga0207693_10065398 3300025915 Bacteria 2848
126 Ga0207693_10167835 3300025915 Bacteria 1728
127 Ga0207663_10012987 3300025916 Bacteria 4517
128 Ga0207663_10041295 3300025916 Bacteria 2811
129 Ga0207660_10013786 3300025917 Bacteria 5304
130 Ga0207662_10051574 3300025918 Bacteria 2447
131 Ga0207657_10003732 3300025919 Bacteria 16187
132 Ga0207649_10199481 3300025920 Bacteria 1413
133 Ga0207646_10004775 3300025922 Bacteria 14556
134 Ga0207646_10036607 3300025922 Bacteria 4429
135 Ga0207687_10050296 3300025927 Bacteria 2900
136 Ga0207700_10128503 3300025928 Bacteria 2065
137 Ga0207664_10054486 3300025929 Bacteria 3169
138 Ga0207664_10131352 3300025929 Bacteria 2108
139 Ga0207664_10155380 3300025929 Bacteria 1947
140 Ga0207706_10142277 3300025933 Bacteria 2110
141 Ga0207709_10088198 3300025935 Bacteria 2019
142 Ga0207665_10033918 3300025939 Bacteria 3386
143 Ga0207665_10055442 3300025939 Bacteria 2674
144 Ga0207689_10005905 3300025942 Bacteria 10844
145 Ga0207668_10143891 3300025972 Bacteria 1837
146 Ga0207640_10064579 3300025981 Bacteria 2438
147 Ga0207677_10060849 3300026023 Bacteria 2612
148 Ga0207703_10032142 3300026035 Bacteria 4153
149 Ga0207678_10000312 3300026067 Bacteria 43816
150 Ga0207678_10000552 3300026067 Bacteria 34170
151 Ga0207708_10060487 3300026075 Bacteria 2891
152 Ga0207674_10016630 3300026116 Bacteria 8043
153 Ga0207675_100138643 3300026118 Bacteria 2309
154 Ga0207683_10008781 3300026121 Bacteria 8627
155 Ga0207428_10001190 3300027907 Bacteria 28004
156 Ga0265326_10006155 3300028558 Bacteria 3746
157 Ga0265319_1011467 3300028563 Bacteria 3627
158 Ga0265334_10002927 3300028573 Bacteria 7824
159 Ga0265336_10018862 3300028666 Bacteria 2230
160 Ga0265338_10000449 3300028800 Bacteria 73385
161 Ga0265324_10000824 3300029957 Bacteria 20119
162 Ga0265320_10001578 3300031240 Bacteria 16367
163 Ga0265339_10025391 3300031249 Bacteria 3400
164 Ga0265316_10050720 3300031344 Bacteria 3262
165 Ga0307513_10134371 3300031456 Bacteria 2412
166 Ga0265313_10016218 3300031595 Bacteria 4293
167 Ga0265314_10059048 3300031711 Bacteria 2626
168 Ga0265342_10009088 3300031712 Bacteria 7043
169 Ga0307410_10134620 3300031852 Bacteria 1820
170 Ga0326468_10000191 3300031889 Bacteria 6245
171 Ga0307406_10009586 3300031901 Bacteria 5439
172 Ga0307406_10237634 3300031901 Bacteria 1365
173 Ga0307412_10071748 3300031911 Bacteria 2365
174 Ga0307409_100005434 3300031995 Bacteria 7334
175 Ga0307409_100119789 3300031995 Bacteria 2226
176 Ga0307416_100079744 3300032002 Bacteria 2760
177 Ga0307414_10357129 3300032004 Bacteria 1256
178 Ga0307415_100003676 3300032126 Bacteria 7847
179 Ga0307415_100020062 3300032126 Bacteria 4072
180 Ga0307415_100155265 3300032126 Bacteria 1766
181 Ga0307507_10059312 3300033179 Bacteria 3583
182 Ga0307510_10062879 3300033180 Bacteria 3787
183 Ga0373926_0005125 3300035083 Bacteria 4307
184 Ga0373926_0053273 3300035083 Unclassified 1464
185 Ga0373934_0025014 3300035086 Bacteria 2310
186 Ga0373934_0031795 3300035086 Bacteria 2067
187 Ga0373940_0003910 3300035088 Bacteria 3097
188 Ga0373940_0017369 3300035088 Bacteria 1793
189 Ga0373944_0001444 3300035089 Bacteria 5994
190 Ga0373923_0057047 3300035111 Bacteria 1650
191 Ga0373932_0014766 3300035112 Bacteria 1969
192 Ga0373936_0000200 3300035113 Bacteria 19968
193 Ga0373936_0000765 3300035113 Bacteria 11298
194 Ga0373939_0006759 3300035114 Bacteria 2770
195 Ga0373939_0007719 3300035114 Bacteria 2619
196 Ga0373945_0000988 3300035116 Bacteria 8486
197 Ga0373945_0003233 3300035116 Bacteria 5114
198 Ga0373954_0024604 3300035118 Bacteria 2746
199 Ga0373957_0015072 3300035120 Bacteria 2654
200 Ga0373957_0046790 3300035120 Bacteria 1643
201 Ga0373960_0001382 3300035121 Bacteria 5358
202 Ga0373960_0028940 3300035121 Bacteria 1532
203 Ga0373943_0000088 3300035170 Bacteria 33412
204 Ga0373943_0000633 3300035170 Bacteria 15185
205 Ga0373943_0105643 3300035170 Bacteria 1479
206 Ga0373946_0000133 3300035171 Bacteria 22295
207 Ga0373946_0000647 3300035171 Bacteria 11650
208 Ga0373955_0022542 3300035172 Bacteria 3195
209 Ga0373955_0097996 3300035172 Bacteria 1679
210 Ga0373931_0011031 3300035691 Bacteria 4356
211 Ga0373935_0006479 3300035692 Bacteria 6991
212 Ga0373927_0004754 3300035695 Bacteria 9456
213 Ga0373927_0028243 3300035695 Bacteria 3659
214 Ga0373933_0005941 3300035724 Bacteria 6640
215 Ga0373933_0020988 3300035724 Bacteria 3705
216 Ga0373933_0030203 3300035724 Bacteria 3137
217 Ga0373947_0000713 3300035725 Bacteria 19785
218 Ga0373947_0001155 3300035725 Bacteria 16200
219 Ga0373937_0003794 3300036401 Bacteria 12773
220 Ga0373937_0019739 3300036401 Bacteria 6036
221 Ga0373937_0089412 3300036401 Bacteria 2851
222 Ga0316582_0185110 3300036647 Bacteria 1418
223 Ga0373925_0008093 3300037068 Bacteria 7655
224 Ga0373925_0059693 3300037068 Bacteria 2861
225 Ga0395900_0022124 3300037418 Bacteria 6504
226 Ga0395900_0060834 3300037418 Bacteria 3885
227 Ga0395898_0035710 3300037466 Bacteria 4940
228 Ga0395898_0199396 3300037466 Unclassified 1911
229 Ga0395905_0031905 3300037471 Bacteria 4956
230 Ga0436364_0755931 3300037853 Bacteria 3133
231 Ga0436364_1511731 3300037853 Bacteria 10954
232 Ga0395901_0007519 3300038443 Bacteria 11000
233 Ga0395901_0063709 3300038443 Bacteria 3837
234 Ga0395901_0148976 3300038443 Bacteria 2459
235 Ga0439449_0032833 3300042007 Bacteria 1934
236 Ga0439450_030060 3300042008 Bacteria 1217
237 Ga0466969_0067881 3300044656 Bacteria 1719
238 Ga0466972_0001980 3300044658 Bacteria 10023
239 Ga0466959_0056220 3300045049 Bacteria 2872
240 Ga0466959_0243408 3300045049 Bacteria 1242
241 Ga0466967_0094662 3300045976 Bacteria 2720
242 Ga0495592_0161375 3300046454 Unclassified 1542
243 Ga0495592_0192420 3300046454 Bacteria 1381
244 Ga0495603_0000448 3300046455 Bacteria 22622
245 Ga0495603_0023536 3300046455 Bacteria 3725
246 Ga0495629_0005793 3300046459 Bacteria 9215
247 Ga0495641_0005821 3300046461 Bacteria 8171
248 Ga0495641_0022296 3300046461 Bacteria 3170
249 Ga0495641_0044933 3300046461 Bacteria 2035
250 Ga0495651_0004448 3300046462 Bacteria 10735
251 Ga0495651_0084507 3300046462 Bacteria 2391
252 Ga0495653_0004004 3300046463 Bacteria 11898
253 Ga0495653_0017542 3300046463 Bacteria 5820
254 Ga0495653_0024496 3300046463 Bacteria 4862
255 Ga0495653_0053203 3300046463 Bacteria 3098
256 Ga0495580_0081200 3300046472 Bacteria 2260
257 Ga0495582_0001646 3300046473 Bacteria 12594
258 Ga0495582_0028897 3300046473 Bacteria 3044
259 Ga0495582_0030659 3300046473 Bacteria 2953
260 Ga0495582_0052579 3300046473 Bacteria 2246
261 Ga0495639_0015947 3300046475 Bacteria 3258
262 Ga0495662_0003259 3300046476 Bacteria 8208
263 Ga0495662_0019090 3300046476 Bacteria 3318
264 Ga0495664_0009277 3300046477 Bacteria 5502
265 Ga0495664_0028968 3300046477 Bacteria 3236
266 Ga0495664_0044496 3300046477 Bacteria 2631
267 Ga0495608_0003609 3300046511 Bacteria 11108
268 Ga0495608_0003741 3300046511 Bacteria 10918
269 Ga0495608_0014003 3300046511 Bacteria 5564
270 Ga0495608_0055514 3300046511 Bacteria 2617
271 Ga0495618_0007734 3300046514 Bacteria 6502
272 Ga0495618_0040945 3300046514 Bacteria 2917
273 Ga0495628_0027836 3300046516 Bacteria 4594
274 Ga0495630_0018863 3300046517 Bacteria 5070
275 Ga0495630_0019303 3300046517 Bacteria 5009
276 Ga0495630_0147515 3300046517 Bacteria 1789
277 Ga0495666_0000530 3300046526 Bacteria 16999
278 Ga0495652_0014399 3300046529 Bacteria 7100
279 Ga0495652_0024813 3300046529 Bacteria 5305
280 Ga0495652_0051633 3300046529 Bacteria 3510
281 Ga0495665_0000134 3300046531 Bacteria 35684
282 Ga0495665_0024570 3300046531 Bacteria 3237
283 Ga0495665_0052804 3300046531 Bacteria 2151
284 Ga0495640_0014018 3300046533 Bacteria 6082
285 Ga0495640_0018807 3300046533 Bacteria 5112
286 Ga0495640_0049945 3300046533 Bacteria 2882
287 Ga0495586_0004116 3300046535 Bacteria 7793
288 Ga0495587_0011092 3300046536 Bacteria 5716
289 Ga0495587_0052643 3300046536 Bacteria 2401
290 Ga0495645_0011173 3300046543 Bacteria 6314
291 Ga0495645_0017145 3300046543 Bacteria 5188
292 Ga0495667_0004296 3300046559 Bacteria 9610
293 Ga0495667_0008382 3300046559 Bacteria 7011
294 Ga0495667_0015153 3300046559 Bacteria 5204
295 Ga0495667_0026827 3300046559 Bacteria 3881
296 Ga0495634_0008576 3300046642 Bacteria 7591
297 Ga0495635_0002544 3300046663 Bacteria 12480
298 Ga0495635_0016891 3300046663 Bacteria 5097
299 Ga0495635_0025211 3300046663 Bacteria 4142
300 Ga0495588_0139537 3300046674 Unclassified 1280
301 Ga0495657_0011372 3300046675 Bacteria 6658
302 Ga0495657_0015914 3300046675 Bacteria 5490
303 Ga0495657_0033034 3300046675 Bacteria 3606
304 Ga0495657_0034554 3300046675 Bacteria 3510
305 Ga0495657_0069817 3300046675 Bacteria 2297
306 Ga0495599_0023439 3300046678 Bacteria 3859
307 Ga0495599_0104875 3300046678 Bacteria 1761
308 Ga0495623_0004816 3300046679 Bacteria 8851
309 Ga0495647_0003101 3300046681 Bacteria 5307
310 Ga0495658_0000376 3300046683 Bacteria 25075
311 Ga0495613_0001261 3300046689 Bacteria 19288
312 Ga0495624_0001162 3300046690 Bacteria 20865
313 Ga0495624_0014065 3300046690 Bacteria 5443
314 Ga0495670_0067952 3300046691 Bacteria 1800
315 Ga0495600_0019430 3300046809 Bacteria 4338
316 Ga0495600_0138531 3300046809 Unclassified 1579
317 Ga0495581_0001618 3300047315 Bacteria 12555
318 Ga0495581_0019559 3300047315 Bacteria 3929
319 Ga0495581_0024660 3300047315 Bacteria 3486
320 Ga0495604_0205502 3300047317 Unclassified 1363
321 Ga0495674_0000926 3300047319 Bacteria 28035
322 Ga0495674_0007614 3300047319 Bacteria 10347
323 Ga0495674_0078205 3300047319 Bacteria 2842
324 Ga0495676_0002272 3300047321 Bacteria 17045
325 Ga0495676_0010181 3300047321 Bacteria 8541
326 Ga0495680_0005325 3300047322 Bacteria 12144
327 Ga0495680_0027385 3300047322 Bacteria 4685
328 Ga0495680_0043071 3300047322 Bacteria 3577
329 Ga0495680_0098676 3300047322 Bacteria 2179
330 Ga0495675_0095426 3300047444 Bacteria 1864
331 Ga0495684_0001281 3300047471 Bacteria 20198
332 Ga0495684_0105951 3300047471 Bacteria 2124
333 Ga0495593_0016079 3300047673 Bacteria 4223
334 Ga0495593_0084440 3300047673 Bacteria 1639
335 Ga0495602_0031308 3300048088 Bacteria 5031
336 Ga0495602_0109284 3300048088 Bacteria 2250
337 Ga0496100_0025213 3300048903 Bacteria 3635
338 Ga0496101_0045789 3300048904 Bacteria 3135
339 Ga0496102_0004116 3300048905 Bacteria 12334
340 Ga0496102_0022512 3300048905 Bacteria 5585
341 Ga0496102_0048338 3300048905 Bacteria 3868
342 Ga0496103_0006302 3300048906 Bacteria 7091
343 Ga0496104_0076518 3300048907 Bacteria 3187
344 Ga0496104_0394264 3300048907 Unclassified 1296
345 Ga0496105_0011336 3300048908 Bacteria 7040
346 Ga0496106_0070683 3300048909 Bacteria 2666
347 Ga0496108_0000102 3300048911 Bacteria 88979
348 Ga0496108_0008988 3300048911 Bacteria 8097
349 Ga0496108_0014769 3300048911 Bacteria 6374
350 Ga0496108_0086617 3300048911 Bacteria 2659
351 Ga0496108_0175271 3300048911 Unclassified 1856
352 Ga0496109_0001926 3300048912 Bacteria 17245
353 Ga0496109_0040697 3300048912 Bacteria 4209
354 Ga0496109_0553677 3300048912 Bacteria 1085
355 Ga0496110_0010124 3300048913 Bacteria 7656
356 Ga0496110_0045752 3300048913 Bacteria 3826
357 Ga0496110_0100663 3300048913 Bacteria 2590
358 Ga0496111_0107493 3300048914 Bacteria 2054
359 Ga0496111_0128441 3300048914 Bacteria 1874
360 Ga0496112_0004688 3300048915 Bacteria 11636
361 Ga0496112_0039007 3300048915 Bacteria 4639
362 Ga0496113_0053857 3300048916 Bacteria 3009
363 Ga0496113_0100668 3300048916 Bacteria 2239
364 Ga0496113_0113893 3300048916 Unclassified 2108
365 Ga0496114_0065103 3300048917 Bacteria 3053
366 Ga0496115_0015274 3300048918 Bacteria 5822
367 Ga0501033_0124970 3300049570 Bacteria 1865
368 Ga0501036_0057473 3300049572 Bacteria 3295
369 Ga0501036_0276876 3300049572 Bacteria 1404
370 Ga0501037_0017274 3300049573 Bacteria 5313
371 Ga0501037_0076218 3300049573 Bacteria 2435
372 Ga0501038_0053698 3300049574 Bacteria 3468
373 Ga0501039_0135038 3300049575 Bacteria 1937
374 Ga0501040_0007258 3300049576 Bacteria 7181
375 Ga0501040_0047774 3300049576 Bacteria 2923
376 Ga0501041_0092580 3300049577 Bacteria 1866
377 Ga0501042_0006168 3300049578 Bacteria 7773
378 Ga0501042_0173939 3300049578 Bacteria 1553
379 Ga0501043_0093635 3300049579 Bacteria 2362
380 Ga0501048_0013382 3300049582 Bacteria 6089
381 Ga0501048_0055639 3300049582 Bacteria 2808
382 Ga0501048_0066337 3300049582 Bacteria 2552
383 Ga0501068_0064232 3300049584 Bacteria 2234
384 Ga0501071_0030413 3300049587 Bacteria 3819
385 Ga0501071_0056369 3300049587 Bacteria 2838
386 Ga0501074_0007040 3300049590 Bacteria 8123
387 Ga0501074_0118192 3300049590 Bacteria 1896
388 Ga0501075_0057937 3300049591 Bacteria 2917
389 Ga0501075_0155534 3300049591 Bacteria 1743
390 Ga0501076_0003080 3300049592 Bacteria 11614
391 Ga0501076_0057210 3300049592 Bacteria 3096
392 Ga0501076_0235677 3300049592 Bacteria 1496
393 Ga0501077_0005246 3300049593 Bacteria 7872
394 Ga0501077_0029722 3300049593 Bacteria 3475
395 Ga0501077_0151152 3300049593 Bacteria 1473
396 Ga0501079_0001038 3300049741 Bacteria 19232
397 Ga0501079_0127391 3300049741 Bacteria 1980
398 Ga0501080_0051830 3300049742 Bacteria 3820
399 Ga0501080_0264846 3300049742 Bacteria 1565
400 Ga0501081_0006325 3300049743 Bacteria 7676
401 Ga0501045_0003583 3300049824 Bacteria 10665
402 Ga0501045_0043681 3300049824 Bacteria 3264
403 nmdc:mga05p37_126626_c1 3300050507 Bacteria 3137
404 nmdc:mga05p37_37650_c1 3300050507 Bacteria 5932
405 nmdc:mga09592_11554_c1 3300050508 Bacteria 7183
406 nmdc:mga09592_12602_c1 3300050508 Bacteria 6891
407 nmdc:mga09592_26707_c1 3300050508 Bacteria 4785
408 nmdc:mga09592_42367_c1 3300050508 Bacteria 3828
409 nmdc:mga0qj67_114736_c1 3300050509 Bacteria 2176
410 nmdc:mga0qj67_202444_c1 3300050509 Unclassified 1613
411 nmdc:mga0qj67_42339_c1 3300050509 Bacteria 3584
412 nmdc:mga0qj67_8866_c1 3300050509 Bacteria 7463
413 nmdc:mga06r32_11316_c1 3300050510 Bacteria 8037
414 nmdc:mga06r32_26122_c1 3300050510 Bacteria 5441
415 nmdc:mga06r32_531761_c1 3300050510 Unclassified 1151
416 nmdc:mga08y16_493_c1 3300050511 Bacteria 36438
417 nmdc:mga0n895_23842_c1 3300050512 Bacteria 5758
418 nmdc:mga0n895_2557_c1 3300050512 Bacteria 14264
419 nmdc:mga0rr50_125083_c1 3300050513 Bacteria 2052
420 nmdc:mga0a205_34068_c1 3300050515 Bacteria 4886
421 Ga0495601_0140656 3300053077 Bacteria 1574
422 Ga0495619_0000574 3300053085 Bacteria 24419
423 Ga0501084_0083950 3300054114 Bacteria 2674
424 Ga0501082_0073961 3300060353 Bacteria 2934
425 Ga0530510_0001208 3300061734 Bacteria 17227
426 Ga0530510_0046016 3300061734 Bacteria 3152
427 Ga0530510_0280989 3300061734 Bacteria 1243
428 2899368673 2899359706 Bacteria 10940472
429 8003323446 8003314358 Bacteria 10575343
430 Ga0081455_10025829
431 JGI25407J50210_10002495
432 JGI25407J50210_10009525
433 JGI25407J50210_10011876
434 JGI25407J50210_10013775
435 JGI25407J50210_10015532
436 Ga0070666_10156932
437 Ga0068868_100204527
438 Ga0070691_10061195
439 Ga0070668_100058796
440 Ga0070668_100098639
441 Ga0070667_100342091
442 Ga0070714_100094363
443 Ga0070714_100135560
444 Ga0070714_100198068
445 Ga0070714_100198530
446 Ga0070713_100018683
447 Ga0070713_100177287
448 Ga0070710_10061661
449 Ga0070710_10075873
450 Ga0070711_100061263
451 Ga0070711_100132944
452 Ga0070711_100212690
453 Ga0070708_100012829
454 Ga0070663_100000795
455 Ga0070663_100003457
456 Ga0070681_10037896
457 Ga0070706_100342253
458 Ga0070707_100005650
459 Ga0070707_100015035
460 Ga0070707_100027821
461 Ga0070698_100135157
462 Ga0070699_100059960
463 Ga0070699_100201300
464 Ga0070697_100000447
465 Ga0070686_100104301
466 Ga0070704_100135431
467 Ga0070704_100166938
468 Ga0068855_100180147
469 Ga0068855_100181572
470 Ga0070664_100085424
471 Ga0068857_100129618
472 Ga0068856_100065215
473 Ga0068859_100070795
474 Ga0068863_100050117
475 Ga0068858_100032830
476 Ga0068858_100067047
477 Ga0068862_100158022
478 Ga0068862_100159926
479 Ga0081455_10000332
480 Ga0081455_10037244
481 Ga0081538_10000655
482 Ga0081538_10001348
483 Ga0081538_10002297
484 Ga0081538_10002818
485 Ga0081538_10002914
486 Ga0081538_10005403
487 Ga0081538_10007125
488 Ga0081540_1007882
489 Ga0081539_10004997
490 Ga0070717_10008658
491 Ga0070717_10091599
492 Ga0070717_10150752
493 Ga0070715_10011859
494 Ga0070715_10018963
495 Ga0070712_100023865
496 Ga0070712_100042136
497 Ga0070712_100117348
498 Ga0075427_10000993
499 Ga0068871_100184357
500 Ga0075428_100010550
501 Ga0075428_100014437
502 Ga0075428_100117567
503 Ga0075430_100006333
504 Ga0075430_100037029
505 Ga0075431_100017600
506 Ga0075431_100063829
507 Ga0075431_100095417
508 Ga0075433_10040062
509 Ga0075429_100004099
510 Ga0075429_100025786
511 Ga0075429_100069377
512 Ga0075429_100186089
513 Ga0097620_100070787
514 Ga0075435_100057386
515 Ga0075435_100149790
516 Ga0075435_100157995
517 Ga0105251_10020886
518 Ga0111539_10014581
519 Ga0105245_10061776
520 Ga0105245_10082484
521 Ga0114129_10000906
522 Ga0114129_10005966
523 Ga0114129_10096272
524 Ga0114129_10178189
525 Ga0114129_10596494
526 Ga0105242_10073996
527 Ga0105248_10088116
528 Ga0105248_10110240
529 Ga0105239_10215569
530 Ga0157373_10048184
531 Ga0157370_10163430
532 Ga0157378_10264342
533 Ga0157375_10035582
534 Ga0163163_10054920
535 Ga0163163_10223400
536 Ga0157379_10004880
537 Ga0163161_10216228
538 Ga0206353_10954675
539 Ga0213875_10005152
540 Ga0213875_10026520
541 Ga0207653_10013175
542 Ga0207692_10011308
543 Ga0207692_10163963
544 Ga0207685_10004348
545 Ga0207699_10003284
546 Ga0207699_10006161
547 Ga0207645_10026259
548 Ga0207643_10040844
549 Ga0207684_10032135
550 Ga0207684_10274463
551 Ga0207693_10006608
552 Ga0207693_10043685
553 Ga0207693_10044295
554 Ga0207693_10065398
555 Ga0207693_10167835
556 Ga0207663_10012987
557 Ga0207663_10041295
558 Ga0207660_10013786
559 Ga0207662_10051574
560 Ga0207657_10003732
561 Ga0207649_10199481
562 Ga0207646_10004775
563 Ga0207646_10036607
564 Ga0207687_10050296
565 Ga0207700_10128503
566 Ga0207664_10054486
567 Ga0207664_10131352
568 Ga0207664_10155380
569 Ga0207706_10142277
570 Ga0207709_10088198
571 Ga0207665_10033918
572 Ga0207665_10055442
573 Ga0207689_10005905
574 Ga0207668_10143891
575 Ga0207640_10064579
576 Ga0207677_10060849
577 Ga0207703_10032142
578 Ga0207678_10000312
579 Ga0207678_10000552
580 Ga0207708_10060487
581 Ga0207674_10016630
582 Ga0207675_100138643
583 Ga0207683_10008781
584 Ga0207428_10001190
585 Ga0265326_10006155
586 Ga0265319_1011467
587 Ga0265334_10002927
588 Ga0265336_10018862
589 Ga0265338_10000449
590 Ga0265324_10000824
591 Ga0265320_10001578
592 Ga0265339_10025391
593 Ga0265316_10050720
594 Ga0307513_10134371
595 Ga0265313_10016218
596 Ga0265314_10059048
597 Ga0265342_10009088
598 Ga0307410_10134620
599 Ga0326468_10000191
600 Ga0307406_10009586
601 Ga0307406_10237634
602 Ga0307412_10071748
603 Ga0307409_100005434
604 Ga0307409_100119789
605 Ga0307416_100079744
606 Ga0307414_10357129
607 Ga0307415_100003676
608 Ga0307415_100020062
609 Ga0307415_100155265
610 Ga0307507_10059312
611 Ga0307510_10062879
612 Ga0373926_0005125
613 Ga0373926_0053273
614 Ga0373934_0025014
615 Ga0373934_0031795
616 Ga0373940_0003910
617 Ga0373940_0017369
618 Ga0373944_0001444
619 Ga0373923_0057047
620 Ga0373932_0014766
621 Ga0373936_0000200
622 Ga0373936_0000765
623 Ga0373939_0006759
624 Ga0373939_0007719
625 Ga0373945_0000988
626 Ga0373945_0003233
627 Ga0373954_0024604
628 Ga0373957_0015072
629 Ga0373957_0046790
630 Ga0373960_0001382
631 Ga0373960_0028940
632 Ga0373943_0000088
633 Ga0373943_0000633
634 Ga0373943_0105643
635 Ga0373946_0000133
636 Ga0373946_0000647
637 Ga0373955_0022542
638 Ga0373955_0097996
639 Ga0373931_0011031
640 Ga0373935_0006479
641 Ga0373927_0004754
642 Ga0373927_0028243
643 Ga0373933_0005941
644 Ga0373933_0020988
645 Ga0373933_0030203
646 Ga0373947_0000713
647 Ga0373947_0001155
648 Ga0373937_0003794
649 Ga0373937_0019739
650 Ga0373937_0089412
651 Ga0316582_0185110
652 Ga0373925_0008093
653 Ga0373925_0059693
654 Ga0395900_0022124
655 Ga0395900_0060834
656 Ga0395898_0035710
657 Ga0395898_0199396
658 Ga0395905_0031905
659 Ga0436364_0755931
660 Ga0436364_1511731
661 Ga0395901_0007519
662 Ga0395901_0063709
663 Ga0395901_0148976
664 Ga0439449_0032833
665 Ga0439450_030060
666 Ga0466969_0067881
667 Ga0466972_0001980
668 Ga0466959_0056220
669 Ga0466959_0243408
670 Ga0466967_0094662
671 Ga0495592_0161375
672 Ga0495592_0192420
673 Ga0495603_0000448
674 Ga0495603_0023536
675 Ga0495629_0005793
676 Ga0495641_0005821
677 Ga0495641_0022296
678 Ga0495641_0044933
679 Ga0495651_0004448
680 Ga0495651_0084507
681 Ga0495653_0004004
682 Ga0495653_0017542
683 Ga0495653_0024496
684 Ga0495653_0053203
685 Ga0495580_0081200
686 Ga0495582_0001646
687 Ga0495582_0028897
688 Ga0495582_0030659
689 Ga0495582_0052579
690 Ga0495639_0015947
691 Ga0495662_0003259
692 Ga0495662_0019090
693 Ga0495664_0009277
694 Ga0495664_0028968
695 Ga0495664_0044496
696 Ga0495608_0003609
697 Ga0495608_0003741
698 Ga0495608_0014003
699 Ga0495608_0055514
700 Ga0495618_0007734
701 Ga0495618_0040945
702 Ga0495628_0027836
703 Ga0495630_0018863
704 Ga0495630_0019303
705 Ga0495630_0147515
706 Ga0495666_0000530
707 Ga0495652_0014399
708 Ga0495652_0024813
709 Ga0495652_0051633
710 Ga0495665_0000134
711 Ga0495665_0024570
712 Ga0495665_0052804
713 Ga0495640_0014018
714 Ga0495640_0018807
715 Ga0495640_0049945
716 Ga0495586_0004116
717 Ga0495587_0011092
718 Ga0495587_0052643
719 Ga0495645_0011173
720 Ga0495645_0017145
721 Ga0495667_0004296
722 Ga0495667_0008382
723 Ga0495667_0015153
724 Ga0495667_0026827
725 Ga0495634_0008576
726 Ga0495635_0002544
727 Ga0495635_0016891
728 Ga0495635_0025211
729 Ga0495588_0139537
730 Ga0495657_0011372
731 Ga0495657_0015914
732 Ga0495657_0033034
733 Ga0495657_0034554
734 Ga0495657_0069817
735 Ga0495599_0023439
736 Ga0495599_0104875
737 Ga0495623_0004816
738 Ga0495647_0003101
739 Ga0495658_0000376
740 Ga0495613_0001261
741 Ga0495624_0001162
742 Ga0495624_0014065
743 Ga0495670_0067952
744 Ga0495600_0019430
745 Ga0495600_0138531
746 Ga0495581_0001618
747 Ga0495581_0019559
748 Ga0495581_0024660
749 Ga0495604_0205502
750 Ga0495674_0000926
751 Ga0495674_0007614
752 Ga0495674_0078205
753 Ga0495676_0002272
754 Ga0495676_0010181
755 Ga0495680_0005325
756 Ga0495680_0027385
757 Ga0495680_0043071
758 Ga0495680_0098676
759 Ga0495675_0095426
760 Ga0495684_0001281
761 Ga0495684_0105951
762 Ga0495593_0016079
763 Ga0495593_0084440
764 Ga0495602_0031308
765 Ga0495602_0109284
766 Ga0496100_0025213
767 Ga0496101_0045789
768 Ga0496102_0004116
769 Ga0496102_0022512
770 Ga0496102_0048338
771 Ga0496103_0006302
772 Ga0496104_0076518
773 Ga0496104_0394264
774 Ga0496105_0011336
775 Ga0496106_0070683
776 Ga0496108_0000102
777 Ga0496108_0008988
778 Ga0496108_0014769
779 Ga0496108_0086617
780 Ga0496108_0175271
781 Ga0496109_0001926
782 Ga0496109_0040697
783 Ga0496109_0553677
784 Ga0496110_0010124
785 Ga0496110_0045752
786 Ga0496110_0100663
787 Ga0496111_0107493
788 Ga0496111_0128441
789 Ga0496112_0004688
790 Ga0496112_0039007
791 Ga0496113_0053857
792 Ga0496113_0100668
793 Ga0496113_0113893
794 Ga0496114_0065103
795 Ga0496115_0015274
796 Ga0501033_0124970
797 Ga0501036_0057473
798 Ga0501036_0276876
799 Ga0501037_0017274
800 Ga0501037_0076218
801 Ga0501038_0053698
802 Ga0501039_0135038
803 Ga0501040_0007258
804 Ga0501040_0047774
805 Ga0501041_0092580
806 Ga0501042_0006168
807 Ga0501042_0173939
808 Ga0501043_0093635
809 Ga0501048_0013382
810 Ga0501048_0055639
811 Ga0501048_0066337
812 Ga0501068_0064232
813 Ga0501071_0030413
814 Ga0501071_0056369
815 Ga0501074_0007040
816 Ga0501074_0118192
817 Ga0501075_0057937
818 Ga0501075_0155534
819 Ga0501076_0003080
820 Ga0501076_0057210
821 Ga0501076_0235677
822 Ga0501077_0005246
823 Ga0501077_0029722
824 Ga0501077_0151152
825 Ga0501079_0001038
826 Ga0501079_0127391
827 Ga0501080_0051830
828 Ga0501080_0264846
829 Ga0501081_0006325
830 Ga0501045_0003583
831 Ga0501045_0043681
832 nmdc:mga05p37_126626_c1
833 nmdc:mga05p37_37650_c1
834 nmdc:mga09592_11554_c1
835 nmdc:mga09592_12602_c1
836 nmdc:mga09592_26707_c1
837 nmdc:mga09592_42367_c1
838 nmdc:mga0qj67_114736_c1
839 nmdc:mga0qj67_202444_c1
840 nmdc:mga0qj67_42339_c1
841 nmdc:mga0qj67_8866_c1
842 nmdc:mga06r32_11316_c1
843 nmdc:mga06r32_26122_c1
844 nmdc:mga06r32_531761_c1
845 nmdc:mga08y16_493_c1
846 nmdc:mga0n895_23842_c1
847 nmdc:mga0n895_2557_c1
848 nmdc:mga0rr50_125083_c1
849 nmdc:mga0a205_34068_c1
850 Ga0495601_0140656
851 Ga0495619_0000574
852 Ga0501084_0083950
853 Ga0501082_0073961
854 Ga0530510_0001208
855 Ga0530510_0046016
856 Ga0530510_0280989
857 2899368673
858 8003323446

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01409

tRNA-synt_2d

tRNA synthetases class II core domain (F)

100

306

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p75-assembly1.cif.gz_C phers in complex with compound 4a 0.8883 30 255
6p24-assembly1.cif.gz_A escherichia coli trna synthetase 0.8877 28 255
4p73-assembly1.cif.gz_C phers in complex with compound 1a 0.8862 30 255
7n8y-assembly1.cif.gz_C oxidized phers g318w from salmonella enterica serovar typhimurium 0.8771 28 254
4p75-assembly1.cif.gz_D phers in complex with compound 4a 0.8769 30 255
ID Description Score Start End Superfamily
af_Q94K73_217_334_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.89 154 261 3.30.930.10
4p73C01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8866 30 254 3.30.930.10
4p73C01 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8716 30 254 3.30.930.10
af_P9WFU3_10_338_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8702 29 254 3.30.930.10
af_Q2QPD4_79_354_3.30.930.10 Alpha Beta;2-Layer Sandwich;BirA Bifunctional Protein; domain 2;Bira Bifunctional Protein; Domain 2 0.8586 3 260 3.30.930.10
ID Description Score Start End GO Terms
AF-A0A1H5Q8T5-F1-model_v4 Phenylalanyl-tRNA synthetase alpha chain 0.986 1 259 GO:0000049
GO:0004826
GO:0005524
GO:0043039
AF-A0A1H5Q8T5-F1-model_v4 Phenylalanyl-tRNA synthetase alpha chain 0.9784 1 259 GO:0000049
GO:0004826
GO:0005524
GO:0043039
AF-A0A6L9SAM8-F1-model_v4 FDX-ACB domain-containing protein 0.9726 1 366 GO:0000049
GO:0004826
GO:0005524
GO:0043039
AF-A0A1H5Q8M9-F1-model_v4 Phenylalanyl-tRNA synthetase alpha chain 0.9725 264 372 GO:0004812
AF-A0A853AHJ0-F1-model_v4 deleted 0.9722 33 371

Map