F441868

General Info

Members Datasets Scaffolds Average Seq Length
429 272 858 273

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100008389|Ga0068856_1000083899
Length 270
Sequence MSRADVLVTADWAEQNLGQPGIVFVEVDEDTSAYDKGHIAGAVKLDWKTELQDQVRRDFVDKAGFEQLLSAKGIATDDTVILYGGNNNWFAAYAYWYFKLYGHRDVKLLDGGRKKWELDSRPLTEETTYTAKDQDTSIRAFRDEVVAAIGNKNLVDVRSPDEFAGRLFAPAHLPQEASQRAGHIPTALNVPWSKAANEDGTFKSDDELRTLYSGAGLDSSKETIAYCRIGERSSHTWFALHELLGEPNVKNYDGSWTEYGSLVGVPIEKS

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
100 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
104 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
168 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
169 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
170 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
171 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
172 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
173 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
174 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
175 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
178 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
182 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
188 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
189 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
192 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
193 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
194 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
195 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
198 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
199 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
200 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
201 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
202 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
203 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
204 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
205 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
230 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
239 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
240 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
241 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
244 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
245 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
252 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
253 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
254 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 2508501039 Frankia saprophytica CN3 Isolate Nodule
260 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
261 2517572101 Frankia sp. DC12 Isolate Nodule
262 2579778521 Frankia torreyi CpI1-S Isolate Unclassified
263 2619618881 Frankia sp. ACN1ag Isolate Unclassified
264 2619619003 Frankia sp. CpI1-P Isolate Nodule
265 2626541554 Frankia sp. AvcI.1 Isolate Nodule
266 2671180195 Frankia sp. CcI49 Isolate Nodule
267 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
268 2687453737 Frankia sp. BMG5.36 Isolate Nodule
269 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
270 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
271 2773857922 Frankia sp. CcI49 Isolate Nodule
272 8002784119 Frankia sp. AgB1.9 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 89.51
Metatranscriptomes 7.23
Isolates 3.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.47
Nodule 2.56
Rhizoplane 5.36
Rhizosphere 87.88
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100008389 3300005614 Bacteria 10068
2 Ga0007417J51691_1057119 3300003544 Bacteria 943
3 Ga0007416J51690_1056566 3300003577 Bacteria 1368
4 Ga0007429J51699_1028410 3300003579 Bacteria 1107
5 Ga0058861_12020638 3300004800 Bacteria 1628
6 Ga0058862_10078475 3300004803 Bacteria 1428
7 Ga0058862_12814060 3300004803 Bacteria 1336
8 Ga0070658_10010304 3300005327 Bacteria 7499
9 Ga0070658_10210949 3300005327 Bacteria 1640
10 Ga0070658_10223044 3300005327 Bacteria 1595
11 Ga0070676_10044390 3300005328 Bacteria 2586
12 Ga0070690_100039220 3300005330 Bacteria 2992
13 Ga0068869_100007101 3300005334 Bacteria 7135
14 Ga0068869_100110406 3300005334 Bacteria 2091
15 Ga0070666_10066807 3300005335 Bacteria 2441
16 Ga0070666_10069912 3300005335 Bacteria 2388
17 Ga0070680_100000764 3300005336 Bacteria 22523
18 Ga0070682_100155589 3300005337 Bacteria 1573
19 Ga0068868_100028863 3300005338 Bacteria 4246
20 Ga0070660_100078762 3300005339 Bacteria 2584
21 Ga0070660_100102550 3300005339 Bacteria 2268
22 Ga0070691_10038038 3300005341 Bacteria 2271
23 Ga0070687_100128896 3300005343 Bacteria 1458
24 Ga0070692_10062990 3300005345 Bacteria 1958
25 Ga0070669_100118996 3300005353 Bacteria 2012
26 Ga0070675_100473500 3300005354 Bacteria 1126
27 Ga0070671_100002344 3300005355 Bacteria 14616
28 Ga0070674_100051460 3300005356 Bacteria 2839
29 Ga0070674_100424526 3300005356 Bacteria 1092
30 Ga0070673_100152445 3300005364 Bacteria 1958
31 Ga0070673_100389799 3300005364 Bacteria 1243
32 Ga0070688_100260054 3300005365 Bacteria 1239
33 Ga0070659_100123543 3300005366 Bacteria 2099
34 Ga0070659_100216311 3300005366 Bacteria 1580
35 Ga0070667_100025482 3300005367 Bacteria 4917
36 Ga0070667_100095542 3300005367 Bacteria 2563
37 Ga0070709_10072354 3300005434 Bacteria 2228
38 Ga0070714_100043638 3300005435 Bacteria 3793
39 Ga0070713_100004654 3300005436 Bacteria 9259
40 Ga0070713_100368267 3300005436 Bacteria 1336
41 Ga0070710_10000369 3300005437 Bacteria 21100
42 Ga0070710_10033219 3300005437 Bacteria 2800
43 Ga0070710_10209684 3300005437 Bacteria 1234
44 Ga0070711_100061353 3300005439 Bacteria 2617
45 Ga0070700_100004713 3300005441 Bacteria 7145
46 Ga0070694_100164690 3300005444 Bacteria 1630
47 Ga0070663_100141257 3300005455 Bacteria 1839
48 Ga0070678_100024618 3300005456 Bacteria 4035
49 Ga0070678_100356262 3300005456 Bacteria 1259
50 Ga0070662_100022305 3300005457 Bacteria 4333
51 Ga0070681_10186228 3300005458 Bacteria 1996
52 Ga0070706_100514750 3300005467 Bacteria 1113
53 Ga0070707_100601713 3300005468 Bacteria 1062
54 Ga0070679_100024372 3300005530 Bacteria 5928
55 Ga0070679_100107930 3300005530 Bacteria 2770
56 Ga0070679_100198727 3300005530 Bacteria 1972
57 Ga0068853_100004684 3300005539 Bacteria 10609
58 Ga0068853_100063660 3300005539 Bacteria 3195
59 Ga0070686_100253035 3300005544 Bacteria 1287
60 Ga0070695_100155340 3300005545 Bacteria 1600
61 Ga0070696_100074305 3300005546 Bacteria 2397
62 Ga0070693_100012097 3300005547 Bacteria 4359
63 Ga0070665_100008463 3300005548 Bacteria 10407
64 Ga0070665_100056155 3300005548 Bacteria 3948
65 Ga0070665_100300385 3300005548 Bacteria 1608
66 Ga0068855_100021593 3300005563 Bacteria 7721
67 Ga0070664_100000129 3300005564 Bacteria 50535
68 Ga0068854_100044663 3300005578 Bacteria 3147
69 Ga0068856_100097110 3300005614 Bacteria 2935
70 Ga0070702_100006551 3300005615 Bacteria 5519
71 Ga0070702_100018120 3300005615 Bacteria 3646
72 Ga0068852_100256806 3300005616 Bacteria 1676
73 Ga0068852_100293945 3300005616 Bacteria 1570
74 Ga0068859_100086593 3300005617 Bacteria 3180
75 Ga0068864_100017887 3300005618 Bacteria 5913
76 Ga0068866_10243506 3300005718 Bacteria 1096
77 Ga0068861_100038243 3300005719 Bacteria 3571
78 Ga0068861_100073897 3300005719 Bacteria 2650
79 Ga0068870_10046286 3300005840 Bacteria 2280
80 Ga0068863_100003672 3300005841 Bacteria 15156
81 Ga0068863_100015970 3300005841 Bacteria 7202
82 Ga0068858_100011725 3300005842 Bacteria 8266
83 Ga0068858_100031845 3300005842 Bacteria 4901
84 Ga0068858_100073624 3300005842 Bacteria 3171
85 Ga0068858_100172533 3300005842 Bacteria 2040
86 Ga0068860_100000114 3300005843 Bacteria 128789
87 Ga0068862_100001055 3300005844 Bacteria 26435
88 Ga0068862_100064902 3300005844 Bacteria 3144
89 Ga0068862_100139496 3300005844 Bacteria 2151
90 Ga0081455_10135394 3300005937 Bacteria 1920
91 Ga0081540_1007535 3300005983 Bacteria 7746
92 Ga0081540_1008747 3300005983 Bacteria 7039
93 Ga0081539_10006081 3300005985 Bacteria 11798
94 Ga0081539_10018726 3300005985 Bacteria 4784
95 Ga0070717_10226011 3300006028 Bacteria 1647
96 Ga0075432_10021629 3300006058 Bacteria 2198
97 Ga0070716_100000339 3300006173 Bacteria 18942
98 Ga0070716_100007509 3300006173 Bacteria 5372
99 Ga0070712_100062926 3300006175 Bacteria 2625
100 Ga0097621_100027356 3300006237 Bacteria 4483
101 Ga0068871_100041003 3300006358 Bacteria 3710
102 Ga0068871_100585220 3300006358 Bacteria 1014
103 Ga0075430_100001364 3300006846 Bacteria 19795
104 Ga0075430_100097167 3300006846 Bacteria 2461
105 Ga0075431_100006765 3300006847 Bacteria 11384
106 Ga0075431_100290847 3300006847 Bacteria 1653
107 Ga0075433_10019681 3300006852 Bacteria 5630
108 Ga0075433_10095188 3300006852 Bacteria 2635
109 Ga0075434_100012969 3300006871 Bacteria 7917
110 Ga0075434_100051707 3300006871 Bacteria 4083
111 Ga0075429_100002721 3300006880 Bacteria 14925
112 Ga0097620_100086593 3300006931 Bacteria 3180
113 Ga0105251_10063727 3300009011 Bacteria 1729
114 Ga0111539_10001897 3300009094 Bacteria 27830
115 Ga0111539_10088850 3300009094 Bacteria 3630
116 Ga0111539_10194303 3300009094 Bacteria 2367
117 Ga0105245_10558143 3300009098 Bacteria 1168
118 Ga0105247_10031511 3300009101 Bacteria 3218
119 Ga0114129_10018920 3300009147 Bacteria 9813
120 Ga0114129_10029512 3300009147 Bacteria 7768
121 Ga0105243_10027780 3300009148 Bacteria 4338
122 Ga0105243_10487318 3300009148 Bacteria 1165
123 Ga0105241_10120464 3300009174 Bacteria 2112
124 Ga0105242_10106878 3300009176 Bacteria 2379
125 Ga0105248_10000419 3300009177 Bacteria 48685
126 Ga0105248_10023686 3300009177 Bacteria 6823
127 Ga0105248_10031838 3300009177 Bacteria 5893
128 Ga0105248_10676824 3300009177 Bacteria 1164
129 Ga0105237_10219906 3300009545 Bacteria 1900
130 Ga0105238_10194559 3300009551 Bacteria 2004
131 Ga0105238_10430595 3300009551 Bacteria 1315
132 Ga0105238_10445210 3300009551 Bacteria 1292
133 Ga0105249_10065215 3300009553 Bacteria 3350
134 Ga0105249_10105386 3300009553 Bacteria 2658
135 Ga0105239_10094012 3300010375 Bacteria 3311
136 Ga0105246_10430093 3300011119 Bacteria 1104
137 Ga0157373_10028556 3300013100 Bacteria 4024
138 Ga0157373_10221204 3300013100 Bacteria 1336
139 Ga0157370_10029061 3300013104 Bacteria 5431
140 Ga0157370_10063337 3300013104 Bacteria 3504
141 Ga0157370_10176327 3300013104 Bacteria 1987
142 Ga0157370_10257258 3300013104 Bacteria 1614
143 Ga0163162_10031688 3300013306 Bacteria 5245
144 Ga0157372_10074760 3300013307 Bacteria 3821
145 Ga0157372_10143063 3300013307 Bacteria 2757
146 Ga0157375_10048459 3300013308 Bacteria 4156
147 Ga0157375_10182130 3300013308 Bacteria 2253
148 Ga0163163_10037218 3300014325 Bacteria 4733
149 Ga0163163_10059004 3300014325 Bacteria 3794
150 Ga0182008_10029398 3300014497 Bacteria 2777
151 Ga0157377_10001984 3300014745 Bacteria 8960
152 Ga0157377_10048191 3300014745 Bacteria 2389
153 Ga0157376_10013982 3300014969 Bacteria 6005
154 Ga0157376_10265552 3300014969 Bacteria 1610
155 Ga0163161_10008261 3300017792 Bacteria 7201
156 Ga0163161_10059930 3300017792 Bacteria 2769
157 Ga0197907_10165883 3300020069 Bacteria 1755
158 Ga0197907_10820604 3300020069 Bacteria 1439
159 Ga0197907_10856530 3300020069 Bacteria 1526
160 Ga0206356_10437382 3300020070 Bacteria 2381
161 Ga0206356_10474123 3300020070 Bacteria 2049
162 Ga0206356_10480554 3300020070 Bacteria 2312
163 Ga0206349_1058361 3300020075 Bacteria 1288
164 Ga0206355_1494796 3300020076 Bacteria 1171
165 Ga0206351_10182009 3300020077 Bacteria 1586
166 Ga0206352_10715289 3300020078 Bacteria 1591
167 Ga0206352_10799515 3300020078 Bacteria 980
168 Ga0206350_10360878 3300020080 Bacteria 1488
169 Ga0206350_10367859 3300020080 Bacteria 3154
170 Ga0206350_10475216 3300020080 Bacteria 1536
171 Ga0206354_10767625 3300020081 Bacteria 4168
172 Ga0206353_10984429 3300020082 Bacteria 3216
173 Ga0206353_11098282 3300020082 Bacteria 7786
174 Ga0154015_1462848 3300020610 Bacteria 2038
175 Ga0224712_10006683 3300022467 Bacteria 3308
176 Ga0224712_10068632 3300022467 Bacteria 1433
177 Ga0207713_1097330 3300025735 Bacteria 1022
178 Ga0207692_10181196 3300025898 Bacteria 1227
179 Ga0207688_10002304 3300025901 Bacteria 10271
180 Ga0207688_10188350 3300025901 Bacteria 1233
181 Ga0207680_10017231 3300025903 Bacteria 3813
182 Ga0207680_10087912 3300025903 Bacteria 1969
183 Ga0207699_10000620 3300025906 Bacteria 17254
184 Ga0207645_10023712 3300025907 Bacteria 3985
185 Ga0207643_10000039 3300025908 Bacteria 86154
186 Ga0207705_10095684 3300025909 Bacteria 2179
187 Ga0207654_10056877 3300025911 Bacteria 2271
188 Ga0207654_10127722 3300025911 Bacteria 1605
189 Ga0207707_10002511 3300025912 Bacteria 16511
190 Ga0207671_10102418 3300025914 Bacteria 2170
191 Ga0207693_10000970 3300025915 Bacteria 25775
192 Ga0207693_10002273 3300025915 Bacteria 16710
193 Ga0207663_10013328 3300025916 Bacteria 4465
194 Ga0207663_10094172 3300025916 Bacteria 1995
195 Ga0207660_10023893 3300025917 Bacteria 4133
196 Ga0207660_10041430 3300025917 Bacteria 3227
197 Ga0207662_10162337 3300025918 Bacteria 1428
198 Ga0207657_10002184 3300025919 Bacteria 21193
199 Ga0207657_10004984 3300025919 Bacteria 13967
200 Ga0207657_10161110 3300025919 Bacteria 1822
201 Ga0207649_10014521 3300025920 Bacteria 4412
202 Ga0207652_10000272 3300025921 Bacteria 53831
203 Ga0207652_10067224 3300025921 Bacteria 3107
204 Ga0207652_10283736 3300025921 Bacteria 1494
205 Ga0207681_10067966 3300025923 Bacteria 2473
206 Ga0207694_10048075 3300025924 Bacteria 3300
207 Ga0207650_10000470 3300025925 Bacteria 33897
208 Ga0207659_10001725 3300025926 Bacteria 12965
209 Ga0207659_10072760 3300025926 Bacteria 2514
210 Ga0207687_10027450 3300025927 Bacteria 3820
211 Ga0207700_10000238 3300025928 Bacteria 32837
212 Ga0207700_10190178 3300025928 Bacteria 1724
213 Ga0207664_10000691 3300025929 Bacteria 23092
214 Ga0207644_10066533 3300025931 Bacteria 2624
215 Ga0207644_10282864 3300025931 Bacteria 1332
216 Ga0207690_10051975 3300025932 Bacteria 2743
217 Ga0207690_10138619 3300025932 Bacteria 1789
218 Ga0207706_10175301 3300025933 Bacteria 1884
219 Ga0207706_10208574 3300025933 Bacteria 1713
220 Ga0207670_10045701 3300025936 Bacteria 2904
221 Ga0207665_10000421 3300025939 Bacteria 29232
222 Ga0207665_10001014 3300025939 Bacteria 18945
223 Ga0207691_10107194 3300025940 Bacteria 2488
224 Ga0207711_10000357 3300025941 Bacteria 48637
225 Ga0207711_10023360 3300025941 Bacteria 5177
226 Ga0207689_10001021 3300025942 Bacteria 26898
227 Ga0207689_10014257 3300025942 Bacteria 6762
228 Ga0207689_10016884 3300025942 Bacteria 6176
229 Ga0207661_10114861 3300025944 Bacteria 2283
230 Ga0207661_10325429 3300025944 Bacteria 1383
231 Ga0207679_10019087 3300025945 Bacteria 4601
232 Ga0207679_10037347 3300025945 Bacteria 3452
233 Ga0207667_10028583 3300025949 Bacteria 6054
234 Ga0207651_10258065 3300025960 Bacteria 1429
235 Ga0207712_10061441 3300025961 Bacteria 2666
236 Ga0207712_10373569 3300025961 Bacteria 1191
237 Ga0207668_10039123 3300025972 Bacteria 3189
238 Ga0207668_10191961 3300025972 Bacteria 1619
239 Ga0207658_10209798 3300025986 Bacteria 1631
240 Ga0207658_10428757 3300025986 Bacteria 1167
241 Ga0207677_10049746 3300026023 Bacteria 2830
242 Ga0207703_10056803 3300026035 Bacteria 3189
243 Ga0207703_10230944 3300026035 Bacteria 1658
244 Ga0207639_10113950 3300026041 Bacteria 2209
245 Ga0207678_10000435 3300026067 Bacteria 37869
246 Ga0207678_10017846 3300026067 Bacteria 6232
247 Ga0207708_10011281 3300026075 Bacteria 6650
248 Ga0207708_10033383 3300026075 Bacteria 3910
249 Ga0207702_10003149 3300026078 Bacteria 15277
250 Ga0207702_10094255 3300026078 Bacteria 2627
251 Ga0207641_10015821 3300026088 Bacteria 6178
252 Ga0207641_10051452 3300026088 Bacteria 3488
253 Ga0207641_10066984 3300026088 Bacteria 3075
254 Ga0207676_10079429 3300026095 Bacteria 2660
255 Ga0207674_10060181 3300026116 Bacteria 3841
256 Ga0207675_100023881 3300026118 Bacteria 5686
257 Ga0207675_100036467 3300026118 Bacteria 4587
258 Ga0207683_10160117 3300026121 Bacteria 2034
259 Ga0207683_10400450 3300026121 Bacteria 1263
260 Ga0207698_10059029 3300026142 Bacteria 2977
261 Ga0207698_10291219 3300026142 Bacteria 1515
262 Ga0207428_10046619 3300027907 Bacteria 3486
263 Ga0268266_10001159 3300028379 Bacteria 32594
264 Ga0268266_10123971 3300028379 Bacteria 2303
265 Ga0268266_10694707 3300028379 Bacteria 980
266 Ga0268265_10000915 3300028380 Bacteria 27323
267 Ga0268265_10226027 3300028380 Bacteria 1641
268 Ga0268265_10397355 3300028380 Bacteria 1273
269 Ga0268264_10000147 3300028381 Bacteria 164790
270 Ga0268264_10120900 3300028381 Bacteria 2308
271 Ga0307513_10056680 3300031456 Bacteria 4181
272 Ga0307513_10091349 3300031456 Bacteria 3103
273 Ga0307509_10111183 3300031507 Bacteria 2743
274 Ga0307408_100626438 3300031548 Bacteria 959
275 Ga0316575_10065538 3300031665 Bacteria 1455
276 Ga0307405_10003583 3300031731 Bacteria 7169
277 Ga0307405_10041531 3300031731 Bacteria 2794
278 Ga0307413_10005806 3300031824 Bacteria 5559
279 Ga0307413_10368635 3300031824 Bacteria 1115
280 Ga0307410_10043436 3300031852 Bacteria 2979
281 Ga0307410_10305225 3300031852 Bacteria 1257
282 Ga0307406_10119181 3300031901 Bacteria 1831
283 Ga0307406_10292796 3300031901 Bacteria 1247
284 Ga0307407_10409652 3300031903 Bacteria 975
285 Ga0307412_10038047 3300031911 Bacteria 3095
286 Ga0307409_100001950 3300031995 Bacteria 10544
287 Ga0307409_100012386 3300031995 Bacteria 5434
288 Ga0307409_100013733 3300031995 Bacteria 5230
289 Ga0307409_100117067 3300031995 Bacteria 2248
290 Ga0307416_100002819 3300032002 Bacteria 10109
291 Ga0307416_100467288 3300032002 Bacteria 1318
292 Ga0307411_10487399 3300032005 Bacteria 1039
293 Ga0307415_100000938 3300032126 Bacteria 13386
294 Ga0307415_100015781 3300032126 Bacteria 4484
295 Ga0307415_100045037 3300032126 Bacteria 2955
296 Ga0307415_100166307 3300032126 Bacteria 1715
297 Ga0307507_10000009 3300033179 Bacteria 265992
298 Ga0307507_10044337 3300033179 Bacteria 4399
299 Ga0373929_0010165 3300035085 Bacteria 1755
300 Ga0373949_0039198 3300035090 Bacteria 1159
301 Ga0373951_0016170 3300035091 Bacteria 1682
302 Ga0373939_0018969 3300035114 Bacteria 1850
303 Ga0373931_0004236 3300035691 Bacteria 6525
304 Ga0395899_0052280 3300037312 Bacteria 3029
305 Ga0395900_0022082 3300037418 Bacteria 6510
306 Ga0395900_0202830 3300037418 Bacteria 2006
307 Ga0395898_0035475 3300037466 Bacteria 4958
308 Ga0395898_0215905 3300037466 Bacteria 1829
309 Ga0395901_0004651 3300038443 Bacteria 13847
310 Ga0395901_0005702 3300038443 Bacteria 12603
311 Ga0436365_0584201 3300039437 Bacteria 1636
312 Ga0436365_1775703 3300039437 Bacteria 2534
313 Ga0439450_014231 3300042008 Bacteria 1611
314 Ga0439455_0007984 3300042012 Bacteria 2257
315 Ga0439463_018473 3300042016 Bacteria 1735
316 Ga0439464_0020133 3300042439 Bacteria 1826
317 Ga0466969_0042838 3300044656 Bacteria 2257
318 Ga0466965_0045743 3300044683 Bacteria 2166
319 Ga0466965_0084054 3300044683 Bacteria 1612
320 Ga0466965_0105560 3300044683 Bacteria 1444
321 Ga0466966_0065972 3300044684 Bacteria 2275
322 Ga0466966_0140924 3300044684 Bacteria 1473
323 Ga0466961_0014354 3300044693 Bacteria 5083
324 Ga0466961_0101346 3300044693 Bacteria 1814
325 Ga0466961_0131469 3300044693 Bacteria 1569
326 Ga0466961_0162701 3300044693 Bacteria 1391
327 Ga0466963_0009583 3300044694 Bacteria 5836
328 Ga0466963_0138881 3300044694 Bacteria 1682
329 Ga0466963_0168063 3300044694 Bacteria 1528
330 Ga0466964_0053370 3300044706 Bacteria 1664
331 Ga0466971_0002473 3300044719 Bacteria 7804
332 Ga0466971_0098187 3300044719 Bacteria 1344
333 Ga0466968_0000209 3300044735 Bacteria 18032
334 Ga0466957_0087558 3300044842 Bacteria 1947
335 Ga0466957_0090142 3300044842 Bacteria 1920
336 Ga0466957_0142389 3300044842 Bacteria 1545
337 Ga0466960_0008336 3300044901 Bacteria 4241
338 Ga0466959_0037760 3300045049 Bacteria 3569
339 Ga0466959_0111243 3300045049 Bacteria 1954
340 Ga0466959_0147371 3300045049 Bacteria 1660
341 Ga0466958_0001073 3300045836 Bacteria 12562
342 Ga0466958_0040292 3300045836 Bacteria 2808
343 Ga0466958_0110662 3300045836 Bacteria 1714
344 Ga0466967_0006591 3300045976 Bacteria 8246
345 Ga0466967_0053535 3300045976 Bacteria 3547
346 Ga0466967_0138335 3300045976 Bacteria 2266
347 Ga0466967_0156760 3300045976 Bacteria 2133
348 Ga0495608_0367928 3300046511 Bacteria 883
349 Ga0496100_0084920 3300048903 Bacteria 2147
350 Ga0496101_0090127 3300048904 Bacteria 2280
351 Ga0496102_0245894 3300048905 Bacteria 1687
352 Ga0496102_0362664 3300048905 Bacteria 1364
353 Ga0496104_0001372 3300048907 Bacteria 21066
354 Ga0496104_0025620 3300048907 Bacteria 5438
355 Ga0496105_0001555 3300048908 Bacteria 16243
356 Ga0496105_0009011 3300048908 Bacteria 7784
357 Ga0496106_0017984 3300048909 Bacteria 5227
358 Ga0496107_0022726 3300048910 Bacteria 4433
359 Ga0496108_0192131 3300048911 Bacteria 1769
360 Ga0496109_0017670 3300048912 Bacteria 6255
361 Ga0496109_0027760 3300048912 Bacteria 5057
362 Ga0496109_0210886 3300048912 Bacteria 1827
363 Ga0496110_0065709 3300048913 Bacteria 3207
364 Ga0496110_0081901 3300048913 Bacteria 2877
365 Ga0496111_0050717 3300048914 Bacteria 2994
366 Ga0496111_0066186 3300048914 Bacteria 2623
367 Ga0496111_0403796 3300048914 Bacteria 1010
368 Ga0496112_0097826 3300048915 Bacteria 2905
369 Ga0496113_0046608 3300048916 Bacteria 3218
370 Ga0496114_0013901 3300048917 Bacteria 6453
371 Ga0496115_0061544 3300048918 Bacteria 3026
372 Ga0496116_0000182 3300048919 Bacteria 125343
373 Ga0496117_0010092 3300048920 Bacteria 8668
374 Ga0496117_0051619 3300048920 Bacteria 2905
375 Ga0496118_0001362 3300048921 Bacteria 36823
376 Ga0496119_0003744 3300048922 Bacteria 15560
377 Ga0496120_0041408 3300048923 Bacteria 2699
378 Ga0496124_0338420 3300048927 Bacteria 1070
379 Ga0501032_0194931 3300049569 Bacteria 1323
380 Ga0501037_0008850 3300049573 Bacteria 7373
381 Ga0501038_0155735 3300049574 Bacteria 1860
382 Ga0501043_0136273 3300049579 Bacteria 1923
383 Ga0501043_0138744 3300049579 Bacteria 1904
384 Ga0501046_0021164 3300049580 Bacteria 5370
385 Ga0501047_0028498 3300049581 Bacteria 5385
386 Ga0501047_0153842 3300049581 Bacteria 2174
387 Ga0501048_0157701 3300049582 Bacteria 1605
388 Ga0501069_0000471 3300049585 Bacteria 18364
389 Ga0501069_0116071 3300049585 Bacteria 1527
390 Ga0501070_0006798 3300049586 Bacteria 9732
391 Ga0501070_0017079 3300049586 Bacteria 6090
392 Ga0501070_0162429 3300049586 Bacteria 1841
393 Ga0501074_0027119 3300049590 Bacteria 4152
394 Ga0501080_0002736 3300049742 Bacteria 15470
395 Ga0501035_0284325 3300049822 Bacteria 1397
396 Ga0501044_0140515 3300049823 Bacteria 2404
397 Ga0501044_0317063 3300049823 Bacteria 1484
398 nmdc:mga0yw44_23389_c1 3300050492 Bacteria 3481
399 nmdc:mga05p37_23809_c1 3300050507 Bacteria 7436
400 nmdc:mga0qj67_6026_c1 3300050509 Bacteria 8880
401 nmdc:mga06r32_499974_c1 3300050510 Bacteria 1193
402 nmdc:mga08y16_335883_c1 3300050511 Bacteria 1554
403 nmdc:mga08y16_41249_c1 3300050511 Bacteria 4836
404 nmdc:mga0n895_177060_c2 3300050512 Bacteria 1803
405 nmdc:mga0n895_9011_c1 3300050512 Bacteria 8702
406 nmdc:mga0rr50_11595_c1 3300050513 Bacteria 5652
407 nmdc:mga08x19_36214_c1 3300050514 Bacteria 3125
408 nmdc:mga0a205_12912_c1 3300050515 Bacteria 7748
409 nmdc:mga0a205_4767_c1 3300050515 Bacteria 12185
410 Ga0500583_0037945 3300053092 Bacteria 2167
411 Ga0587083_0033400 3300059505 Bacteria 1038
412 Ga0587128_010380 3300059630 Bacteria 1250
413 Ga0587079_023289 3300059647 Bacteria 1132
414 Ga0587107_008742 3300059652 Bacteria 1177
415 Ga0587111_0034811 3300060346 Bacteria 1047
416 2508670794 2508501039 Bacteria 9978592
417 2515857026 2515154155 Bacteria 7985436
418 2517762405 2517572101 Bacteria 6884336
419 2579854464 2579778521 Bacteria 7624758
420 2619853897 2619618881 Bacteria 7521104
421 2620349421 2619619003 Bacteria 7619552
422 2626634760 2626541554 Bacteria 7741902
423 2671835877 2671180195 Bacteria 9757215
424 2676201188 2675902999 Bacteria 9438463
425 2689959114 2687453737 Bacteria 11203906
426 2689992221 2687453743 Bacteria 8361025
427 2774845764 2773857921 Bacteria 9435764
428 2774854033 2773857922 Bacteria 9757215
429 8002791781 8002784119 Bacteria 9788632
430 Ga0068856_100008389
431 Ga0007417J51691_1057119
432 Ga0007416J51690_1056566
433 Ga0007429J51699_1028410
434 Ga0058861_12020638
435 Ga0058862_10078475
436 Ga0058862_12814060
437 Ga0070658_10010304
438 Ga0070658_10210949
439 Ga0070658_10223044
440 Ga0070676_10044390
441 Ga0070690_100039220
442 Ga0068869_100007101
443 Ga0068869_100110406
444 Ga0070666_10066807
445 Ga0070666_10069912
446 Ga0070680_100000764
447 Ga0070682_100155589
448 Ga0068868_100028863
449 Ga0070660_100078762
450 Ga0070660_100102550
451 Ga0070691_10038038
452 Ga0070687_100128896
453 Ga0070692_10062990
454 Ga0070669_100118996
455 Ga0070675_100473500
456 Ga0070671_100002344
457 Ga0070674_100051460
458 Ga0070674_100424526
459 Ga0070673_100152445
460 Ga0070673_100389799
461 Ga0070688_100260054
462 Ga0070659_100123543
463 Ga0070659_100216311
464 Ga0070667_100025482
465 Ga0070667_100095542
466 Ga0070709_10072354
467 Ga0070714_100043638
468 Ga0070713_100004654
469 Ga0070713_100368267
470 Ga0070710_10000369
471 Ga0070710_10033219
472 Ga0070710_10209684
473 Ga0070711_100061353
474 Ga0070700_100004713
475 Ga0070694_100164690
476 Ga0070663_100141257
477 Ga0070678_100024618
478 Ga0070678_100356262
479 Ga0070662_100022305
480 Ga0070681_10186228
481 Ga0070706_100514750
482 Ga0070707_100601713
483 Ga0070679_100024372
484 Ga0070679_100107930
485 Ga0070679_100198727
486 Ga0068853_100004684
487 Ga0068853_100063660
488 Ga0070686_100253035
489 Ga0070695_100155340
490 Ga0070696_100074305
491 Ga0070693_100012097
492 Ga0070665_100008463
493 Ga0070665_100056155
494 Ga0070665_100300385
495 Ga0068855_100021593
496 Ga0070664_100000129
497 Ga0068854_100044663
498 Ga0068856_100097110
499 Ga0070702_100006551
500 Ga0070702_100018120
501 Ga0068852_100256806
502 Ga0068852_100293945
503 Ga0068859_100086593
504 Ga0068864_100017887
505 Ga0068866_10243506
506 Ga0068861_100038243
507 Ga0068861_100073897
508 Ga0068870_10046286
509 Ga0068863_100003672
510 Ga0068863_100015970
511 Ga0068858_100011725
512 Ga0068858_100031845
513 Ga0068858_100073624
514 Ga0068858_100172533
515 Ga0068860_100000114
516 Ga0068862_100001055
517 Ga0068862_100064902
518 Ga0068862_100139496
519 Ga0081455_10135394
520 Ga0081540_1007535
521 Ga0081540_1008747
522 Ga0081539_10006081
523 Ga0081539_10018726
524 Ga0070717_10226011
525 Ga0075432_10021629
526 Ga0070716_100000339
527 Ga0070716_100007509
528 Ga0070712_100062926
529 Ga0097621_100027356
530 Ga0068871_100041003
531 Ga0068871_100585220
532 Ga0075430_100001364
533 Ga0075430_100097167
534 Ga0075431_100006765
535 Ga0075431_100290847
536 Ga0075433_10019681
537 Ga0075433_10095188
538 Ga0075434_100012969
539 Ga0075434_100051707
540 Ga0075429_100002721
541 Ga0097620_100086593
542 Ga0105251_10063727
543 Ga0111539_10001897
544 Ga0111539_10088850
545 Ga0111539_10194303
546 Ga0105245_10558143
547 Ga0105247_10031511
548 Ga0114129_10018920
549 Ga0114129_10029512
550 Ga0105243_10027780
551 Ga0105243_10487318
552 Ga0105241_10120464
553 Ga0105242_10106878
554 Ga0105248_10000419
555 Ga0105248_10023686
556 Ga0105248_10031838
557 Ga0105248_10676824
558 Ga0105237_10219906
559 Ga0105238_10194559
560 Ga0105238_10430595
561 Ga0105238_10445210
562 Ga0105249_10065215
563 Ga0105249_10105386
564 Ga0105239_10094012
565 Ga0105246_10430093
566 Ga0157373_10028556
567 Ga0157373_10221204
568 Ga0157370_10029061
569 Ga0157370_10063337
570 Ga0157370_10176327
571 Ga0157370_10257258
572 Ga0163162_10031688
573 Ga0157372_10074760
574 Ga0157372_10143063
575 Ga0157375_10048459
576 Ga0157375_10182130
577 Ga0163163_10037218
578 Ga0163163_10059004
579 Ga0182008_10029398
580 Ga0157377_10001984
581 Ga0157377_10048191
582 Ga0157376_10013982
583 Ga0157376_10265552
584 Ga0163161_10008261
585 Ga0163161_10059930
586 Ga0197907_10165883
587 Ga0197907_10820604
588 Ga0197907_10856530
589 Ga0206356_10437382
590 Ga0206356_10474123
591 Ga0206356_10480554
592 Ga0206349_1058361
593 Ga0206355_1494796
594 Ga0206351_10182009
595 Ga0206352_10715289
596 Ga0206352_10799515
597 Ga0206350_10360878
598 Ga0206350_10367859
599 Ga0206350_10475216
600 Ga0206354_10767625
601 Ga0206353_10984429
602 Ga0206353_11098282
603 Ga0154015_1462848
604 Ga0224712_10006683
605 Ga0224712_10068632
606 Ga0207713_1097330
607 Ga0207692_10181196
608 Ga0207688_10002304
609 Ga0207688_10188350
610 Ga0207680_10017231
611 Ga0207680_10087912
612 Ga0207699_10000620
613 Ga0207645_10023712
614 Ga0207643_10000039
615 Ga0207705_10095684
616 Ga0207654_10056877
617 Ga0207654_10127722
618 Ga0207707_10002511
619 Ga0207671_10102418
620 Ga0207693_10000970
621 Ga0207693_10002273
622 Ga0207663_10013328
623 Ga0207663_10094172
624 Ga0207660_10023893
625 Ga0207660_10041430
626 Ga0207662_10162337
627 Ga0207657_10002184
628 Ga0207657_10004984
629 Ga0207657_10161110
630 Ga0207649_10014521
631 Ga0207652_10000272
632 Ga0207652_10067224
633 Ga0207652_10283736
634 Ga0207681_10067966
635 Ga0207694_10048075
636 Ga0207650_10000470
637 Ga0207659_10001725
638 Ga0207659_10072760
639 Ga0207687_10027450
640 Ga0207700_10000238
641 Ga0207700_10190178
642 Ga0207664_10000691
643 Ga0207644_10066533
644 Ga0207644_10282864
645 Ga0207690_10051975
646 Ga0207690_10138619
647 Ga0207706_10175301
648 Ga0207706_10208574
649 Ga0207670_10045701
650 Ga0207665_10000421
651 Ga0207665_10001014
652 Ga0207691_10107194
653 Ga0207711_10000357
654 Ga0207711_10023360
655 Ga0207689_10001021
656 Ga0207689_10014257
657 Ga0207689_10016884
658 Ga0207661_10114861
659 Ga0207661_10325429
660 Ga0207679_10019087
661 Ga0207679_10037347
662 Ga0207667_10028583
663 Ga0207651_10258065
664 Ga0207712_10061441
665 Ga0207712_10373569
666 Ga0207668_10039123
667 Ga0207668_10191961
668 Ga0207658_10209798
669 Ga0207658_10428757
670 Ga0207677_10049746
671 Ga0207703_10056803
672 Ga0207703_10230944
673 Ga0207639_10113950
674 Ga0207678_10000435
675 Ga0207678_10017846
676 Ga0207708_10011281
677 Ga0207708_10033383
678 Ga0207702_10003149
679 Ga0207702_10094255
680 Ga0207641_10015821
681 Ga0207641_10051452
682 Ga0207641_10066984
683 Ga0207676_10079429
684 Ga0207674_10060181
685 Ga0207675_100023881
686 Ga0207675_100036467
687 Ga0207683_10160117
688 Ga0207683_10400450
689 Ga0207698_10059029
690 Ga0207698_10291219
691 Ga0207428_10046619
692 Ga0268266_10001159
693 Ga0268266_10123971
694 Ga0268266_10694707
695 Ga0268265_10000915
696 Ga0268265_10226027
697 Ga0268265_10397355
698 Ga0268264_10000147
699 Ga0268264_10120900
700 Ga0307513_10056680
701 Ga0307513_10091349
702 Ga0307509_10111183
703 Ga0307408_100626438
704 Ga0316575_10065538
705 Ga0307405_10003583
706 Ga0307405_10041531
707 Ga0307413_10005806
708 Ga0307413_10368635
709 Ga0307410_10043436
710 Ga0307410_10305225
711 Ga0307406_10119181
712 Ga0307406_10292796
713 Ga0307407_10409652
714 Ga0307412_10038047
715 Ga0307409_100001950
716 Ga0307409_100012386
717 Ga0307409_100013733
718 Ga0307409_100117067
719 Ga0307416_100002819
720 Ga0307416_100467288
721 Ga0307411_10487399
722 Ga0307415_100000938
723 Ga0307415_100015781
724 Ga0307415_100045037
725 Ga0307415_100166307
726 Ga0307507_10000009
727 Ga0307507_10044337
728 Ga0373929_0010165
729 Ga0373949_0039198
730 Ga0373951_0016170
731 Ga0373939_0018969
732 Ga0373931_0004236
733 Ga0395899_0052280
734 Ga0395900_0022082
735 Ga0395900_0202830
736 Ga0395898_0035475
737 Ga0395898_0215905
738 Ga0395901_0004651
739 Ga0395901_0005702
740 Ga0436365_0584201
741 Ga0436365_1775703
742 Ga0439450_014231
743 Ga0439455_0007984
744 Ga0439463_018473
745 Ga0439464_0020133
746 Ga0466969_0042838
747 Ga0466965_0045743
748 Ga0466965_0084054
749 Ga0466965_0105560
750 Ga0466966_0065972
751 Ga0466966_0140924
752 Ga0466961_0014354
753 Ga0466961_0101346
754 Ga0466961_0131469
755 Ga0466961_0162701
756 Ga0466963_0009583
757 Ga0466963_0138881
758 Ga0466963_0168063
759 Ga0466964_0053370
760 Ga0466971_0002473
761 Ga0466971_0098187
762 Ga0466968_0000209
763 Ga0466957_0087558
764 Ga0466957_0090142
765 Ga0466957_0142389
766 Ga0466960_0008336
767 Ga0466959_0037760
768 Ga0466959_0111243
769 Ga0466959_0147371
770 Ga0466958_0001073
771 Ga0466958_0040292
772 Ga0466958_0110662
773 Ga0466967_0006591
774 Ga0466967_0053535
775 Ga0466967_0138335
776 Ga0466967_0156760
777 Ga0495608_0367928
778 Ga0496100_0084920
779 Ga0496101_0090127
780 Ga0496102_0245894
781 Ga0496102_0362664
782 Ga0496104_0001372
783 Ga0496104_0025620
784 Ga0496105_0001555
785 Ga0496105_0009011
786 Ga0496106_0017984
787 Ga0496107_0022726
788 Ga0496108_0192131
789 Ga0496109_0017670
790 Ga0496109_0027760
791 Ga0496109_0210886
792 Ga0496110_0065709
793 Ga0496110_0081901
794 Ga0496111_0050717
795 Ga0496111_0066186
796 Ga0496111_0403796
797 Ga0496112_0097826
798 Ga0496113_0046608
799 Ga0496114_0013901
800 Ga0496115_0061544
801 Ga0496116_0000182
802 Ga0496117_0010092
803 Ga0496117_0051619
804 Ga0496118_0001362
805 Ga0496119_0003744
806 Ga0496120_0041408
807 Ga0496124_0338420
808 Ga0501032_0194931
809 Ga0501037_0008850
810 Ga0501038_0155735
811 Ga0501043_0136273
812 Ga0501043_0138744
813 Ga0501046_0021164
814 Ga0501047_0028498
815 Ga0501047_0153842
816 Ga0501048_0157701
817 Ga0501069_0000471
818 Ga0501069_0116071
819 Ga0501070_0006798
820 Ga0501070_0017079
821 Ga0501070_0162429
822 Ga0501074_0027119
823 Ga0501080_0002736
824 Ga0501035_0284325
825 Ga0501044_0140515
826 Ga0501044_0317063
827 nmdc:mga0yw44_23389_c1
828 nmdc:mga05p37_23809_c1
829 nmdc:mga0qj67_6026_c1
830 nmdc:mga06r32_499974_c1
831 nmdc:mga08y16_335883_c1
832 nmdc:mga08y16_41249_c1
833 nmdc:mga0n895_177060_c2
834 nmdc:mga0n895_9011_c1
835 nmdc:mga0rr50_11595_c1
836 nmdc:mga08x19_36214_c1
837 nmdc:mga0a205_12912_c1
838 nmdc:mga0a205_4767_c1
839 Ga0500583_0037945
840 Ga0587083_0033400
841 Ga0587128_010380
842 Ga0587079_023289
843 Ga0587107_008742
844 Ga0587111_0034811
845 2508670794
846 2515857026
847 2517762405
848 2579854464
849 2619853897
850 2620349421
851 2626634760
852 2671835877
853 2676201188
854 2689959114
855 2689992221
856 2774845764
857 2774854033
858 8002791781

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00581

Rhodanese

Rhodanese-like domain

141

262

0.85

PF00581

Rhodanese

Rhodanese-like domain

9

119

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
3aay-assembly1.cif.gz_A crystal structure of probable thiosulfate sulfurtransferase cysa3 (rv3117) from mycobacterium tuberculosis: orthorhombic form 0.9669 1 277
3hwi-assembly1.cif.gz_A crystal structure of probable thiosulfate sulfurtransferase cysa2 (rhodanese-like protein) from mycobacterium tuberculosis 0.9638 3 277
3aay-assembly1.cif.gz_A crystal structure of probable thiosulfate sulfurtransferase cysa3 (rv3117) from mycobacterium tuberculosis: orthorhombic form 0.9634 1 277
3hwi-assembly1.cif.gz_A crystal structure of probable thiosulfate sulfurtransferase cysa2 (rhodanese-like protein) from mycobacterium tuberculosis 0.9602 3 277
3aax-assembly1.cif.gz_A crystal structure of probable thiosulfate sulfurtransferase cysa3 (rv3117) from mycobacterium tuberculosis: monoclinic form 0.9595 5 277
ID Description Score Start End Superfamily
1uarA01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.944 1 141 3.40.250.10
1uarA01 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9312 1 141 3.40.250.10
af_A0A1D6KFY9_106_247_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.9014 5 129 3.40.250.10
3aayB02 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8978 143 277 3.40.250.10
af_P9WHF5_1_149_3.40.250.10 Alpha Beta;3-Layer(aba) Sandwich;Oxidized Rhodanese; domain 1;Rhodanese-like domain 0.8945 1 132 3.40.250.10
ID Description Score Start End GO Terms
AF-A0A5B2XR42-F1-model_v4 thiosulfate sulfurtransferase (EC 2.8.1.1) 0.9948 1 163 GO:0004792
AF-A0A5B2XR42-F1-model_v4 thiosulfate sulfurtransferase (EC 2.8.1.1) 0.9887 1 163 GO:0004792
AF-A0A1V3WU02-F1-model_v4 thiosulfate sulfurtransferase (EC 2.8.1.1) 0.9885 1 137 GO:0004792
AF-A0A536NA36-F1-model_v4 Sulfurtransferase 0.9769 5 113 GO:0016740
AF-A0A1C2B6G8-F1-model_v4 deleted 0.975 1 241

Map