metagRoot

F441678

General Info

Members	Datasets	Scaffolds	Average Seq Length
428	202	428	152

Family's Representative Sequence

Representative Sequence	3300013297\|Ga0157378_10168800\|Ga0157378_101688003
Length	186
Sequence	MLFRRLHLKTDCCLNGCGNRQLKVSPSIHSQWRKIMKRNRTLIGLLIVLVLTASVIVVAQVRRPFRNGSVWSVSFIQMKPGMETAYLNYVAGDWKREQEALKKDGQIISYKVITTEAHGSNDWNIMLMSEYKDLATMEANEDKADNLAQTVIGNDEKQMQGYRDRLQIREVLQTRIGREVILEPKR

Samples

	Sample ID	Description	Type	Environment
1	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
2	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
3	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
4	3300005293	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2)	Metagenome	Rhizosphere
5	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
6	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
7	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
8	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
9	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
10	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
11	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
12	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
13	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
14	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
15	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
16	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
17	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
18	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
19	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
20	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
21	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
22	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
23	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
24	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
25	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
26	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
27	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
28	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
29	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
30	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
31	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
32	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
33	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
34	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
35	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
36	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
37	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
38	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
39	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
40	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
41	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
42	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
43	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
44	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
45	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
46	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
47	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
48	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
49	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
50	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
51	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
52	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
53	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
54	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
55	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
56	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
57	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
58	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
59	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
60	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
61	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
62	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
63	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
64	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
65	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
66	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
67	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
68	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
69	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
70	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
71	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
72	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
73	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
74	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
75	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
76	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
77	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
78	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
79	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
80	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
81	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
82	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
83	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
84	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
85	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
86	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
87	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
88	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
89	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
90	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
91	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
92	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
93	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
94	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
95	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
96	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
135	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
136	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
137	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
138	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
139	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
140	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
141	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
142	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
143	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
144	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
145	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
146	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
147	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
148	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
149	3300038996	Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19	Metagenome	Rhizosphere
150	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
151	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
152	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
153	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
154	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
155	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
156	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
157	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
158	3300049513	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control	Metagenome	Rhizosphere
159	3300049515	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought	Metagenome	Rhizosphere
160	3300049520	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought	Metagenome	Rhizosphere
161	3300049521	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought	Metagenome	Rhizosphere
162	3300049523	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control	Metagenome	Rhizosphere
163	3300049526	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_B_7_control	Metagenome	Rhizosphere
164	3300049649	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought	Metagenome	Rhizosphere
165	3300049650	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought	Metagenome	Rhizosphere
166	3300049651	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought	Metagenome	Rhizosphere
167	3300049652	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought	Metagenome	Rhizosphere
168	3300049653	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control	Metagenome	Rhizosphere
169	3300049660	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control	Metagenome	Rhizosphere
170	3300049661	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control	Metagenome	Rhizosphere
171	3300049663	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought	Metagenome	Rhizosphere
172	3300049664	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought	Metagenome	Rhizosphere
173	3300049665	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought	Metagenome	Rhizosphere
174	3300049668	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought	Metagenome	Rhizosphere
175	3300049669	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought	Metagenome	Rhizosphere
176	3300049672	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought	Metagenome	Rhizosphere
177	3300049674	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought	Metagenome	Rhizosphere
178	3300049675	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control	Metagenome	Rhizosphere
179	3300049677	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control	Metagenome	Rhizosphere
180	3300049679	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought	Metagenome	Rhizosphere
181	3300049680	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought	Metagenome	Rhizosphere
182	3300049685	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control	Metagenome	Rhizosphere
183	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
184	3300049690	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought	Metagenome	Rhizosphere
185	3300049704	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control	Metagenome	Rhizosphere
186	3300049705	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought	Metagenome	Rhizosphere
187	3300049707	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought	Metagenome	Rhizosphere
188	3300049708	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control	Metagenome	Rhizosphere
189	3300049763	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control	Metagenome	Rhizosphere
190	3300049764	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control	Metagenome	Rhizosphere
191	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
192	3300049768	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought	Metagenome	Rhizosphere
193	3300049770	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control	Metagenome	Rhizosphere
194	3300049775	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought	Metagenome	Rhizosphere
195	3300049779	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought	Metagenome	Rhizosphere
196	3300049851	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought	Metagenome	Rhizosphere
197	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
198	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
199	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
200	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
201	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
202	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	1.64
Rhizosphere	98.36
Stem	0
Stem Tuber	0
Unclassified	0

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	MBSR1b_contig_1195118	2162886012	Bacteria	948
2	Ga0065704_10089556	3300005289	Bacteria	2849
3	Ga0065704_10222460	3300005289	Unclassified	1069
4	Ga0065712_10338536	3300005290	Unclassified	804
5	Ga0065715_10338422	3300005293	Unclassified	884
6	Ga0065715_10462021	3300005293	Unclassified	815
7	Ga0065715_10987588	3300005293	Unclassified	549
8	Ga0065707_10220112	3300005295	Bacteria	1213
9	Ga0070676_10637257	3300005328	Unclassified	772
10	Ga0070690_100347678	3300005330	Bacteria	1075
11	Ga0070690_100473586	3300005330	Unclassified	932
12	Ga0070690_100488039	3300005330	Unclassified	919
13	Ga0070670_101200249	3300005331	Bacteria	693
14	Ga0070670_101474364	3300005331	Unclassified	624
15	Ga0068869_100009918	3300005334	Bacteria	6189
16	Ga0068869_100176803	3300005334	Bacteria	1671
17	Ga0068869_100623615	3300005334	Unclassified	913
18	Ga0068869_100668346	3300005334	Unclassified	883
19	Ga0070666_10660039	3300005335	Unclassified	765
20	Ga0070680_100013594	3300005336	Bacteria	6346
21	Ga0068868_100029394	3300005338	Bacteria	4208
22	Ga0068868_101022779	3300005338	Unclassified	757
23	Ga0068868_101256220	3300005338	Unclassified	686
24	Ga0070689_100083380	3300005340	Bacteria	2512
25	Ga0070687_100037358	3300005343	Unclassified	2427
26	Ga0070687_100435263	3300005343	Bacteria	868
27	Ga0070692_10142691	3300005345	Unclassified	1357
28	Ga0070668_100027332	3300005347	Bacteria	4332
29	Ga0070668_100617429	3300005347	Bacteria	950
30	Ga0070669_100851677	3300005353	Unclassified	777
31	Ga0070669_101863033	3300005353	Unclassified	525
32	Ga0070675_100538470	3300005354	Bacteria	1055
33	Ga0070675_100540662	3300005354	Bacteria	1053
34	Ga0070675_101084472	3300005354	Unclassified	736
35	Ga0070671_100000791	3300005355	Bacteria	22791
36	Ga0070671_100050715	3300005355	Bacteria	3451
37	Ga0070673_100009622	3300005364	Bacteria	6499
38	Ga0070673_100044781	3300005364	Bacteria	3428
39	Ga0070673_100207525	3300005364	Bacteria	1690
40	Ga0070673_101543002	3300005364	Unclassified	627
41	Ga0070688_100230553	3300005365	Bacteria	1310
42	Ga0070688_101119585	3300005365	Unclassified	630
43	Ga0070667_100277510	3300005367	Bacteria	1504
44	Ga0070667_100624393	3300005367	Bacteria	994
45	Ga0070703_10187495	3300005406	Unclassified	803
46	Ga0070705_100061819	3300005440	Unclassified	2227
47	Ga0070705_100517692	3300005440	Unclassified	909
48	Ga0070705_100897574	3300005440	Unclassified	712
49	Ga0070705_101135247	3300005440	Unclassified	641
50	Ga0070705_101435301	3300005440	Unclassified	576
51	Ga0070694_100112848	3300005444	Bacteria	1938
52	Ga0070694_100255161	3300005444	Bacteria	1328
53	Ga0070694_100297560	3300005444	Unclassified	1235
54	Ga0070708_100143487	3300005445	Bacteria	2216
55	Ga0070708_100814886	3300005445	Unclassified	877
56	Ga0070662_100476800	3300005457	Bacteria	1038
57	Ga0070662_101071266	3300005457	Unclassified	691
58	Ga0070662_101858490	3300005457	Unclassified	520
59	Ga0070681_10009220	3300005458	Bacteria	9699
60	Ga0068867_101056337	3300005459	Bacteria	739
61	Ga0070685_10307131	3300005466	Unclassified	1071
62	Ga0070706_100063057	3300005467	Bacteria	3425
63	Ga0070706_100205536	3300005467	Bacteria	1839
64	Ga0070706_101113328	3300005467	Unclassified	727
65	Ga0070706_101590283	3300005467	Unclassified	596
66	Ga0070707_100046468	3300005468	Unclassified	4155
67	Ga0070707_100808449	3300005468	Unclassified	901
68	Ga0070707_101744553	3300005468	Unclassified	590
69	Ga0070698_101745221	3300005471	Unclassified	575
70	Ga0070699_100000061	3300005518	Bacteria	102321
71	Ga0070699_100569759	3300005518	Unclassified	1031
72	Ga0070679_100000175	3300005530	Bacteria	51520
73	Ga0070684_100666471	3300005535	Unclassified	969
74	Ga0070697_100012640	3300005536	Bacteria	6612
75	Ga0070697_100106605	3300005536	Bacteria	2331
76	Ga0070697_100583274	3300005536	Unclassified	982
77	Ga0070697_100626019	3300005536	Unclassified	947
78	Ga0070697_100868186	3300005536	Unclassified	800
79	Ga0068853_100030534	3300005539	Bacteria	4553
80	Ga0068853_100612882	3300005539	Bacteria	1034
81	Ga0070672_100867873	3300005543	Bacteria	796
82	Ga0070686_100029582	3300005544	Unclassified	3334
83	Ga0070686_101716747	3300005544	Unclassified	533
84	Ga0070695_100043425	3300005545	Bacteria	2858
85	Ga0070695_100339262	3300005545	Unclassified	1122
86	Ga0070696_100000031	3300005546	Bacteria	65548
87	Ga0070696_100016693	3300005546	Unclassified	4951
88	Ga0070696_100025412	3300005546	Unclassified	4026
89	Ga0070696_100099876	3300005546	Unclassified	2078
90	Ga0070696_100107084	3300005546	Bacteria	2010
91	Ga0070696_100186250	3300005546	Unclassified	1542
92	Ga0070696_100235944	3300005546	Bacteria	1378
93	Ga0070696_100306296	3300005546	Bacteria	1218
94	Ga0070696_101729460	3300005546	Unclassified	539
95	Ga0070693_100026974	3300005547	Bacteria	3106
96	Ga0070693_100065666	3300005547	Bacteria	2121
97	Ga0070693_100129446	3300005547	Unclassified	1576
98	Ga0070665_100122484	3300005548	Unclassified	2602
99	Ga0070665_101494800	3300005548	Unclassified	684
100	Ga0070704_100312915	3300005549	Unclassified	1313
101	Ga0070704_100315875	3300005549	Bacteria	1307
102	Ga0070704_100328019	3300005549	Unclassified	1285
103	Ga0070704_100330220	3300005549	Bacteria	1281
104	Ga0070704_100358700	3300005549	Unclassified	1233
105	Ga0070704_101256048	3300005549	Unclassified	677
106	Ga0068855_100370018	3300005563	Bacteria	1576
107	Ga0068855_100375493	3300005563	Bacteria	1562
108	Ga0068855_100615594	3300005563	Bacteria	1170
109	Ga0068855_101382027	3300005563	Unclassified	726
110	Ga0070664_100006821	3300005564	Bacteria	9209
111	Ga0070664_100244014	3300005564	Bacteria	1613
112	Ga0070664_100575624	3300005564	Unclassified	1043
113	Ga0068857_100000472	3300005577	Bacteria	28705
114	Ga0068857_100027292	3300005577	Bacteria	5036
115	Ga0068857_100188702	3300005577	Bacteria	1877
116	Ga0068857_100418429	3300005577	Bacteria	1249
117	Ga0068854_100405019	3300005578	Bacteria	1130
118	Ga0068854_100454231	3300005578	Unclassified	1071
119	Ga0068854_100623242	3300005578	Unclassified	923
120	Ga0068854_101265863	3300005578	Unclassified	663
121	Ga0068856_100020827	3300005614	Bacteria	6373
122	Ga0070702_100399687	3300005615	Bacteria	982
123	Ga0070702_101265039	3300005615	Unclassified	598
124	Ga0068852_100485533	3300005616	Bacteria	1228
125	Ga0068859_100013821	3300005617	Bacteria	8096
126	Ga0068859_100063666	3300005617	Bacteria	3719
127	Ga0068859_100073222	3300005617	Bacteria	3464
128	Ga0068859_100595320	3300005617	Bacteria	1199
129	Ga0068859_101569339	3300005617	Unclassified	727
130	Ga0068864_100009298	3300005618	Bacteria	8105
131	Ga0068864_100035583	3300005618	Bacteria	4240
132	Ga0068864_100037821	3300005618	Unclassified	4120
133	Ga0068864_100286187	3300005618	Bacteria	1540
134	Ga0068864_100694115	3300005618	Bacteria	994
135	Ga0068864_100985013	3300005618	Bacteria	836
136	Ga0068861_100037448	3300005719	Bacteria	3606
137	Ga0068861_100424555	3300005719	Unclassified	1185
138	Ga0068861_100698026	3300005719	Bacteria	943
139	Ga0068851_10186478	3300005834	Unclassified	1151
140	Ga0068870_10177354	3300005840	Bacteria	1276
141	Ga0068870_10524311	3300005840	Bacteria	793
142	Ga0068870_10562177	3300005840	Unclassified	770
143	Ga0068863_100170927	3300005841	Unclassified	2085
144	Ga0068863_100507370	3300005841	Bacteria	1188
145	Ga0068863_100672106	3300005841	Bacteria	1028
146	Ga0068863_100845800	3300005841	Bacteria	914
147	Ga0068858_100014643	3300005842	Bacteria	7386
148	Ga0068858_100040155	3300005842	Bacteria	4338
149	Ga0068858_100148544	3300005842	Bacteria	2202
150	Ga0068858_100872912	3300005842	Unclassified	879
151	Ga0068860_100061762	3300005843	Unclassified	3560
152	Ga0068860_100124273	3300005843	Bacteria	2473
153	Ga0068860_100733471	3300005843	Bacteria	999
154	Ga0068862_100019271	3300005844	Bacteria	5692
155	Ga0068862_100135963	3300005844	Bacteria	2178
156	Ga0068862_100145525	3300005844	Bacteria	2106
157	Ga0068862_100198874	3300005844	Bacteria	1806
158	Ga0068862_101088224	3300005844	Bacteria	794
159	Ga0068862_101840175	3300005844	Unclassified	615
160	Ga0081455_10420490	3300005937	Unclassified	922
161	Ga0070716_100265949	3300006173	Bacteria	1176
162	Ga0097621_100140871	3300006237	Bacteria	2060
163	Ga0097621_100350028	3300006237	Bacteria	1314
164	Ga0068871_100009839	3300006358	Bacteria	6941
165	Ga0075433_10005218	3300006852	Bacteria	10175
166	Ga0075433_10147118	3300006852	Bacteria	2094
167	Ga0075434_100024494	3300006871	Bacteria	5900
168	Ga0075434_100083951	3300006871	Bacteria	3183
169	Ga0075434_100109645	3300006871	Bacteria	2771
170	Ga0075434_100412137	3300006871	Bacteria	1372
171	Ga0068865_100157111	3300006881	Bacteria	1731
172	Ga0075436_100133758	3300006914	Bacteria	1740
173	Ga0097620_100013821	3300006931	Bacteria	8096
174	Ga0097620_100063659	3300006931	Bacteria	3719
175	Ga0097620_100073225	3300006931	Bacteria	3464
176	Ga0097620_100595282	3300006931	Bacteria	1199
177	Ga0097620_101568988	3300006931	Unclassified	727
178	Ga0075435_100146991	3300007076	Bacteria	1980
179	Ga0075435_100323483	3300007076	Unclassified	1320
180	Ga0105240_11321442	3300009093	Unclassified	760
181	Ga0111539_10405045	3300009094	Unclassified	1589
182	Ga0111539_11203128	3300009094	Bacteria	880
183	Ga0105245_10184483	3300009098	Unclassified	1995
184	Ga0105245_10436056	3300009098	Bacteria	1316
185	Ga0105245_10706693	3300009098	Bacteria	1042
186	Ga0114129_12420897	3300009147	Bacteria	629
187	Ga0105243_10042343	3300009148	Bacteria	3565
188	Ga0105243_10098630	3300009148	Bacteria	2421
189	Ga0105243_10289927	3300009148	Bacteria	1478
190	Ga0105241_10490671	3300009174	Unclassified	1093
191	Ga0105248_10104491	3300009177	Bacteria	3193
192	Ga0105248_12239927	3300009177	Unclassified	622
193	Ga0105237_10105530	3300009545	Bacteria	2809
194	Ga0105249_10059365	3300009553	Bacteria	3508
195	Ga0105249_10067968	3300009553	Bacteria	3285
196	Ga0105249_10107976	3300009553	Bacteria	2627
197	Ga0105249_10113520	3300009553	Bacteria	2564
198	Ga0105249_10131439	3300009553	Bacteria	2390
199	Ga0105239_10006935	3300010375	Bacteria	13069
200	Ga0105239_10244853	3300010375	Bacteria	2013
201	Ga0105239_10316128	3300010375	Bacteria	1760
202	Ga0157371_10367560	3300013102	Unclassified	1049
203	Ga0157374_10016331	3300013296	Bacteria	6522
204	Ga0157374_10315244	3300013296	Bacteria	1549
205	Ga0157378_10028635	3300013297	Unclassified	4916
206	Ga0157378_10031219	3300013297	Unclassified	4705
207	Ga0157378_10054219	3300013297	Bacteria	3570
208	Ga0157378_10168800	3300013297	Bacteria	2051
209	Ga0157378_10320397	3300013297	Unclassified	1506
210	Ga0157378_10720234	3300013297	Bacteria	1018
211	Ga0163162_10002793	3300013306	Bacteria	16594
212	Ga0163162_10290173	3300013306	Unclassified	1768
213	Ga0157372_10286046	3300013307	Unclassified	1917
214	Ga0157375_10000152	3300013308	Bacteria	67342
215	Ga0157375_10026079	3300013308	Bacteria	5441
216	Ga0157375_10031901	3300013308	Unclassified	4990
217	Ga0157375_10683640	3300013308	Bacteria	1181
218	Ga0157375_11819534	3300013308	Unclassified	722
219	Ga0157375_12569114	3300013308	Bacteria	608
220	Ga0163163_10009611	3300014325	Bacteria	8643
221	Ga0163163_10078287	3300014325	Bacteria	3302
222	Ga0163163_10344573	3300014325	Bacteria	1546
223	Ga0163163_10465881	3300014325	Bacteria	1324
224	Ga0163163_11178036	3300014325	Unclassified	829
225	Ga0157380_10552628	3300014326	Unclassified	1130
226	Ga0157377_10356595	3300014745	Unclassified	983
227	Ga0157379_10022716	3300014968	Bacteria	5558
228	Ga0157379_10506011	3300014968	Bacteria	1120
229	Ga0157376_10158181	3300014969	Bacteria	2051
230	Ga0157376_10462354	3300014969	Unclassified	1240
231	Ga0182007_10066859	3300015262	Unclassified	1177
232	Ga0182007_10071565	3300015262	Unclassified	1136
233	Ga0182005_1095722	3300015265	Bacteria	829
234	Ga0163161_10001586	3300017792	Bacteria	16768
235	Ga0163161_10251809	3300017792	Unclassified	1377
236	Ga0207647_10213600	3300025904	Bacteria	1113
237	Ga0207647_10335084	3300025904	Unclassified	858
238	Ga0207685_10000002	3300025905	Bacteria	438088
239	Ga0207645_10069135	3300025907	Bacteria	2259
240	Ga0207643_10194419	3300025908	Bacteria	1233
241	Ga0207643_10384238	3300025908	Bacteria	886
242	Ga0207684_10035214	3300025910	Bacteria	4252
243	Ga0207684_10045614	3300025910	Unclassified	3717
244	Ga0207654_10504917	3300025911	Unclassified	854
245	Ga0207707_10000017	3300025912	Bacteria	237068
246	Ga0207707_10015572	3300025912	Bacteria	6624
247	Ga0207671_10179243	3300025914	Bacteria	1648
248	Ga0207660_10000212	3300025917	Bacteria	37348
249	Ga0207660_10076890	3300025917	Bacteria	2442
250	Ga0207662_10023061	3300025918	Bacteria	3573
251	Ga0207662_10116204	3300025918	Bacteria	1673
252	Ga0207657_10119294	3300025919	Unclassified	2171
253	Ga0207652_10000661	3300025921	Bacteria	33806
254	Ga0207646_10005353	3300025922	Bacteria	13520
255	Ga0207646_10548447	3300025922	Unclassified	1040
256	Ga0207646_11224144	3300025922	Unclassified	658
257	Ga0207681_10388196	3300025923	Bacteria	1125
258	Ga0207681_10452438	3300025923	Bacteria	1045
259	Ga0207650_10974640	3300025925	Bacteria	721
260	Ga0207644_10454529	3300025931	Unclassified	1052
261	Ga0207706_10573119	3300025933	Bacteria	971
262	Ga0207706_11606983	3300025933	Unclassified	526
263	Ga0207686_10223516	3300025934	Bacteria	1361
264	Ga0207686_10240635	3300025934	Bacteria	1317
265	Ga0207709_10036096	3300025935	Bacteria	2927
266	Ga0207709_10104003	3300025935	Bacteria	1883
267	Ga0207670_10115549	3300025936	Bacteria	1941
268	Ga0207669_11045184	3300025937	Unclassified	688
269	Ga0207689_10252469	3300025942	Bacteria	1458
270	Ga0207689_10389224	3300025942	Unclassified	1161
271	Ga0207689_10400102	3300025942	Bacteria	1145
272	Ga0207689_10603904	3300025942	Unclassified	923
273	Ga0207689_10818941	3300025942	Unclassified	786
274	Ga0207689_11192360	3300025942	Unclassified	641
275	Ga0207679_10045502	3300025945	Unclassified	3174
276	Ga0207667_10380338	3300025949	Unclassified	1438
277	Ga0207667_10603983	3300025949	Unclassified	1106
278	Ga0207667_10946836	3300025949	Unclassified	851
279	Ga0207651_10421994	3300025960	Bacteria	1139
280	Ga0207712_10004229	3300025961	Bacteria	9057
281	Ga0207712_10015090	3300025961	Bacteria	4978
282	Ga0207712_10078463	3300025961	Unclassified	2396
283	Ga0207712_10091335	3300025961	Bacteria	2243
284	Ga0207668_10183314	3300025972	Unclassified	1653
285	Ga0207668_10444867	3300025972	Bacteria	1105
286	Ga0207640_10339580	3300025981	Unclassified	1202
287	Ga0207677_10611057	3300026023	Bacteria	958
288	Ga0207703_10970591	3300026035	Bacteria	815
289	Ga0207703_10998159	3300026035	Bacteria	803
290	Ga0207703_11111262	3300026035	Bacteria	759
291	Ga0207639_10152970	3300026041	Bacteria	1934
292	Ga0207639_11093878	3300026041	Bacteria	747
293	Ga0207648_10255826	3300026089	Bacteria	1562
294	Ga0207648_10281026	3300026089	Bacteria	1488
295	Ga0207676_10014061	3300026095	Bacteria	5750
296	Ga0207676_10048862	3300026095	Bacteria	3287
297	Ga0207676_10504547	3300026095	Bacteria	1149
298	Ga0207676_10869914	3300026095	Bacteria	882
299	Ga0207676_11124723	3300026095	Unclassified	777
300	Ga0207674_10000068	3300026116	Bacteria	106470
301	Ga0207674_10041737	3300026116	Bacteria	4743
302	Ga0207674_10186792	3300026116	Unclassified	2023
303	Ga0207674_10486153	3300026116	Bacteria	1193
304	Ga0207675_100403428	3300026118	Bacteria	1347
305	Ga0207675_100631725	3300026118	Unclassified	1076
306	Ga0207675_100847152	3300026118	Unclassified	929
307	Ga0268266_11318721	3300028379	Unclassified	697
308	Ga0268265_10077100	3300028380	Bacteria	2617
309	Ga0268265_10142789	3300028380	Bacteria	2007
310	Ga0268265_10370279	3300028380	Unclassified	1315
311	Ga0268264_10030538	3300028381	Bacteria	4417
312	Ga0307408_100046588	3300031548	Bacteria	3102
313	Ga0307408_100110949	3300031548	Bacteria	2107
314	Ga0307408_100795063	3300031548	Bacteria	858
315	Ga0307408_101123718	3300031548	Bacteria	730
316	Ga0307405_10332755	3300031731	Bacteria	1164
317	Ga0307405_10437573	3300031731	Bacteria	1033
318	Ga0307405_10733933	3300031731	Bacteria	821
319	Ga0307413_10030933	3300031824	Plasmid	3013
320	Ga0307413_10081863	3300031824	Bacteria	2071
321	Ga0307413_10270639	3300031824	Bacteria	1272
322	Ga0307410_10001627	3300031852	Bacteria	10322
323	Ga0307410_10030665	3300031852	Bacteria	3439
324	Ga0307406_10012093	3300031901	Bacteria	4912
325	Ga0307406_10032309	3300031901	Bacteria	3195
326	Ga0307406_10173324	3300031901	Bacteria	1563
327	Ga0307406_10282336	3300031901	Bacteria	1267
328	Ga0307407_10094878	3300031903	Bacteria	1838
329	Ga0307407_10124533	3300031903	Bacteria	1639
330	Ga0307407_10435128	3300031903	Unclassified	949
331	Ga0307412_10031441	3300031911	Unclassified	3353
332	Ga0307412_10140060	3300031911	Unclassified	1770
333	Ga0307412_10226316	3300031911	Bacteria	1437
334	Ga0307412_10703032	3300031911	Unclassified	868
335	Ga0307409_100389491	3300031995	Bacteria	1327
336	Ga0307416_100206391	3300032002	Unclassified	1869
337	Ga0307416_100282358	3300032002	Bacteria	1638
338	Ga0307416_100604924	3300032002	Unclassified	1176
339	Ga0307416_101092187	3300032002	Unclassified	902
340	Ga0307416_102435949	3300032002	Unclassified	622
341	Ga0307414_10125456	3300032004	Bacteria	1982
342	Ga0307414_10638008	3300032004	Unclassified	959
343	Ga0307411_10012566	3300032005	Bacteria	4629
344	Ga0307411_10067439	3300032005	Unclassified	2408
345	Ga0307411_10071921	3300032005	Unclassified	2346
346	Ga0307411_10510402	3300032005	Unclassified	1018
347	Ga0307415_100109600	3300032126	Bacteria	2045
348	Ga0307415_100238047	3300032126	Unclassified	1470
349	Ga0307415_100800557	3300032126	Bacteria	860
350	Ga0307415_101100215	3300032126	Unclassified	744
351	Ga0307415_101519828	3300032126	Unclassified	641
352	Ga0395900_0491257	3300037418	Unclassified	1179
353	Ga0395905_0312609	3300037471	Unclassified	1460
354	Ga0395901_0683103	3300038443	Unclassified	1026
355	Ga0242420_003469	3300038996	Bacteria	2329
356	Ga0451576_0602217	3300045051	Bacteria	1155
357	Ga0451576_1289023	3300045051	Unclassified	762
358	Ga0495658_0026336	3300046683	Unclassified	3116
359	Ga0496102_0028551	3300048905	Bacteria	4984
360	Ga0496103_0514270	3300048906	Unclassified	766
361	Ga0496104_0028583	3300048907	Bacteria	5168
362	Ga0496106_0825510	3300048909	Unclassified	735
363	Ga0496108_0088333	3300048911	Unclassified	2634
364	Ga0496112_0492764	3300048915	Bacteria	1161
365	Ga0496112_0631760	3300048915	Bacteria	1001
366	Ga0501290_005144	3300049513	Unclassified	1634
367	Ga0501292_002817	3300049515	Unclassified	2273
368	Ga0501292_032567	3300049515	Unclassified	880
369	Ga0501297_003965	3300049520	Bacteria	1497
370	Ga0501298_006255	3300049521	Unclassified	1943
371	Ga0501300_053196	3300049523	Bacteria	628
372	Ga0501303_006533	3300049526	Bacteria	1020
373	Ga0501198_016275	3300049649	Unclassified	1149
374	Ga0501199_019046	3300049650	Bacteria	787
375	Ga0501201_008193	3300049651	Unclassified	1007
376	Ga0501202_002779	3300049652	Unclassified	2963
377	Ga0501206_046999	3300049653	Bacteria	678
378	Ga0501216_022504	3300049660	Unclassified	1114
379	Ga0501216_044093	3300049660	Bacteria	861
380	Ga0501217_007143	3300049661	Unclassified	2388
381	Ga0501223_011607	3300049663	Unclassified	1768
382	Ga0501223_060313	3300049663	Bacteria	741
383	Ga0501224_021365	3300049664	Bacteria	965
384	Ga0501227_023388	3300049665	Unclassified	1436
385	Ga0501233_051232	3300049668	Unclassified	1000
386	Ga0501235_010205	3300049669	Bacteria	2053
387	Ga0501239_030813	3300049672	Unclassified	703
388	Ga0501242_013516	3300049674	Bacteria	1003
389	Ga0501242_041570	3300049674	Bacteria	651
390	Ga0501243_006474	3300049675	Unclassified	1775
391	Ga0501243_006821	3300049675	Bacteria	1737
392	Ga0501247_041026	3300049677	Unclassified	661
393	Ga0501249_005990	3300049679	Bacteria	2495
394	Ga0501249_027230	3300049679	Unclassified	1265
395	Ga0501249_055179	3300049679	Unclassified	916
396	Ga0501250_019690	3300049680	Bacteria	864
397	Ga0501250_028952	3300049680	Bacteria	760
398	Ga0501256_020760	3300049685	Bacteria	689
399	Ga0501257_013349	3300049686	Bacteria	1883
400	Ga0501257_035214	3300049686	Bacteria	1217
401	Ga0501261_113541	3300049690	Unclassified	529
402	Ga0501221_024935	3300049704	Bacteria	1204
403	Ga0501225_0028093	3300049705	Bacteria	1547
404	Ga0501234_008936	3300049707	Unclassified	1562
405	Ga0501234_034234	3300049707	Unclassified	824
406	Ga0501245_028770	3300049708	Bacteria	908
407	Ga0501266_052172	3300049763	Bacteria	635
408	Ga0501267_005815	3300049764	Bacteria	1174
409	Ga0501268_019993	3300049765	Bacteria	1137
410	Ga0501271_002977	3300049768	Unclassified	1542
411	Ga0501273_016080	3300049770	Unclassified	977
412	Ga0501279_003967	3300049775	Bacteria	1936
413	Ga0501283_029771	3300049779	Unclassified	911
414	Ga0501212_005790	3300049851	Unclassified	1646
415	Ga0501212_053722	3300049851	Unclassified	686
416	nmdc:mga05p37_2136_c1	3300050507	Bacteria	23082
417	nmdc:mga05p37_610492_c1	3300050507	Bacteria	1229
418	nmdc:mga09592_314222_c1	3300050508	Unclassified	1357
419	nmdc:mga0n895_145421_c1	3300050512	Bacteria	2400
420	nmdc:mga0n895_285972_c1	3300050512	Unclassified	1672
421	nmdc:mga0n895_296674_c1	3300050512	Bacteria	1639
422	nmdc:mga0n895_405618_c1	3300050512	Bacteria	1378
423	nmdc:mga0rr50_222820_c1	3300050513	Bacteria	1558
424	nmdc:mga0rr50_317750_c1	3300050513	Unclassified	1305
425	nmdc:mga0rr50_348518_c1	3300050513	Unclassified	1245
426	nmdc:mga08x19_858853_c1	3300050514	Unclassified	645
427	nmdc:mga0a205_402439_c1	3300050515	Bacteria	1233
428	nmdc:mga0a205_80980_c1	3300050515	Bacteria	3137

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300005334	Ga0068869_100009918	Ga0068869_1000099184	149
2	3300005338	Ga0068868_101256220	Ga0068868_1012562201	149
3	3300005340	Ga0070689_100083380	Ga0070689_1000833802	149
4	3300005354	Ga0070675_100538470	Ga0070675_1005384701	149
5	3300005355	Ga0070671_100050715	Ga0070671_1000507152	149
6	3300005367	Ga0070667_100277510	Ga0070667_1002775102	149
7	3300005547	Ga0070693_100065666	Ga0070693_1000656662	149
8	3300005548	Ga0070665_100122484	Ga0070665_1001224843	149
9	3300005578	Ga0068854_100623242	Ga0068854_1006232422	149
10	3300005615	Ga0070702_100399687	Ga0070702_1003996872	149
11	3300005616	Ga0068852_100485533	Ga0068852_1004855331	149
12	3300005617	Ga0068859_100013821	Ga0068859_1000138215	149
13	3300005618	Ga0068864_100009298	Ga0068864_10000929811	149
14	3300005834	Ga0068851_10186478	Ga0068851_101864782	149
15	3300005841	Ga0068863_100507370	Ga0068863_1005073702	149
16	3300005843	Ga0068860_100124273	Ga0068860_1001242732	149
17	3300006237	Ga0097621_100140871	Ga0097621_1001408711	149
18	3300006358	Ga0068871_100009839	Ga0068871_1000098395	149
19	3300006931	Ga0097620_100013821	Ga0097620_1000138215	149
20	3300013297	Ga0157378_10028635	Ga0157378_100286352	149
21	3300013308	Ga0157375_10031901	Ga0157375_100319012	149
22	3300005347	Ga0070668_100027332	Ga0070668_1000273322	150
23	3300005468	Ga0070707_100808449	Ga0070707_1008084491	150
24	3300017792	Ga0163161_10001586	Ga0163161_100015862	150
25	3300025922	Ga0207646_10548447	Ga0207646_105484472	150
26	3300025972	Ga0207668_10183314	Ga0207668_101833141	150
27	3300005289	Ga0065704_10222460	Ga0065704_102224602	151
28	3300005290	Ga0065712_10338536	Ga0065712_103385361	151
29	3300005293	Ga0065715_10338422	Ga0065715_103384221	151
30	3300005293	Ga0065715_10462021	Ga0065715_104620212	151
31	3300005293	Ga0065715_10987588	Ga0065715_109875881	151
32	3300005295	Ga0065707_10220112	Ga0065707_102201121	151
33	3300005328	Ga0070676_10637257	Ga0070676_106372571	151
34	3300005330	Ga0070690_100347678	Ga0070690_1003476781	151
35	3300005330	Ga0070690_100473586	Ga0070690_1004735861	151
36	3300005334	Ga0068869_100176803	Ga0068869_1001768033	151
37	3300005334	Ga0068869_100668346	Ga0068869_1006683461	151
38	3300005335	Ga0070666_10660039	Ga0070666_106600392	151
39	3300005336	Ga0070680_100013594	Ga0070680_1000135945	151
40	3300005338	Ga0068868_100029394	Ga0068868_1000293947	151
41	3300005338	Ga0068868_101022779	Ga0068868_1010227792	151
42	3300005343	Ga0070687_100435263	Ga0070687_1004352632	151
43	3300005345	Ga0070692_10142691	Ga0070692_101426912	151
44	3300005347	Ga0070668_100617429	Ga0070668_1006174291	151
45	3300005353	Ga0070669_100851677	Ga0070669_1008516771	151
46	3300005353	Ga0070669_101863033	Ga0070669_1018630331	151
47	3300005354	Ga0070675_100540662	Ga0070675_1005406622	151
48	3300005354	Ga0070675_101084472	Ga0070675_1010844721	151
49	3300005355	Ga0070671_100000791	Ga0070671_10000079112	151
50	3300005364	Ga0070673_100009622	Ga0070673_1000096226	151
51	3300005364	Ga0070673_100044781	Ga0070673_1000447812	151
52	3300005364	Ga0070673_100207525	Ga0070673_1002075253	151
53	3300005364	Ga0070673_101543002	Ga0070673_1015430021	151
54	3300005365	Ga0070688_100230553	Ga0070688_1002305533	151
55	3300005365	Ga0070688_101119585	Ga0070688_1011195851	151
56	3300005367	Ga0070667_100624393	Ga0070667_1006243932	151
57	3300005440	Ga0070705_100061819	Ga0070705_1000618192	151
58	3300005440	Ga0070705_100517692	Ga0070705_1005176922	151
59	3300005440	Ga0070705_101435301	Ga0070705_1014353011	151
60	3300005444	Ga0070694_100112848	Ga0070694_1001128483	151
61	3300005444	Ga0070694_100297560	Ga0070694_1002975602	151
62	3300005457	Ga0070662_101071266	Ga0070662_1010712661	151
63	3300005457	Ga0070662_101858490	Ga0070662_1018584901	151
64	3300005458	Ga0070681_10009220	Ga0070681_100092206	151
65	3300005466	Ga0070685_10307131	Ga0070685_103071311	151
66	3300005467	Ga0070706_101590283	Ga0070706_1015902831	151
67	3300005468	Ga0070707_101744553	Ga0070707_1017445531	151
68	3300005471	Ga0070698_101745221	Ga0070698_1017452211	151
69	3300005518	Ga0070699_100000061	Ga0070699_10000006137	151
70	3300005530	Ga0070679_100000175	Ga0070679_10000017523	151
71	3300005535	Ga0070684_100666471	Ga0070684_1006664712	151
72	3300005536	Ga0070697_100583274	Ga0070697_1005832742	151
73	3300005536	Ga0070697_100626019	Ga0070697_1006260191	151
74	3300005539	Ga0068853_100030534	Ga0068853_1000305343	151
75	3300005539	Ga0068853_100612882	Ga0068853_1006128822	151
76	3300005544	Ga0070686_101716747	Ga0070686_1017167471	151
77	3300005545	Ga0070695_100043425	Ga0070695_1000434252	151
78	3300005545	Ga0070695_100339262	Ga0070695_1003392622	151
79	3300005546	Ga0070696_100000031	Ga0070696_10000003117	151
80	3300005546	Ga0070696_100016693	Ga0070696_1000166932	151
81	3300005546	Ga0070696_100099876	Ga0070696_1000998762	151
82	3300005546	Ga0070696_100186250	Ga0070696_1001862502	151
83	3300005546	Ga0070696_100306296	Ga0070696_1003062961	151
84	3300005547	Ga0070693_100026974	Ga0070693_1000269741	151
85	3300005547	Ga0070693_100129446	Ga0070693_1001294463	151
86	3300005548	Ga0070665_101494800	Ga0070665_1014948001	151
87	3300005549	Ga0070704_100328019	Ga0070704_1003280192	151
88	3300005549	Ga0070704_100330220	Ga0070704_1003302201	151
89	3300005549	Ga0070704_101256048	Ga0070704_1012560481	151
90	3300005563	Ga0068855_100370018	Ga0068855_1003700181	151
91	3300005563	Ga0068855_100375493	Ga0068855_1003754932	151
92	3300005563	Ga0068855_100615594	Ga0068855_1006155942	151
93	3300005563	Ga0068855_101382027	Ga0068855_1013820271	151
94	3300005564	Ga0070664_100006821	Ga0070664_1000068214	151
95	3300005564	Ga0070664_100244014	Ga0070664_1002440141	151
96	3300005564	Ga0070664_100575624	Ga0070664_1005756242	151
97	3300005577	Ga0068857_100000472	Ga0068857_10000047211	151
98	3300005577	Ga0068857_100188702	Ga0068857_1001887022	151
99	3300005577	Ga0068857_100418429	Ga0068857_1004184293	151
100	3300005578	Ga0068854_100405019	Ga0068854_1004050192	151
101	3300005578	Ga0068854_100454231	Ga0068854_1004542312	151
102	3300005578	Ga0068854_101265863	Ga0068854_1012658631	151
103	3300005614	Ga0068856_100020827	Ga0068856_1000208272	151
104	3300005615	Ga0070702_101265039	Ga0070702_1012650391	151
105	3300005617	Ga0068859_100063666	Ga0068859_1000636666	151
106	3300005617	Ga0068859_100073222	Ga0068859_1000732227	151
107	3300005617	Ga0068859_100595320	Ga0068859_1005953202	151
108	3300005617	Ga0068859_101569339	Ga0068859_1015693392	151
109	3300005618	Ga0068864_100035583	Ga0068864_1000355833	151
110	3300005618	Ga0068864_100037821	Ga0068864_1000378213	151
111	3300005618	Ga0068864_100286187	Ga0068864_1002861872	151
112	3300005618	Ga0068864_100694115	Ga0068864_1006941152	151
113	3300005618	Ga0068864_100985013	Ga0068864_1009850132	151
114	3300005719	Ga0068861_100037448	Ga0068861_1000374486	151
115	3300005719	Ga0068861_100698026	Ga0068861_1006980261	151
116	3300005840	Ga0068870_10562177	Ga0068870_105621771	151
117	3300005841	Ga0068863_100170927	Ga0068863_1001709272	151
118	3300005841	Ga0068863_100672106	Ga0068863_1006721061	151
119	3300005841	Ga0068863_100845800	Ga0068863_1008458002	151
120	3300005842	Ga0068858_100014643	Ga0068858_1000146434	151
121	3300005842	Ga0068858_100040155	Ga0068858_1000401553	151
122	3300005842	Ga0068858_100148544	Ga0068858_1001485442	151
123	3300005842	Ga0068858_100872912	Ga0068858_1008729121	151
124	3300005843	Ga0068860_100061762	Ga0068860_1000617624	151
125	3300005843	Ga0068860_100733471	Ga0068860_1007334712	151
126	3300005844	Ga0068862_100019271	Ga0068862_1000192713	151
127	3300005844	Ga0068862_100145525	Ga0068862_1001455252	151
128	3300005844	Ga0068862_100198874	Ga0068862_1001988741	151
129	3300005844	Ga0068862_101088224	Ga0068862_1010882242	151
130	3300005937	Ga0081455_10420490	Ga0081455_104204901	151
131	3300006237	Ga0097621_100350028	Ga0097621_1003500283	151
132	3300006852	Ga0075433_10005218	Ga0075433_100052185	151
133	3300006852	Ga0075433_10147118	Ga0075433_101471183	151
134	3300006871	Ga0075434_100024494	Ga0075434_1000244945	151
135	3300006871	Ga0075434_100083951	Ga0075434_1000839514	151
136	3300006871	Ga0075434_100109645	Ga0075434_1001096453	151
137	3300006871	Ga0075434_100412137	Ga0075434_1004121373	151
138	3300006881	Ga0068865_100157111	Ga0068865_1001571113	151
139	3300006931	Ga0097620_100063659	Ga0097620_1000636592	151
140	3300006931	Ga0097620_100073225	Ga0097620_1000732257	151
141	3300006931	Ga0097620_100595282	Ga0097620_1005952822	151
142	3300006931	Ga0097620_101568988	Ga0097620_1015689882	151
143	3300007076	Ga0075435_100146991	Ga0075435_1001469913	151
144	3300007076	Ga0075435_100323483	Ga0075435_1003234831	151
145	3300009093	Ga0105240_11321442	Ga0105240_113214421	151
146	3300009094	Ga0111539_10405045	Ga0111539_104050454	151
147	3300009098	Ga0105245_10184483	Ga0105245_101844832	151
148	3300009098	Ga0105245_10436056	Ga0105245_104360563	151
149	3300009098	Ga0105245_10706693	Ga0105245_107066931	151
150	3300009147	Ga0114129_12420897	Ga0114129_124208971	151
151	3300009148	Ga0105243_10098630	Ga0105243_100986302	151
152	3300009148	Ga0105243_10289927	Ga0105243_102899272	151
153	3300009177	Ga0105248_10104491	Ga0105248_101044914	151
154	3300009177	Ga0105248_12239927	Ga0105248_122399271	151
155	3300009545	Ga0105237_10105530	Ga0105237_101055302	151
156	3300009553	Ga0105249_10059365	Ga0105249_100593652	151
157	3300009553	Ga0105249_10067968	Ga0105249_100679682	151
158	3300009553	Ga0105249_10113520	Ga0105249_101135202	151
159	3300009553	Ga0105249_10131439	Ga0105249_101314392	151
160	3300010375	Ga0105239_10006935	Ga0105239_100069355	151
161	3300010375	Ga0105239_10244853	Ga0105239_102448531	151
162	3300010375	Ga0105239_10316128	Ga0105239_103161282	151
163	3300013102	Ga0157371_10367560	Ga0157371_103675602	151
164	3300013296	Ga0157374_10016331	Ga0157374_100163313	151
165	3300013296	Ga0157374_10315244	Ga0157374_103152441	151
166	3300013297	Ga0157378_10054219	Ga0157378_100542194	151
167	3300013297	Ga0157378_10168800	Ga0157378_101688003	151
168	3300013297	Ga0157378_10320397	Ga0157378_103203972	151
169	3300013297	Ga0157378_10720234	Ga0157378_107202342	151
170	3300013306	Ga0163162_10002793	Ga0163162_100027932	151
171	3300013306	Ga0163162_10290173	Ga0163162_102901731	151
172	3300013307	Ga0157372_10286046	Ga0157372_102860462	151
173	3300013308	Ga0157375_10000152	Ga0157375_1000015212	151
174	3300013308	Ga0157375_10026079	Ga0157375_100260793	151
175	3300013308	Ga0157375_10683640	Ga0157375_106836401	151
176	3300013308	Ga0157375_11819534	Ga0157375_118195341	151
177	3300014325	Ga0163163_10009611	Ga0163163_100096118	151
178	3300014325	Ga0163163_10078287	Ga0163163_100782871	151
179	3300014325	Ga0163163_10344573	Ga0163163_103445731	151
180	3300014325	Ga0163163_10465881	Ga0163163_104658812	151
181	3300014325	Ga0163163_11178036	Ga0163163_111780361	151
182	3300014745	Ga0157377_10356595	Ga0157377_103565952	151
183	3300014968	Ga0157379_10022716	Ga0157379_100227165	151
184	3300014968	Ga0157379_10506011	Ga0157379_105060112	151
185	3300014969	Ga0157376_10158181	Ga0157376_101581813	151
186	3300014969	Ga0157376_10462354	Ga0157376_104623541	151
187	3300015262	Ga0182007_10066859	Ga0182007_100668591	151
188	3300015262	Ga0182007_10071565	Ga0182007_100715651	151
189	3300015265	Ga0182005_1095722	Ga0182005_10957221	151
190	3300025904	Ga0207647_10213600	Ga0207647_102136001	151
191	3300025904	Ga0207647_10335084	Ga0207647_103350842	151
192	3300025907	Ga0207645_10069135	Ga0207645_100691352	151
193	3300025908	Ga0207643_10384238	Ga0207643_103842382	151
194	3300025912	Ga0207707_10000017	Ga0207707_1000001716	151
195	3300025912	Ga0207707_10015572	Ga0207707_100155722	151
196	3300025914	Ga0207671_10179243	Ga0207671_101792432	151
197	3300025917	Ga0207660_10000212	Ga0207660_1000021222	151
198	3300025917	Ga0207660_10076890	Ga0207660_100768902	151
199	3300025918	Ga0207662_10116204	Ga0207662_101162043	151
200	3300025919	Ga0207657_10119294	Ga0207657_101192941	151
201	3300025921	Ga0207652_10000661	Ga0207652_100006613	151
202	3300025922	Ga0207646_11224144	Ga0207646_112241441	151
203	3300025923	Ga0207681_10388196	Ga0207681_103881962	151
204	3300025923	Ga0207681_10452438	Ga0207681_104524382	151
205	3300025931	Ga0207644_10454529	Ga0207644_104545291	151
206	3300025933	Ga0207706_10573119	Ga0207706_105731191	151
207	3300025933	Ga0207706_11606983	Ga0207706_116069831	151
208	3300025934	Ga0207686_10240635	Ga0207686_102406352	151
209	3300025935	Ga0207709_10104003	Ga0207709_101040031	151
210	3300025936	Ga0207670_10115549	Ga0207670_101155493	151
211	3300025937	Ga0207669_11045184	Ga0207669_110451842	151
212	3300025942	Ga0207689_10252469	Ga0207689_102524691	151
213	3300025942	Ga0207689_10389224	Ga0207689_103892242	151
214	3300025942	Ga0207689_10400102	Ga0207689_104001022	151
215	3300025942	Ga0207689_10603904	Ga0207689_106039041	151
216	3300025942	Ga0207689_11192360	Ga0207689_111923602	151
217	3300025945	Ga0207679_10045502	Ga0207679_100455021	151
218	3300025949	Ga0207667_10380338	Ga0207667_103803382	151
219	3300025949	Ga0207667_10603983	Ga0207667_106039831	151
220	3300025949	Ga0207667_10946836	Ga0207667_109468361	151
221	3300025960	Ga0207651_10421994	Ga0207651_104219942	151
222	3300025961	Ga0207712_10004229	Ga0207712_100042298	151
223	3300025961	Ga0207712_10015090	Ga0207712_100150901	151
224	3300025961	Ga0207712_10078463	Ga0207712_100784634	151
225	3300025961	Ga0207712_10091335	Ga0207712_100913352	151
226	3300025972	Ga0207668_10444867	Ga0207668_104448672	151
227	3300025981	Ga0207640_10339580	Ga0207640_103395801	151
228	3300026023	Ga0207677_10611057	Ga0207677_106110571	151
229	3300026035	Ga0207703_10970591	Ga0207703_109705912	151
230	3300026035	Ga0207703_10998159	Ga0207703_109981592	151
231	3300026035	Ga0207703_11111262	Ga0207703_111112622	151
232	3300026041	Ga0207639_10152970	Ga0207639_101529701	151
233	3300026041	Ga0207639_11093878	Ga0207639_110938782	151
234	3300026089	Ga0207648_10255826	Ga0207648_102558262	151
235	3300026095	Ga0207676_10014061	Ga0207676_100140611	151
236	3300026095	Ga0207676_10048862	Ga0207676_100488622	151
237	3300026095	Ga0207676_10504547	Ga0207676_105045472	151
238	3300026095	Ga0207676_10869914	Ga0207676_108699142	151
239	3300026095	Ga0207676_11124723	Ga0207676_111247231	151
240	3300026116	Ga0207674_10000068	Ga0207674_1000006843	151
241	3300026116	Ga0207674_10186792	Ga0207674_101867923	151
242	3300026116	Ga0207674_10486153	Ga0207674_104861533	151
243	3300026118	Ga0207675_100403428	Ga0207675_1004034281	151
244	3300026118	Ga0207675_100631725	Ga0207675_1006317251	151
245	3300028379	Ga0268266_11318721	Ga0268266_113187211	151
246	3300028380	Ga0268265_10077100	Ga0268265_100771003	151
247	3300028380	Ga0268265_10370279	Ga0268265_103702792	151
248	3300028381	Ga0268264_10030538	Ga0268264_100305385	151
249	3300031548	Ga0307408_100046588	Ga0307408_1000465884	151
250	3300031548	Ga0307408_100110949	Ga0307408_1001109492	151
251	3300031548	Ga0307408_100795063	Ga0307408_1007950631	151
252	3300031548	Ga0307408_101123718	Ga0307408_1011237181	151
253	3300031731	Ga0307405_10332755	Ga0307405_103327552	151
254	3300031731	Ga0307405_10437573	Ga0307405_104375731	151
255	3300031731	Ga0307405_10733933	Ga0307405_107339333	151
256	3300031824	Ga0307413_10030933	Ga0307413_100309332	151
257	3300031824	Ga0307413_10081863	Ga0307413_100818632	151
258	3300031824	Ga0307413_10270639	Ga0307413_102706391	151
259	3300031852	Ga0307410_10001627	Ga0307410_100016277	151
260	3300031852	Ga0307410_10030665	Ga0307410_100306655	151
261	3300031901	Ga0307406_10012093	Ga0307406_100120934	151
262	3300031901	Ga0307406_10032309	Ga0307406_100323092	151
263	3300031901	Ga0307406_10173324	Ga0307406_101733242	151
264	3300031901	Ga0307406_10282336	Ga0307406_102823362	151
265	3300031903	Ga0307407_10094878	Ga0307407_100948782	151
266	3300031903	Ga0307407_10124533	Ga0307407_101245332	151
267	3300031903	Ga0307407_10435128	Ga0307407_104351282	151
268	3300031911	Ga0307412_10031441	Ga0307412_100314412	151
269	3300031911	Ga0307412_10140060	Ga0307412_101400602	151
270	3300031911	Ga0307412_10226316	Ga0307412_102263162	151
271	3300031911	Ga0307412_10703032	Ga0307412_107030322	151
272	3300031995	Ga0307409_100389491	Ga0307409_1003894912	151
273	3300032002	Ga0307416_100206391	Ga0307416_1002063911	151
274	3300032002	Ga0307416_100282358	Ga0307416_1002823582	151
275	3300032002	Ga0307416_100604924	Ga0307416_1006049242	151
276	3300032002	Ga0307416_101092187	Ga0307416_1010921871	151
277	3300032002	Ga0307416_102435949	Ga0307416_1024359491	151
278	3300032004	Ga0307414_10125456	Ga0307414_101254562	151
279	3300032004	Ga0307414_10638008	Ga0307414_106380081	151
280	3300032005	Ga0307411_10012566	Ga0307411_100125663	151
281	3300032005	Ga0307411_10067439	Ga0307411_100674391	151
282	3300032005	Ga0307411_10071921	Ga0307411_100719213	151
283	3300032005	Ga0307411_10510402	Ga0307411_105104021	151
284	3300032126	Ga0307415_100109600	Ga0307415_1001096004	151
285	3300032126	Ga0307415_100238047	Ga0307415_1002380471	151
286	3300032126	Ga0307415_100800557	Ga0307415_1008005571	151
287	3300032126	Ga0307415_101100215	Ga0307415_1011002151	151
288	3300032126	Ga0307415_101519828	Ga0307415_1015198281	151
289	3300037418	Ga0395900_0491257	Ga0395900_0491257_52_507	151
290	3300037471	Ga0395905_0312609	Ga0395905_0312609_434_889	151
291	3300038443	Ga0395901_0683103	Ga0395901_0683103_112_567	151
292	3300038996	Ga0242420_003469	Ga0242420_003469_401_856	151
293	3300045051	Ga0451576_1289023	Ga0451576_1289023_133_588	151
294	3300046683	Ga0495658_0026336	Ga0495658_0026336_869_1324	151
295	3300048905	Ga0496102_0028551	Ga0496102_0028551_1082_1537	151
296	3300048906	Ga0496103_0514270	Ga0496103_0514270_252_707	151
297	3300048907	Ga0496104_0028583	Ga0496104_0028583_166_621	151
298	3300048909	Ga0496106_0825510	Ga0496106_0825510_157_669	151
299	3300048911	Ga0496108_0088333	Ga0496108_0088333_1930_2385	151
300	3300048915	Ga0496112_0492764	Ga0496112_0492764_560_1015	151
301	3300048915	Ga0496112_0631760	Ga0496112_0631760_55_510	151
302	3300049513	Ga0501290_005144	Ga0501290_005144_483_938	151
303	3300049515	Ga0501292_002817	Ga0501292_002817_1139_1594	151
304	3300049515	Ga0501292_032567	Ga0501292_032567_409_864	151
305	3300049520	Ga0501297_003965	Ga0501297_003965_862_1317	151
306	3300049521	Ga0501298_006255	Ga0501298_006255_1327_1782	151
307	3300049523	Ga0501300_053196	Ga0501300_053196_129_584	151
308	3300049526	Ga0501303_006533	Ga0501303_006533_162_617	151
309	3300049649	Ga0501198_016275	Ga0501198_016275_277_732	151
310	3300049650	Ga0501199_019046	Ga0501199_019046_287_742	151
311	3300049651	Ga0501201_008193	Ga0501201_008193_405_860	151
312	3300049652	Ga0501202_002779	Ga0501202_002779_343_798	151
313	3300049653	Ga0501206_046999	Ga0501206_046999_184_639	151
314	3300049660	Ga0501216_022504	Ga0501216_022504_572_1027	151
315	3300049660	Ga0501216_044093	Ga0501216_044093_276_734	151
316	3300049661	Ga0501217_007143	Ga0501217_007143_509_964	151
317	3300049663	Ga0501223_011607	Ga0501223_011607_578_1033	151
318	3300049663	Ga0501223_060313	Ga0501223_060313_211_669	151
319	3300049664	Ga0501224_021365	Ga0501224_021365_365_820	151
320	3300049665	Ga0501227_023388	Ga0501227_023388_617_1072	151
321	3300049668	Ga0501233_051232	Ga0501233_051232_141_599	151
322	3300049669	Ga0501235_010205	Ga0501235_010205_864_1322	151
323	3300049672	Ga0501239_030813	Ga0501239_030813_28_486	151
324	3300049674	Ga0501242_013516	Ga0501242_013516_123_581	151
325	3300049674	Ga0501242_041570	Ga0501242_041570_147_602	151
326	3300049675	Ga0501243_006474	Ga0501243_006474_1081_1536	151
327	3300049675	Ga0501243_006821	Ga0501243_006821_806_1264	151
328	3300049677	Ga0501247_041026	Ga0501247_041026_52_510	151
329	3300049679	Ga0501249_005990	Ga0501249_005990_264_722	151
330	3300049679	Ga0501249_027230	Ga0501249_027230_60_515	151
331	3300049679	Ga0501249_055179	Ga0501249_055179_228_683	151
332	3300049680	Ga0501250_019690	Ga0501250_019690_63_521	151
333	3300049680	Ga0501250_028952	Ga0501250_028952_180_635	151
334	3300049685	Ga0501256_020760	Ga0501256_020760_60_515	151
335	3300049686	Ga0501257_013349	Ga0501257_013349_1350_1805	151
336	3300049686	Ga0501257_035214	Ga0501257_035214_307_765	151
337	3300049690	Ga0501261_113541	Ga0501261_113541_59_517	151
338	3300049704	Ga0501221_024935	Ga0501221_024935_394_852	151
339	3300049705	Ga0501225_0028093	Ga0501225_0028093_835_1293	151
340	3300049707	Ga0501234_008936	Ga0501234_008936_858_1313	151
341	3300049707	Ga0501234_034234	Ga0501234_034234_272_727	151
342	3300049708	Ga0501245_028770	Ga0501245_028770_313_768	151
343	3300049763	Ga0501266_052172	Ga0501266_052172_118_573	151
344	3300049764	Ga0501267_005815	Ga0501267_005815_442_900	151
345	3300049765	Ga0501268_019993	Ga0501268_019993_633_1091	151
346	3300049768	Ga0501271_002977	Ga0501271_002977_877_1332	151
347	3300049770	Ga0501273_016080	Ga0501273_016080_372_827	151
348	3300049775	Ga0501279_003967	Ga0501279_003967_788_1243	151
349	3300049779	Ga0501283_029771	Ga0501283_029771_410_865	151
350	3300049851	Ga0501212_005790	Ga0501212_005790_336_791	151
351	3300049851	Ga0501212_053722	Ga0501212_053722_148_603	151
352	3300050507	nmdc:mga05p37_610492_c1	nmdc:mga05p37_610492_c1_383_838	151
353	3300050508	nmdc:mga09592_314222_c1	nmdc:mga09592_314222_c1_401_856	151
354	3300050512	nmdc:mga0n895_145421_c1	nmdc:mga0n895_145421_c1_1708_2169	151
355	3300050512	nmdc:mga0n895_285972_c1	nmdc:mga0n895_285972_c1_940_1395	151
356	3300050512	nmdc:mga0n895_296674_c1	nmdc:mga0n895_296674_c1_987_1442	151
357	3300050512	nmdc:mga0n895_405618_c1	nmdc:mga0n895_405618_c1_850_1305	151
358	3300050513	nmdc:mga0rr50_222820_c1	nmdc:mga0rr50_222820_c1_154_615	151
359	3300050513	nmdc:mga0rr50_317750_c1	nmdc:mga0rr50_317750_c1_61_516	151
360	3300050513	nmdc:mga0rr50_348518_c1	nmdc:mga0rr50_348518_c1_304_759	151
361	3300050515	nmdc:mga0a205_402439_c1	nmdc:mga0a205_402439_c1_32_493	151
362	3300050515	nmdc:mga0a205_80980_c1	nmdc:mga0a205_80980_c1_1367_1822	151
363	3300005289	Ga0065704_10089556	Ga0065704_100895562	152
364	3300005330	Ga0070690_100488039	Ga0070690_1004880391	152
365	3300005331	Ga0070670_101200249	Ga0070670_1012002491	152
366	3300005343	Ga0070687_100037358	Ga0070687_1000373581	152
367	3300005440	Ga0070705_100897574	Ga0070705_1008975741	152
368	3300005444	Ga0070694_100255161	Ga0070694_1002551611	152
369	3300005445	Ga0070708_100814886	Ga0070708_1008148861	152
370	3300005467	Ga0070706_100063057	Ga0070706_1000630572	152
371	3300005467	Ga0070706_100205536	Ga0070706_1002055362	152
372	3300005468	Ga0070707_100046468	Ga0070707_1000464682	152
373	3300005518	Ga0070699_100569759	Ga0070699_1005697592	152
374	3300005536	Ga0070697_100012640	Ga0070697_1000126404	152
375	3300005536	Ga0070697_100106605	Ga0070697_1001066052	152
376	3300005536	Ga0070697_100868186	Ga0070697_1008681862	152
377	3300005543	Ga0070672_100867873	Ga0070672_1008678732	152
378	3300005544	Ga0070686_100029582	Ga0070686_1000295822	152
379	3300005546	Ga0070696_100025412	Ga0070696_1000254123	152
380	3300005546	Ga0070696_100107084	Ga0070696_1001070841	152
381	3300005546	Ga0070696_100235944	Ga0070696_1002359442	152
382	3300005549	Ga0070704_100312915	Ga0070704_1003129152	152
383	3300005549	Ga0070704_100315875	Ga0070704_1003158752	152
384	3300005719	Ga0068861_100424555	Ga0068861_1004245551	152
385	3300005840	Ga0068870_10524311	Ga0068870_105243112	152
386	3300006173	Ga0070716_100265949	Ga0070716_1002659492	152
387	3300006914	Ga0075436_100133758	Ga0075436_1001337582	152
388	3300009094	Ga0111539_11203128	Ga0111539_112031281	152
389	3300009148	Ga0105243_10042343	Ga0105243_100423433	152
390	3300009174	Ga0105241_10490671	Ga0105241_104906712	152
391	3300013297	Ga0157378_10031219	Ga0157378_100312191	152
392	3300013308	Ga0157375_12569114	Ga0157375_125691141	152
393	3300017792	Ga0163161_10251809	Ga0163161_102518091	152
394	3300025905	Ga0207685_10000002	Ga0207685_10000002346	152
395	3300025910	Ga0207684_10035214	Ga0207684_100352143	152
396	3300025910	Ga0207684_10045614	Ga0207684_100456143	152
397	3300025911	Ga0207654_10504917	Ga0207654_105049172	152
398	3300025918	Ga0207662_10023061	Ga0207662_100230611	152
399	3300025922	Ga0207646_10005353	Ga0207646_100053536	152
400	3300025925	Ga0207650_10974640	Ga0207650_109746401	152
401	3300025934	Ga0207686_10223516	Ga0207686_102235162	152
402	3300025935	Ga0207709_10036096	Ga0207709_100360962	152
403	3300026118	Ga0207675_100847152	Ga0207675_1008471521	152
404	3300045051	Ga0451576_0602217	Ga0451576_0602217_221_679	152
405	3300050514	nmdc:mga08x19_858853_c1	nmdc:mga08x19_858853_c1_134_592	152
406	2162886012	MBSR1b_contig_1195118	MBSR1b_0022.00007020	155
407	3300005331	Ga0070670_101474364	Ga0070670_1014743641	155
408	3300005334	Ga0068869_100623615	Ga0068869_1006236152	155
409	3300005406	Ga0070703_10187495	Ga0070703_101874951	155
410	3300005440	Ga0070705_101135247	Ga0070705_1011352471	155
411	3300005445	Ga0070708_100143487	Ga0070708_1001434871	155
412	3300005457	Ga0070662_100476800	Ga0070662_1004768002	155
413	3300005459	Ga0068867_101056337	Ga0068867_1010563371	155
414	3300005467	Ga0070706_101113328	Ga0070706_1011133281	155
415	3300005546	Ga0070696_101729460	Ga0070696_1017294601	155
416	3300005549	Ga0070704_100358700	Ga0070704_1003587002	155
417	3300005577	Ga0068857_100027292	Ga0068857_1000272924	155
418	3300005840	Ga0068870_10177354	Ga0068870_101773541	155
419	3300005844	Ga0068862_100135963	Ga0068862_1001359632	155
420	3300005844	Ga0068862_101840175	Ga0068862_1018401751	155
421	3300009553	Ga0105249_10107976	Ga0105249_101079761	155
422	3300014326	Ga0157380_10552628	Ga0157380_105526282	155
423	3300025908	Ga0207643_10194419	Ga0207643_101944191	155
424	3300025942	Ga0207689_10818941	Ga0207689_108189411	155
425	3300026089	Ga0207648_10281026	Ga0207648_102810261	155
426	3300026116	Ga0207674_10041737	Ga0207674_100417373	155
427	3300028380	Ga0268265_10142789	Ga0268265_101427892	155
428	3300050507	nmdc:mga05p37_2136_c1	nmdc:mga05p37_2136_c1_9644_10117	155

Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
6fxd-assembly1.cif.gz_A-2	crystal structure of mupz from pseudomonas fluorescens	0.7385	31	141
6fxd-assembly1.cif.gz_B-2	crystal structure of mupz from pseudomonas fluorescens	0.7328	32	141
2jdj-assembly1.cif.gz_A	crystal structure of hapk from hahella chejuensis	0.7007	35	144
2bbe-assembly1.cif.gz_A	crystal structure of protein so0527 from shewanella oneidensis	0.6966	30	146
1vqs-assembly1.cif.gz_B	crystal structure of a nipsnap family protein with unknown function (atu4242) from agrobacterium tumefaciens str. c58 at 1.50 a resolution	0.6905	33	149

ID	Description	Score	Start	End	Superfamily
5uq4A00	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.7776	34	103	3.30.70.100
af_P9WLA3_28_227_3.30.70.100	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.7054	27	141	3.30.70.100
2bbeA00	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.6966	30	146	3.30.70.100
2jdjB00	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.6804	36	140	3.30.70.100
2bbeA00	Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;	0.6794	30	146	3.30.70.100

ID	Description	Score	Start	End	GO Terms
AF-A0A534BJC1-F1-model_v4	ABM domain-containing protein	0.9547	27	148
AF-A0A2V6KL96-F1-model_v4	EthD domain-containing protein	0.954	27	148	GO:0016020
AF-A0A1Q7SXD8-F1-model_v4	NIPSNAP domain-containing protein	0.9512	29	148
AF-A0A7V9U4S3-F1-model_v4	ABM domain-containing protein	0.9492	27	148
AF-A0A537AXE4-F1-model_v4	Uncharacterized protein	0.9476	27	148

Feature Viewer

pLDDT	pTM	Quality
88.37	0.73	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F441678

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map