F441622

General Info

Members Datasets Scaffolds Average Seq Length
428 202 856 355

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100033940|Ga0070706_1000339401
Length 405
Sequence MVKAREEFGADTDPGRQANAGKFVASPVSRESRREEVPNRTKEQRFYPLVELTLTRIREFVREPEALFWSFVFPVLLAVALGIAFRNTAPEKPRIAVESDASATNSAPNAIADALRGSGKVALVVRATCTGGGETQQNXXTRMSSSSESGARLPSASFSPSCPLEYRYDPTRPESRMARFAVDDALQRAMGRADLVTTRDEKATEPGARYIDFLVPGLIGMNLMATGMWALGFVIVQARGRKLLKRFAVTPMRRSHYLLSFMLSRVIFMVAEVATVLVFAWVIFGVSVRGSLVSVAILSLIGAMTFSGLGLLVAARPKTIEGVSGLMNLVMLPMWLLSGTFFSWARFPQTVQPFIKALPLTALNDSLRAVINDGTPLAASWMQIGIMLAWCVVSFAVALRLFRWH

Samples

Sample ID Description Type Environment
1 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
144 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
151 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
158 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
159 3300038699 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot26 Metagenome Rhizosphere
160 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
161 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
162 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
163 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
164 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
165 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
166 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
167 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
168 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
174 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
175 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
176 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
180 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
181 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
182 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
183 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
187 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
188 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
189 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
190 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
191 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
192 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
193 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
194 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
195 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
196 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
197 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
201 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
202 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.93
Rhizosphere 98.6
Stem 0
Stem Tuber 0
Unclassified 7.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070706_100033940 3300005467 Bacteria 4711
2 SwRhRL2b_contig_130821 2162886007 Unclassified 2092
3 SwRhRL2b_contig_748900 2162886007 Bacteria 1168
4 JGI24751J29686_10000509 3300002459 Bacteria 11240
5 Ga0065714_10064426 3300005288 Bacteria 186606
6 Ga0065704_10006512 3300005289 Bacteria 4867
7 Ga0065704_10081570 3300005289 Bacteria 3734
8 Ga0065712_10002406 3300005290 Bacteria 8306
9 Ga0065712_10067732 3300005290 Bacteria 130748
10 Ga0065712_10094457 3300005290 Bacteria 2254
11 Ga0065715_10089499 3300005293 Bacteria 9818
12 Ga0065715_10113474 3300005293 Bacteria 2488
13 Ga0065715_10137957 3300005293 Unclassified 1899
14 Ga0065707_10020069 3300005295 Unclassified 1945
15 Ga0065707_10122866 3300005295 Bacteria 2079
16 Ga0065707_10124843 3300005295 Bacteria 2031
17 Ga0070690_100001848 3300005330 Bacteria 11237
18 Ga0070690_100097557 3300005330 Bacteria 1944
19 Ga0070670_100000043 3300005331 Bacteria 141622
20 Ga0070670_100059694 3300005331 Bacteria 3274
21 Ga0068869_100166354 3300005334 Bacteria 1720
22 Ga0068869_100307533 3300005334 Bacteria 1282
23 Ga0070666_10064279 3300005335 Bacteria 2489
24 Ga0070680_100000115 3300005336 Bacteria 46887
25 Ga0070682_100001243 3300005337 Bacteria 14481
26 Ga0070682_100004341 3300005337 Bacteria 7870
27 Ga0068868_100053742 3300005338 Bacteria 3173
28 Ga0070689_100000026 3300005340 Bacteria 100274
29 Ga0070689_100000683 3300005340 Bacteria 20628
30 Ga0070689_100031287 3300005340 Bacteria 4043
31 Ga0070687_100008595 3300005343 Bacteria 4333
32 Ga0070661_100057975 3300005344 Unclassified 2838
33 Ga0070692_10022375 3300005345 Bacteria 3087
34 Ga0070692_10054185 3300005345 Bacteria 2093
35 Ga0070692_10056708 3300005345 Bacteria 2052
36 Ga0070669_100012445 3300005353 Bacteria 6037
37 Ga0070669_100082192 3300005353 Bacteria 2401
38 Ga0070675_100058523 3300005354 Bacteria 3179
39 Ga0070675_100204123 3300005354 Bacteria 1716
40 Ga0070671_100022913 3300005355 Bacteria 5103
41 Ga0070674_100202234 3300005356 Bacteria 1535
42 Ga0070674_100297563 3300005356 Bacteria 1285
43 Ga0070673_100105751 3300005364 Bacteria 2326
44 Ga0070688_100000198 3300005365 Bacteria 31982
45 Ga0070688_100003786 3300005365 Bacteria 7837
46 Ga0070688_100010114 3300005365 Bacteria 5188
47 Ga0070688_100015692 3300005365 Bacteria 4316
48 Ga0070659_100151859 3300005366 Bacteria 1890
49 Ga0070703_10004187 3300005406 Bacteria 4061
50 Ga0070701_10060707 3300005438 Bacteria 1991
51 Ga0070701_10144171 3300005438 Unclassified 1365
52 Ga0070701_10177217 3300005438 Bacteria 1245
53 Ga0070705_100061881 3300005440 Bacteria 2226
54 Ga0070705_100108870 3300005440 Bacteria 1766
55 Ga0070700_100003857 3300005441 Bacteria 7776
56 Ga0070700_100026462 3300005441 Bacteria 3426
57 Ga0070700_100142347 3300005441 Unclassified 1631
58 Ga0070694_100002545 3300005444 Bacteria 10766
59 Ga0070694_100011696 3300005444 Bacteria 5437
60 Ga0070694_100054846 3300005444 Bacteria 2701
61 Ga0070708_100000328 3300005445 Bacteria 35692
62 Ga0070681_10000336 3300005458 Bacteria 38138
63 Ga0070681_10023175 3300005458 Bacteria 6245
64 Ga0070681_10253470 3300005458 Bacteria 1672
65 Ga0068867_100010219 3300005459 Bacteria 6621
66 Ga0068867_100067538 3300005459 Bacteria 2666
67 Ga0070685_10002744 3300005466 Bacteria 9024
68 Ga0070685_10010467 3300005466 Bacteria 4822
69 Ga0070685_10031919 3300005466 Bacteria 2947
70 Ga0070685_10072325 3300005466 Bacteria 2047
71 Ga0070706_100000031 3300005467 Bacteria 153504
72 Ga0070707_100014489 3300005468 Bacteria 7389
73 Ga0070707_100034139 3300005468 Bacteria 4852
74 Ga0070707_100045968 3300005468 Bacteria 4177
75 Ga0070707_100225229 3300005468 Unclassified 1826
76 Ga0070707_100309598 3300005468 Bacteria 1535
77 Ga0070698_100000819 3300005471 Bacteria 33992
78 Ga0070698_100011957 3300005471 Bacteria 9211
79 Ga0070698_100013422 3300005471 Bacteria 8672
80 Ga0070699_100001961 3300005518 Bacteria 18583
81 Ga0070699_100052204 3300005518 Bacteria 3539
82 Ga0070679_100000256 3300005530 Bacteria 44524
83 Ga0070679_100076131 3300005530 Unclassified 3346
84 Ga0070679_100212298 3300005530 Unclassified 1899
85 Ga0070697_100000334 3300005536 Bacteria 37096
86 Ga0070697_100009535 3300005536 Bacteria 7585
87 Ga0070697_100015182 3300005536 Bacteria 6048
88 Ga0070697_100028192 3300005536 Bacteria 4496
89 Ga0068853_100076351 3300005539 Bacteria 2925
90 Ga0068853_100130699 3300005539 Bacteria 2247
91 Ga0070686_100056619 3300005544 Bacteria 2515
92 Ga0070686_100165738 3300005544 Bacteria 1559
93 Ga0070696_100014123 3300005546 Bacteria 5361
94 Ga0070696_100079150 3300005546 Bacteria 2325
95 Ga0070696_100270888 3300005546 Unclassified 1291
96 Ga0070693_100039477 3300005547 Bacteria 2644
97 Ga0070704_100012526 3300005549 Bacteria 5239
98 Ga0070704_100064695 3300005549 Bacteria 2630
99 Ga0068855_100192998 3300005563 Bacteria 2296
100 Ga0070664_100095024 3300005564 Bacteria 2585
101 Ga0068857_100023010 3300005577 Bacteria 5481
102 Ga0068857_100205880 3300005577 Bacteria 1794
103 Ga0068857_100236177 3300005577 Bacteria 1673
104 Ga0068856_100010370 3300005614 Bacteria 9050
105 Ga0070702_100003254 3300005615 Bacteria 7233
106 Ga0070702_100023747 3300005615 Bacteria 3262
107 Ga0070702_100075846 3300005615 Bacteria 2000
108 Ga0068852_100119612 3300005616 Bacteria 2408
109 Ga0068852_100168360 3300005616 Bacteria 2052
110 Ga0068859_100000061 3300005617 Bacteria 111254
111 Ga0068859_100002559 3300005617 Bacteria 18462
112 Ga0068859_100019222 3300005617 Bacteria 6863
113 Ga0068859_100024737 3300005617 Bacteria 6026
114 Ga0068859_100038769 3300005617 Bacteria 4780
115 Ga0068859_100067261 3300005617 Bacteria 3617
116 Ga0068859_100084153 3300005617 Bacteria 3225
117 Ga0068859_100116470 3300005617 Bacteria 2737
118 Ga0068859_100142810 3300005617 Bacteria 2468
119 Ga0068859_100172826 3300005617 Bacteria 2242
120 Ga0068859_100255191 3300005617 Bacteria 1844
121 Ga0068859_100592015 3300005617 Bacteria 1202
122 Ga0068864_100027058 3300005618 Bacteria 4839
123 Ga0068864_100056074 3300005618 Bacteria 3405
124 Ga0068864_100082808 3300005618 Bacteria 2816
125 Ga0068864_100099184 3300005618 Bacteria 2580
126 Ga0068864_100159614 3300005618 Bacteria 2049
127 Ga0068866_10055824 3300005718 Bacteria 2030
128 Ga0068861_100065321 3300005719 Bacteria 2802
129 Ga0068861_100153900 3300005719 Bacteria 1889
130 Ga0068861_100157488 3300005719 Bacteria 1870
131 Ga0068851_10025345 3300005834 Bacteria 2909
132 Ga0068870_10016444 3300005840 Bacteria 3535
133 Ga0068863_100153268 3300005841 Bacteria 2206
134 Ga0068863_100329244 3300005841 Bacteria 1485
135 Ga0068863_100334765 3300005841 Bacteria 1472
136 Ga0068863_100464963 3300005841 Bacteria 1243
137 Ga0068858_100049553 3300005842 Bacteria 3889
138 Ga0068858_100106876 3300005842 Bacteria 2612
139 Ga0068858_100336559 3300005842 Bacteria 1444
140 Ga0068860_100009680 3300005843 Bacteria 9573
141 Ga0068860_100026423 3300005843 Bacteria 5596
142 Ga0068860_100030753 3300005843 Bacteria 5163
143 Ga0068860_100039244 3300005843 Bacteria 4529
144 Ga0068860_100048405 3300005843 Bacteria 4051
145 Ga0068860_100109247 3300005843 Bacteria 2643
146 Ga0068860_100114004 3300005843 Bacteria 2585
147 Ga0068860_100272098 3300005843 Bacteria 1653
148 Ga0068862_100079074 3300005844 Bacteria 2850
149 Ga0068862_100140127 3300005844 Bacteria 2146
150 Ga0081539_10000605 3300005985 Bacteria 72953
151 Ga0081539_10008094 3300005985 Bacteria 9299
152 Ga0081539_10027075 3300005985 Unclassified 3639
153 Ga0097621_100001378 3300006237 Bacteria 16716
154 Ga0097621_100020127 3300006237 Bacteria 5139
155 Ga0097621_100177440 3300006237 Bacteria 1839
156 Ga0068871_100001191 3300006358 Bacteria 17362
157 Ga0068871_100027411 3300006358 Bacteria 4455
158 Ga0068871_100398564 3300006358 Bacteria 1225
159 Ga0075428_100025332 3300006844 Bacteria 6566
160 Ga0075428_100032309 3300006844 Bacteria 5780
161 Ga0075428_100260236 3300006844 Unclassified 1868
162 Ga0075430_100016392 3300006846 Bacteria 6309
163 Ga0075431_100014682 3300006847 Bacteria 7927
164 Ga0075431_100032442 3300006847 Bacteria 5382
165 Ga0075431_100138132 3300006847 Bacteria 2513
166 Ga0075433_10011105 3300006852 Bacteria 7243
167 Ga0075433_10021399 3300006852 Bacteria 5423
168 Ga0075433_10027116 3300006852 Bacteria 4857
169 Ga0075433_10077688 3300006852 Bacteria 2924
170 Ga0075433_10102960 3300006852 Unclassified 2529
171 Ga0075433_10137895 3300006852 Bacteria 2168
172 Ga0075434_100027636 3300006871 Bacteria 5571
173 Ga0075434_100043472 3300006871 Bacteria 4457
174 Ga0068865_100075231 3300006881 Bacteria 2407
175 Ga0075436_100043804 3300006914 Bacteria 3086
176 Ga0097620_100000061 3300006931 Bacteria 111254
177 Ga0097620_100002559 3300006931 Bacteria 18462
178 Ga0097620_100016039 3300006931 Bacteria 7528
179 Ga0097620_100019222 3300006931 Bacteria 6863
180 Ga0097620_100024737 3300006931 Bacteria 6026
181 Ga0097620_100038770 3300006931 Bacteria 4780
182 Ga0097620_100067261 3300006931 Bacteria 3617
183 Ga0097620_100084154 3300006931 Bacteria 3225
184 Ga0097620_100116464 3300006931 Bacteria 2737
185 Ga0097620_100142810 3300006931 Bacteria 2468
186 Ga0097620_100172832 3300006931 Bacteria 2242
187 Ga0097620_100255188 3300006931 Bacteria 1844
188 Ga0097620_100592001 3300006931 Bacteria 1202
189 Ga0075435_100021876 3300007076 Bacteria 4928
190 Ga0105240_10036941 3300009093 Bacteria 6279
191 Ga0111539_10006680 3300009094 Bacteria 14854
192 Ga0111539_10164551 3300009094 Bacteria 2594
193 Ga0105247_10000394 3300009101 Bacteria 37073
194 Ga0105247_10066247 3300009101 Bacteria 2248
195 Ga0114129_10016082 3300009147 Bacteria 10643
196 Ga0114129_10071809 3300009147 Bacteria 4826
197 Ga0105243_10001423 3300009148 Bacteria 21119
198 Ga0105243_10008849 3300009148 Bacteria 7709
199 Ga0105242_10012905 3300009176 Bacteria 6439
200 Ga0105242_10088322 3300009176 Bacteria 2604
201 Ga0105242_10171326 3300009176 Bacteria 1908
202 Ga0105248_10001611 3300009177 Bacteria 25097
203 Ga0105248_10002356 3300009177 Bacteria 20978
204 Ga0105248_10060379 3300009177 Bacteria 4256
205 Ga0105248_10099339 3300009177 Bacteria 3280
206 Ga0105248_10136818 3300009177 Bacteria 2764
207 Ga0105237_10002295 3300009545 Bacteria 23777
208 Ga0105238_10000133 3300009551 Bacteria 81201
209 Ga0105238_10044452 3300009551 Bacteria 4490
210 Ga0105238_10114962 3300009551 Bacteria 2670
211 Ga0105249_10047394 3300009553 Bacteria 3916
212 Ga0105249_10075612 3300009553 Bacteria 3119
213 Ga0105249_10103339 3300009553 Bacteria 2683
214 Ga0105249_10284113 3300009553 Unclassified 1654
215 Ga0105249_10315065 3300009553 Bacteria 1574
216 Ga0105239_10047351 3300010375 Bacteria 4712
217 Ga0105239_10058931 3300010375 Bacteria 4214
218 Ga0105239_10208353 3300010375 Bacteria 2191
219 Ga0105246_10034068 3300011119 Bacteria 3389
220 Ga0157373_10008859 3300013100 Bacteria 7448
221 Ga0157373_10094284 3300013100 Bacteria 2108
222 Ga0157373_10132070 3300013100 Unclassified 1756
223 Ga0157378_10010659 3300013297 Bacteria 8031
224 Ga0157378_10017893 3300013297 Bacteria 6220
225 Ga0157378_10044604 3300013297 Bacteria 3938
226 Ga0163162_10007000 3300013306 Bacteria 10938
227 Ga0163162_10018521 3300013306 Bacteria 6823
228 Ga0163162_10039853 3300013306 Bacteria 4695
229 Ga0157372_10029153 3300013307 Bacteria 6023
230 Ga0157375_10005744 3300013308 Bacteria 10792
231 Ga0157375_10045059 3300013308 Unclassified 4291
232 Ga0157375_10397732 3300013308 Bacteria 1544
233 Ga0163163_10012407 3300014325 Bacteria 7762
234 Ga0163163_10013529 3300014325 Bacteria 7477
235 Ga0163163_10364722 3300014325 Bacteria 1501
236 Ga0157380_10000337 3300014326 Bacteria 27979
237 Ga0157380_10020821 3300014326 Bacteria 4909
238 Ga0157380_10074163 3300014326 Bacteria 2761
239 Ga0157380_10293608 3300014326 Bacteria 1494
240 Ga0157377_10026672 3300014745 Bacteria 3095
241 Ga0157377_10067759 3300014745 Bacteria 2055
242 Ga0157379_10052260 3300014968 Bacteria 3650
243 Ga0157379_10206862 3300014968 Bacteria 1776
244 Ga0157376_10007111 3300014969 Bacteria 7948
245 Ga0213876_10076702 3300021384 Bacteria 1765
246 Ga0207656_10001324 3300025321 Bacteria 8145
247 Ga0207653_10004136 3300025885 Bacteria 4562
248 Ga0207642_10020604 3300025899 Bacteria 2578
249 Ga0207710_10000671 3300025900 Bacteria 19274
250 Ga0207647_10023566 3300025904 Bacteria 4069
251 Ga0207647_10074641 3300025904 Bacteria 2042
252 Ga0207685_10026240 3300025905 Bacteria 2023
253 Ga0207643_10047914 3300025908 Bacteria 2420
254 Ga0207684_10000110 3300025910 Bacteria 153722
255 Ga0207684_10015283 3300025910 Bacteria 6612
256 Ga0207684_10090949 3300025910 Bacteria 2600
257 Ga0207707_10000190 3300025912 Bacteria 64802
258 Ga0207707_10007941 3300025912 Bacteria 9229
259 Ga0207707_10057949 3300025912 Bacteria 3371
260 Ga0207695_10038184 3300025913 Bacteria 5173
261 Ga0207671_10000894 3300025914 Bacteria 37708
262 Ga0207671_10131077 3300025914 Bacteria 1924
263 Ga0207660_10000117 3300025917 Bacteria 46029
264 Ga0207662_10034393 3300025918 Bacteria 2957
265 Ga0207657_10060574 3300025919 Bacteria 3248
266 Ga0207649_10108657 3300025920 Bacteria 1849
267 Ga0207652_10000028 3300025921 Bacteria 150429
268 Ga0207652_10173591 3300025921 Unclassified 1935
269 Ga0207646_10035778 3300025922 Bacteria 4483
270 Ga0207646_10418136 3300025922 Bacteria 1210
271 Ga0207681_10044900 3300025923 Bacteria 2963
272 Ga0207694_10000023 3300025924 Bacteria 259621
273 Ga0207694_10019178 3300025924 Bacteria 5170
274 Ga0207650_10000009 3300025925 Bacteria 483583
275 Ga0207650_10112428 3300025925 Bacteria 2110
276 Ga0207650_10157673 3300025925 Bacteria 1796
277 Ga0207650_10266826 3300025925 Bacteria 1390
278 Ga0207644_10018967 3300025931 Bacteria 4663
279 Ga0207644_10059145 3300025931 Bacteria 2771
280 Ga0207706_10185469 3300025933 Bacteria 1827
281 Ga0207686_10067058 3300025934 Bacteria 2294
282 Ga0207709_10010950 3300025935 Bacteria 4999
283 Ga0207709_10019151 3300025935 Bacteria 3843
284 Ga0207709_10329951 3300025935 Bacteria 1145
285 Ga0207670_10000021 3300025936 Bacteria 155646
286 Ga0207670_10005789 3300025936 Bacteria 6822
287 Ga0207670_10092725 3300025936 Bacteria 2138
288 Ga0207670_10198976 3300025936 Bacteria 1521
289 Ga0207704_10012263 3300025938 Bacteria 4250
290 Ga0207691_10002057 3300025940 Bacteria 19664
291 Ga0207711_10022380 3300025941 Bacteria 5285
292 Ga0207711_10268160 3300025941 Bacteria 1570
293 Ga0207711_10370868 3300025941 Bacteria 1327
294 Ga0207689_10004528 3300025942 Bacteria 12581
295 Ga0207689_10156175 3300025942 Bacteria 1881
296 Ga0207689_10180343 3300025942 Bacteria 1741
297 Ga0207679_10087165 3300025945 Bacteria 2403
298 Ga0207651_10099153 3300025960 Bacteria 2157
299 Ga0207651_10318994 3300025960 Bacteria 1298
300 Ga0207712_10002204 3300025961 Bacteria 12685
301 Ga0207712_10223607 3300025961 Bacteria 1506
302 Ga0207640_10041703 3300025981 Bacteria 2921
303 Ga0207703_10025495 3300026035 Bacteria 4650
304 Ga0207703_10036423 3300026035 Bacteria 3916
305 Ga0207703_10189737 3300026035 Bacteria 1819
306 Ga0207703_10255588 3300026035 Bacteria 1581
307 Ga0207639_10069394 3300026041 Bacteria 2750
308 Ga0207708_10001381 3300026075 Bacteria 18242
309 Ga0207708_10009738 3300026075 Bacteria 7130
310 Ga0207708_10029919 3300026075 Bacteria 4129
311 Ga0207708_10034619 3300026075 Bacteria 3842
312 Ga0207708_10183393 3300026075 Bacteria 1662
313 Ga0207641_10024959 3300026088 Bacteria 4929
314 Ga0207641_10175169 3300026088 Bacteria 1961
315 Ga0207641_10266971 3300026088 Bacteria 1604
316 Ga0207641_10313268 3300026088 Bacteria 1486
317 Ga0207648_10032117 3300026089 Unclassified 4638
318 Ga0207648_10032144 3300026089 Bacteria 4636
319 Ga0207648_10198648 3300026089 Bacteria 1778
320 Ga0207676_10002901 3300026095 Bacteria 12223
321 Ga0207676_10482895 3300026095 Unclassified 1174
322 Ga0207674_10012551 3300026116 Bacteria 9465
323 Ga0207674_10041083 3300026116 Bacteria 4785
324 Ga0207674_10120689 3300026116 Bacteria 2589
325 Ga0207674_10222245 3300026116 Bacteria 1837
326 Ga0207675_100001348 3300026118 Bacteria 24637
327 Ga0207675_100031166 3300026118 Bacteria 4966
328 Ga0207675_100053543 3300026118 Bacteria 3765
329 Ga0207675_100145317 3300026118 Bacteria 2255
330 Ga0207675_100187971 3300026118 Bacteria 1980
331 Ga0207675_100200213 3300026118 Bacteria 1918
332 Ga0207675_100256904 3300026118 Bacteria 1692
333 Ga0207698_10076181 3300026142 Bacteria 2684
334 Ga0207428_10004982 3300027907 Bacteria 12506
335 Ga0268265_10030788 3300028380 Bacteria 3869
336 Ga0268265_10282608 3300028380 Unclassified 1486
337 Ga0268264_10016931 3300028381 Bacteria 5967
338 Ga0268264_10098436 3300028381 Bacteria 2536
339 Ga0268264_10117032 3300028381 Bacteria 2343
340 Ga0268264_10127028 3300028381 Bacteria 2255
341 Ga0268264_10291967 3300028381 Bacteria 1532
342 Ga0307408_100081411 3300031548 Bacteria 2421
343 Ga0307408_100134683 3300031548 Bacteria 1932
344 Ga0316576_10013729 3300031727 Bacteria 5394
345 Ga0316576_10090062 3300031727 Bacteria 2285
346 Ga0307405_10158191 3300031731 Bacteria 1601
347 Ga0307405_10191655 3300031731 Bacteria 1477
348 Ga0307412_10197212 3300031911 Unclassified 1526
349 Ga0307412_10292469 3300031911 Unclassified 1284
350 Ga0307414_10037858 3300032004 Bacteria 3234
351 Ga0307414_10246707 3300032004 Bacteria 1482
352 Ga0307415_100039398 3300032126 Bacteria 3123
353 Ga0307415_100103390 3300032126 Bacteria 2096
354 Ga0373959_0000036 3300034820 Bacteria 29513
355 Ga0373934_0004233 3300035086 Bacteria 5293
356 Ga0373951_0001056 3300035091 Bacteria 7400
357 Ga0373957_0007066 3300035120 Bacteria 3572
358 Ga0373931_0052974 3300035691 Bacteria 2165
359 Ga0373933_0017986 3300035724 Bacteria 3970
360 Ga0316582_0014296 3300036647 Bacteria 4499
361 Ga0395899_0099440 3300037312 Bacteria 2101
362 Ga0395900_0505303 3300037418 Bacteria 1159
363 Ga0395905_0376610 3300037471 Bacteria 1313
364 Ga0395901_0021587 3300038443 Bacteria 6596
365 Ga0395901_0047530 3300038443 Bacteria 4456
366 Ga0242422_01044 3300038699 Bacteria 1886
367 Ga0242420_015298 3300038996 Unclassified 1326
368 Ga0436365_0758411 3300039437 Bacteria 3305
369 Ga0439448_0016443 3300042005 Bacteria 2252
370 Ga0439455_0009128 3300042012 Bacteria 2144
371 Ga0451577_0071982 3300042876 Bacteria 3083
372 Ga0451577_0353536 3300042876 Bacteria 1333
373 Ga0466969_0016950 3300044656 Bacteria 3807
374 Ga0453683_0000374 3300044673 Bacteria 53531
375 Ga0453683_0000851 3300044673 Bacteria 29443
376 Ga0466961_0004537 3300044693 Bacteria 8708
377 Ga0453684_0000650 3300044712 Bacteria 125139
378 Ga0453684_0000725 3300044712 Bacteria 116265
379 Ga0453684_0007995 3300044712 Bacteria 19156
380 Ga0453684_0035602 3300044712 Bacteria 6877
381 Ga0453684_0105657 3300044712 Bacteria 3433
382 Ga0451576_0131831 3300045051 Bacteria 2605
383 Ga0466967_0038664 3300045976 Archaea 4094
384 Ga0495592_0048839 3300046454 Bacteria 3146
385 Ga0495608_0059870 3300046511 Unclassified 2507
386 Ga0495630_0220214 3300046517 Bacteria 1449
387 Ga0495652_0428004 3300046529 Unclassified 931
388 Ga0495587_0045500 3300046536 Bacteria 2608
389 Ga0495667_0050524 3300046559 Bacteria 2744
390 Ga0495680_0037411 3300047322 Bacteria 3887
391 Ga0495675_0060335 3300047444 Bacteria 2404
392 Ga0496103_0086260 3300048906 Bacteria 1979
393 Ga0496112_0120391 3300048915 Bacteria 2595
394 Ga0496112_0132667 3300048915 Bacteria 2462
395 Ga0496112_0197551 3300048915 Bacteria 1972
396 Ga0501291_013704 3300049514 Unclassified 1203
397 Ga0501298_015122 3300049521 Bacteria 1386
398 Ga0501298_016065 3300049521 Bacteria 1354
399 Ga0501299_000278 3300049522 Bacteria 5860
400 Ga0501299_006478 3300049522 Unclassified 1837
401 Ga0501038_0009938 3300049574 Bacteria 8712
402 Ga0501048_0217315 3300049582 Bacteria 1355
403 Ga0501216_021354 3300049660 Bacteria 1137
404 Ga0501233_000684 3300049668 Bacteria 5591
405 Ga0501235_025707 3300049669 Bacteria 1317
406 Ga0501243_003643 3300049675 Bacteria 2294
407 Ga0501249_013887 3300049679 Unclassified 1714
408 Ga0501221_001947 3300049704 Bacteria 3443
409 Ga0501225_0025345 3300049705 Bacteria 1631
410 Ga0501245_001561 3300049708 Bacteria 2980
411 Ga0501283_000450 3300049779 Bacteria 5430
412 nmdc:mga05p37_71588_c1 3300050507 Unclassified 4265
413 nmdc:mga05p37_75018_c1 3300050507 Bacteria 4163
414 nmdc:mga09592_96947_c1 3300050508 Bacteria 2523
415 nmdc:mga06r32_12575_c1 3300050510 Bacteria 7642
416 nmdc:mga06r32_243457_c1 3300050510 Bacteria 1786
417 nmdc:mga08y16_124550_c1 3300050511 Unclassified 2681
418 nmdc:mga08y16_1523_c1 3300050511 Bacteria 23323
419 nmdc:mga08y16_297734_c1 3300050511 Bacteria 1663
420 nmdc:mga08y16_474853_c1 3300050511 Bacteria 1273
421 nmdc:mga0rr50_269137_c1 3300050513 Bacteria 1419
422 nmdc:mga08x19_37647_c1 3300050514 Bacteria 3071
423 nmdc:mga0a205_293935_c1 3300050515 Bacteria 1498
424 nmdc:mga0a205_29807_c1 3300050515 Bacteria 5221
425 nmdc:mga0a205_47462_c1 3300050515 Bacteria 4144
426 nmdc:mga0a205_57989_c1 3300050515 Unclassified 3739
427 nmdc:mga0a205_82841_c1 3300050515 Bacteria 3099
428 Ga0495595_0027910 3300053084 Bacteria 2517
429 Ga0070706_100033940
430 SwRhRL2b_contig_130821
431 SwRhRL2b_contig_748900
432 JGI24751J29686_10000509
433 Ga0065714_10064426
434 Ga0065704_10006512
435 Ga0065704_10081570
436 Ga0065712_10002406
437 Ga0065712_10067732
438 Ga0065712_10094457
439 Ga0065715_10089499
440 Ga0065715_10113474
441 Ga0065715_10137957
442 Ga0065707_10020069
443 Ga0065707_10122866
444 Ga0065707_10124843
445 Ga0070690_100001848
446 Ga0070690_100097557
447 Ga0070670_100000043
448 Ga0070670_100059694
449 Ga0068869_100166354
450 Ga0068869_100307533
451 Ga0070666_10064279
452 Ga0070680_100000115
453 Ga0070682_100001243
454 Ga0070682_100004341
455 Ga0068868_100053742
456 Ga0070689_100000026
457 Ga0070689_100000683
458 Ga0070689_100031287
459 Ga0070687_100008595
460 Ga0070661_100057975
461 Ga0070692_10022375
462 Ga0070692_10054185
463 Ga0070692_10056708
464 Ga0070669_100012445
465 Ga0070669_100082192
466 Ga0070675_100058523
467 Ga0070675_100204123
468 Ga0070671_100022913
469 Ga0070674_100202234
470 Ga0070674_100297563
471 Ga0070673_100105751
472 Ga0070688_100000198
473 Ga0070688_100003786
474 Ga0070688_100010114
475 Ga0070688_100015692
476 Ga0070659_100151859
477 Ga0070703_10004187
478 Ga0070701_10060707
479 Ga0070701_10144171
480 Ga0070701_10177217
481 Ga0070705_100061881
482 Ga0070705_100108870
483 Ga0070700_100003857
484 Ga0070700_100026462
485 Ga0070700_100142347
486 Ga0070694_100002545
487 Ga0070694_100011696
488 Ga0070694_100054846
489 Ga0070708_100000328
490 Ga0070681_10000336
491 Ga0070681_10023175
492 Ga0070681_10253470
493 Ga0068867_100010219
494 Ga0068867_100067538
495 Ga0070685_10002744
496 Ga0070685_10010467
497 Ga0070685_10031919
498 Ga0070685_10072325
499 Ga0070706_100000031
500 Ga0070707_100014489
501 Ga0070707_100034139
502 Ga0070707_100045968
503 Ga0070707_100225229
504 Ga0070707_100309598
505 Ga0070698_100000819
506 Ga0070698_100011957
507 Ga0070698_100013422
508 Ga0070699_100001961
509 Ga0070699_100052204
510 Ga0070679_100000256
511 Ga0070679_100076131
512 Ga0070679_100212298
513 Ga0070697_100000334
514 Ga0070697_100009535
515 Ga0070697_100015182
516 Ga0070697_100028192
517 Ga0068853_100076351
518 Ga0068853_100130699
519 Ga0070686_100056619
520 Ga0070686_100165738
521 Ga0070696_100014123
522 Ga0070696_100079150
523 Ga0070696_100270888
524 Ga0070693_100039477
525 Ga0070704_100012526
526 Ga0070704_100064695
527 Ga0068855_100192998
528 Ga0070664_100095024
529 Ga0068857_100023010
530 Ga0068857_100205880
531 Ga0068857_100236177
532 Ga0068856_100010370
533 Ga0070702_100003254
534 Ga0070702_100023747
535 Ga0070702_100075846
536 Ga0068852_100119612
537 Ga0068852_100168360
538 Ga0068859_100000061
539 Ga0068859_100002559
540 Ga0068859_100019222
541 Ga0068859_100024737
542 Ga0068859_100038769
543 Ga0068859_100067261
544 Ga0068859_100084153
545 Ga0068859_100116470
546 Ga0068859_100142810
547 Ga0068859_100172826
548 Ga0068859_100255191
549 Ga0068859_100592015
550 Ga0068864_100027058
551 Ga0068864_100056074
552 Ga0068864_100082808
553 Ga0068864_100099184
554 Ga0068864_100159614
555 Ga0068866_10055824
556 Ga0068861_100065321
557 Ga0068861_100153900
558 Ga0068861_100157488
559 Ga0068851_10025345
560 Ga0068870_10016444
561 Ga0068863_100153268
562 Ga0068863_100329244
563 Ga0068863_100334765
564 Ga0068863_100464963
565 Ga0068858_100049553
566 Ga0068858_100106876
567 Ga0068858_100336559
568 Ga0068860_100009680
569 Ga0068860_100026423
570 Ga0068860_100030753
571 Ga0068860_100039244
572 Ga0068860_100048405
573 Ga0068860_100109247
574 Ga0068860_100114004
575 Ga0068860_100272098
576 Ga0068862_100079074
577 Ga0068862_100140127
578 Ga0081539_10000605
579 Ga0081539_10008094
580 Ga0081539_10027075
581 Ga0097621_100001378
582 Ga0097621_100020127
583 Ga0097621_100177440
584 Ga0068871_100001191
585 Ga0068871_100027411
586 Ga0068871_100398564
587 Ga0075428_100025332
588 Ga0075428_100032309
589 Ga0075428_100260236
590 Ga0075430_100016392
591 Ga0075431_100014682
592 Ga0075431_100032442
593 Ga0075431_100138132
594 Ga0075433_10011105
595 Ga0075433_10021399
596 Ga0075433_10027116
597 Ga0075433_10077688
598 Ga0075433_10102960
599 Ga0075433_10137895
600 Ga0075434_100027636
601 Ga0075434_100043472
602 Ga0068865_100075231
603 Ga0075436_100043804
604 Ga0097620_100000061
605 Ga0097620_100002559
606 Ga0097620_100016039
607 Ga0097620_100019222
608 Ga0097620_100024737
609 Ga0097620_100038770
610 Ga0097620_100067261
611 Ga0097620_100084154
612 Ga0097620_100116464
613 Ga0097620_100142810
614 Ga0097620_100172832
615 Ga0097620_100255188
616 Ga0097620_100592001
617 Ga0075435_100021876
618 Ga0105240_10036941
619 Ga0111539_10006680
620 Ga0111539_10164551
621 Ga0105247_10000394
622 Ga0105247_10066247
623 Ga0114129_10016082
624 Ga0114129_10071809
625 Ga0105243_10001423
626 Ga0105243_10008849
627 Ga0105242_10012905
628 Ga0105242_10088322
629 Ga0105242_10171326
630 Ga0105248_10001611
631 Ga0105248_10002356
632 Ga0105248_10060379
633 Ga0105248_10099339
634 Ga0105248_10136818
635 Ga0105237_10002295
636 Ga0105238_10000133
637 Ga0105238_10044452
638 Ga0105238_10114962
639 Ga0105249_10047394
640 Ga0105249_10075612
641 Ga0105249_10103339
642 Ga0105249_10284113
643 Ga0105249_10315065
644 Ga0105239_10047351
645 Ga0105239_10058931
646 Ga0105239_10208353
647 Ga0105246_10034068
648 Ga0157373_10008859
649 Ga0157373_10094284
650 Ga0157373_10132070
651 Ga0157378_10010659
652 Ga0157378_10017893
653 Ga0157378_10044604
654 Ga0163162_10007000
655 Ga0163162_10018521
656 Ga0163162_10039853
657 Ga0157372_10029153
658 Ga0157375_10005744
659 Ga0157375_10045059
660 Ga0157375_10397732
661 Ga0163163_10012407
662 Ga0163163_10013529
663 Ga0163163_10364722
664 Ga0157380_10000337
665 Ga0157380_10020821
666 Ga0157380_10074163
667 Ga0157380_10293608
668 Ga0157377_10026672
669 Ga0157377_10067759
670 Ga0157379_10052260
671 Ga0157379_10206862
672 Ga0157376_10007111
673 Ga0213876_10076702
674 Ga0207656_10001324
675 Ga0207653_10004136
676 Ga0207642_10020604
677 Ga0207710_10000671
678 Ga0207647_10023566
679 Ga0207647_10074641
680 Ga0207685_10026240
681 Ga0207643_10047914
682 Ga0207684_10000110
683 Ga0207684_10015283
684 Ga0207684_10090949
685 Ga0207707_10000190
686 Ga0207707_10007941
687 Ga0207707_10057949
688 Ga0207695_10038184
689 Ga0207671_10000894
690 Ga0207671_10131077
691 Ga0207660_10000117
692 Ga0207662_10034393
693 Ga0207657_10060574
694 Ga0207649_10108657
695 Ga0207652_10000028
696 Ga0207652_10173591
697 Ga0207646_10035778
698 Ga0207646_10418136
699 Ga0207681_10044900
700 Ga0207694_10000023
701 Ga0207694_10019178
702 Ga0207650_10000009
703 Ga0207650_10112428
704 Ga0207650_10157673
705 Ga0207650_10266826
706 Ga0207644_10018967
707 Ga0207644_10059145
708 Ga0207706_10185469
709 Ga0207686_10067058
710 Ga0207709_10010950
711 Ga0207709_10019151
712 Ga0207709_10329951
713 Ga0207670_10000021
714 Ga0207670_10005789
715 Ga0207670_10092725
716 Ga0207670_10198976
717 Ga0207704_10012263
718 Ga0207691_10002057
719 Ga0207711_10022380
720 Ga0207711_10268160
721 Ga0207711_10370868
722 Ga0207689_10004528
723 Ga0207689_10156175
724 Ga0207689_10180343
725 Ga0207679_10087165
726 Ga0207651_10099153
727 Ga0207651_10318994
728 Ga0207712_10002204
729 Ga0207712_10223607
730 Ga0207640_10041703
731 Ga0207703_10025495
732 Ga0207703_10036423
733 Ga0207703_10189737
734 Ga0207703_10255588
735 Ga0207639_10069394
736 Ga0207708_10001381
737 Ga0207708_10009738
738 Ga0207708_10029919
739 Ga0207708_10034619
740 Ga0207708_10183393
741 Ga0207641_10024959
742 Ga0207641_10175169
743 Ga0207641_10266971
744 Ga0207641_10313268
745 Ga0207648_10032117
746 Ga0207648_10032144
747 Ga0207648_10198648
748 Ga0207676_10002901
749 Ga0207676_10482895
750 Ga0207674_10012551
751 Ga0207674_10041083
752 Ga0207674_10120689
753 Ga0207674_10222245
754 Ga0207675_100001348
755 Ga0207675_100031166
756 Ga0207675_100053543
757 Ga0207675_100145317
758 Ga0207675_100187971
759 Ga0207675_100200213
760 Ga0207675_100256904
761 Ga0207698_10076181
762 Ga0207428_10004982
763 Ga0268265_10030788
764 Ga0268265_10282608
765 Ga0268264_10016931
766 Ga0268264_10098436
767 Ga0268264_10117032
768 Ga0268264_10127028
769 Ga0268264_10291967
770 Ga0307408_100081411
771 Ga0307408_100134683
772 Ga0316576_10013729
773 Ga0316576_10090062
774 Ga0307405_10158191
775 Ga0307405_10191655
776 Ga0307412_10197212
777 Ga0307412_10292469
778 Ga0307414_10037858
779 Ga0307414_10246707
780 Ga0307415_100039398
781 Ga0307415_100103390
782 Ga0373959_0000036
783 Ga0373934_0004233
784 Ga0373951_0001056
785 Ga0373957_0007066
786 Ga0373931_0052974
787 Ga0373933_0017986
788 Ga0316582_0014296
789 Ga0395899_0099440
790 Ga0395900_0505303
791 Ga0395905_0376610
792 Ga0395901_0021587
793 Ga0395901_0047530
794 Ga0242422_01044
795 Ga0242420_015298
796 Ga0436365_0758411
797 Ga0439448_0016443
798 Ga0439455_0009128
799 Ga0451577_0071982
800 Ga0451577_0353536
801 Ga0466969_0016950
802 Ga0453683_0000374
803 Ga0453683_0000851
804 Ga0466961_0004537
805 Ga0453684_0000650
806 Ga0453684_0000725
807 Ga0453684_0007995
808 Ga0453684_0035602
809 Ga0453684_0105657
810 Ga0451576_0131831
811 Ga0466967_0038664
812 Ga0495592_0048839
813 Ga0495608_0059870
814 Ga0495630_0220214
815 Ga0495652_0428004
816 Ga0495587_0045500
817 Ga0495667_0050524
818 Ga0495680_0037411
819 Ga0495675_0060335
820 Ga0496103_0086260
821 Ga0496112_0120391
822 Ga0496112_0132667
823 Ga0496112_0197551
824 Ga0501291_013704
825 Ga0501298_015122
826 Ga0501298_016065
827 Ga0501299_000278
828 Ga0501299_006478
829 Ga0501038_0009938
830 Ga0501048_0217315
831 Ga0501216_021354
832 Ga0501233_000684
833 Ga0501235_025707
834 Ga0501243_003643
835 Ga0501249_013887
836 Ga0501221_001947
837 Ga0501225_0025345
838 Ga0501245_001561
839 Ga0501283_000450
840 nmdc:mga05p37_71588_c1
841 nmdc:mga05p37_75018_c1
842 nmdc:mga09592_96947_c1
843 nmdc:mga06r32_12575_c1
844 nmdc:mga06r32_243457_c1
845 nmdc:mga08y16_124550_c1
846 nmdc:mga08y16_1523_c1
847 nmdc:mga08y16_297734_c1
848 nmdc:mga08y16_474853_c1
849 nmdc:mga0rr50_269137_c1
850 nmdc:mga08x19_37647_c1
851 nmdc:mga0a205_293935_c1
852 nmdc:mga0a205_29807_c1
853 nmdc:mga0a205_47462_c1
854 nmdc:mga0a205_57989_c1
855 nmdc:mga0a205_82841_c1
856 Ga0495595_0027910

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01061

ABC2_membrane

ABC-2 type transporter

183

372

0.91

PF12698

ABC2_membrane_3

ABC-2 family transporter protein

183

400

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
8i3c-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 with chs 0.7513 169 360
2i6e-assembly1.cif.gz_A crystal structure of protein dr0370 from deinococcus radiodurans, pfam duf178 0.739 70 116
7znq-assembly1.cif.gz_Y abc transporter complex nosdfyl in gdn 0.7361 169 360
8i38-assembly1.cif.gz_B cryo-em structure of abscisic acid transporter atabcg25 in inward conformation 0.7349 169 361
7o12-assembly1.cif.gz_E abc transporter nosdfy, amppnp-bound in gdn 0.7339 169 363
ID Description Score Start End Superfamily
af_Q2G221_49_209_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7903 69 148 3.40.1710.10
af_Q2G194_39_178_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7629 66 146 3.40.1710.10
af_A0A2R8QMX4_332_689_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7403 41 359 3.40.1710.10
af_Q86P18_394_773_3.40.1710.10 Alpha Beta;3-Layer(aba) Sandwich;abc type-2 transporter like fold;abc type-2 transporter like domain 0.7253 43 361 3.40.1710.10
4zefA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.6934 66 111 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A2X4V3C4-F1-model_v4 ABC transporter efflux protein, DrrB family 0.9472 181 363 GO:0016020
GO:0140359
AF-A0A846PH14-F1-model_v4 ABC transporter permease 0.94 167 363 GO:0043190
GO:0140359
AF-A0A523LG82-F1-model_v4 Transport permease protein 0.9344 209 360 GO:0043190
GO:0140359
AF-A0A2X4V3C4-F1-model_v4 ABC transporter efflux protein, DrrB family 0.9326 181 363 GO:0016020
GO:0140359
AF-A0A4U3MJJ2-F1-model_v4 ABC transporter permease 0.9312 24 363 GO:0016020
GO:0140359

Map