F441477

General Info

Members Datasets Scaffolds Average Seq Length
427 183 854 222

Family's Representative Sequence

Representative Sequence 3300031456|Ga0307513_10229936|Ga0307513_102299361
Length 211
Sequence MTAELQRVIDAAWEERDGLGTATRGEVREAVEAAIGLLDSGAVRVAENGEAGWTVNQWLKKAVLLSFRLNPMEAISGGPGGAVWWDKVPSKFLGWTDPSFEEAGFRAVPGAIVRRGGVLEPLQAGPVIIEDNCFIGARSEVAEGVVVGASTKIVDRASGEVIYGRVPSYSVVVPGTLPAKDGGPSLACAVIVKRVDARTRSKTGINELLRD

Samples

Sample ID Description Type Environment
1 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
2 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
42 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
51 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
58 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
59 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
116 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
117 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
118 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
119 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
120 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
121 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
122 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
123 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
124 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
125 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
126 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
132 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
133 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
135 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
136 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
137 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
138 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
141 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
142 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
143 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
144 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
149 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
150 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
151 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
152 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
158 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
159 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
160 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
161 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
162 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
163 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
164 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
165 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
166 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
167 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
168 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
169 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
170 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
171 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
172 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
173 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
174 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
180 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.77
Metatranscriptomes 0.23
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.62
Rhizosphere 93.91
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307513_10229936 3300031456 Bacteria 1668
2 JGI24735J21928_10038908 3300002067 Bacteria 1391
3 Ga0070658_10000716 3300005327 Bacteria 28749
4 Ga0070658_10006789 3300005327 Bacteria 9261
5 Ga0070658_10015929 3300005327 Bacteria 6012
6 Ga0070658_10019746 3300005327 Bacteria 5396
7 Ga0070658_10030877 3300005327 Bacteria 4304
8 Ga0070658_10034315 3300005327 Bacteria 4082
9 Ga0070658_10037800 3300005327 Bacteria 3892
10 Ga0070658_10067826 3300005327 Bacteria 2915
11 Ga0070658_10088557 3300005327 Bacteria 2549
12 Ga0070658_10185352 3300005327 Bacteria 1752
13 Ga0070658_10361932 3300005327 Bacteria 1242
14 Ga0070683_100004410 3300005329 Bacteria 11593
15 Ga0070683_100256159 3300005329 Bacteria 1665
16 Ga0070670_100013283 3300005331 Bacteria 7055
17 Ga0070670_100144782 3300005331 Bacteria 2056
18 Ga0070666_10028403 3300005335 Bacteria 3670
19 Ga0070680_100000683 3300005336 Bacteria 23493
20 Ga0070680_100038807 3300005336 Bacteria 3852
21 Ga0070680_100068084 3300005336 Bacteria 2922
22 Ga0070680_100153152 3300005336 Bacteria 1936
23 Ga0070680_100196956 3300005336 Bacteria 1698
24 Ga0070682_100031482 3300005337 Bacteria 3209
25 Ga0070682_100479931 3300005337 Bacteria 959
26 Ga0068868_100024230 3300005338 Bacteria 4602
27 Ga0070660_100000116 3300005339 Bacteria 49715
28 Ga0070660_100000212 3300005339 Bacteria 39028
29 Ga0070660_100002966 3300005339 Bacteria 11674
30 Ga0070660_100012361 3300005339 Bacteria 6095
31 Ga0070660_100016827 3300005339 Bacteria 5319
32 Ga0070660_100054211 3300005339 Bacteria 3096
33 Ga0070660_100152809 3300005339 Bacteria 1857
34 Ga0070660_100167702 3300005339 Bacteria 1772
35 Ga0070660_100211971 3300005339 Bacteria 1573
36 Ga0070691_10014120 3300005341 Bacteria 3661
37 Ga0070661_100033054 3300005344 Bacteria 3746
38 Ga0070661_100058327 3300005344 Bacteria 2829
39 Ga0070661_100089363 3300005344 Bacteria 2281
40 Ga0070661_100126103 3300005344 Bacteria 1920
41 Ga0070661_100357267 3300005344 Bacteria 1147
42 Ga0070668_100056363 3300005347 Bacteria 3035
43 Ga0070669_100012623 3300005353 Bacteria 5996
44 Ga0070675_100102200 3300005354 Bacteria 2415
45 Ga0070671_100015323 3300005355 Bacteria 6191
46 Ga0070671_100048903 3300005355 Bacteria 3518
47 Ga0070671_100105660 3300005355 Bacteria 2363
48 Ga0070671_100412295 3300005355 Bacteria 1156
49 Ga0070673_100015784 3300005364 Bacteria 5318
50 Ga0070673_100111029 3300005364 Bacteria 2274
51 Ga0070659_100189262 3300005366 Bacteria 1691
52 Ga0070659_100207936 3300005366 Bacteria 1612
53 Ga0070667_100004843 3300005367 Bacteria 11279
54 Ga0070714_100008795 3300005435 Bacteria 7896
55 Ga0070714_100111818 3300005435 Bacteria 2419
56 Ga0070713_100016703 3300005436 Bacteria 5525
57 Ga0070663_100010506 3300005455 Bacteria 5770
58 Ga0070663_100018786 3300005455 Bacteria 4541
59 Ga0070663_100029561 3300005455 Bacteria 3746
60 Ga0070663_100216614 3300005455 Bacteria 1501
61 Ga0070663_100231764 3300005455 Bacteria 1454
62 Ga0070678_100014387 3300005456 Bacteria 4992
63 Ga0070678_100061255 3300005456 Bacteria 2773
64 Ga0070662_100001195 3300005457 Bacteria 15948
65 Ga0070662_100003219 3300005457 Bacteria 10152
66 Ga0070681_10095129 3300005458 Bacteria 2928
67 Ga0070681_10215233 3300005458 Bacteria 1838
68 Ga0070681_10438626 3300005458 Bacteria 1218
69 Ga0070706_100292441 3300005467 Bacteria 1520
70 Ga0070679_100011164 3300005530 Bacteria 8557
71 Ga0070679_100014712 3300005530 Bacteria 7521
72 Ga0070679_100065088 3300005530 Bacteria 3634
73 Ga0070679_100159144 3300005530 Bacteria 2233
74 Ga0070679_100280127 3300005530 Bacteria 1620
75 Ga0070684_100025317 3300005535 Bacteria 4986
76 Ga0070684_100128358 3300005535 Bacteria 2286
77 Ga0070672_100012806 3300005543 Bacteria 5905
78 Ga0070672_100028979 3300005543 Bacteria 4146
79 Ga0070672_100118009 3300005543 Bacteria 2169
80 Ga0070686_100528108 3300005544 Bacteria 920
81 Ga0070695_100074433 3300005545 Bacteria 2232
82 Ga0070696_100014446 3300005546 Bacteria 5296
83 Ga0070665_100023460 3300005548 Bacteria 6212
84 Ga0068855_100000079 3300005563 Bacteria 117264
85 Ga0068855_100039788 3300005563 Bacteria 5581
86 Ga0068855_100114300 3300005563 Bacteria 3095
87 Ga0068855_100144965 3300005563 Bacteria 2704
88 Ga0068855_100232768 3300005563 Bacteria 2062
89 Ga0070664_100004847 3300005564 Bacteria 10782
90 Ga0070664_100043752 3300005564 Bacteria 3779
91 Ga0070664_100159522 3300005564 Bacteria 1995
92 Ga0070664_100166026 3300005564 Bacteria 1956
93 Ga0068857_100016959 3300005577 Bacteria 6382
94 Ga0068857_100168334 3300005577 Bacteria 1991
95 Ga0068854_100002329 3300005578 Bacteria 11711
96 Ga0068854_100054595 3300005578 Bacteria 2874
97 Ga0068854_100456844 3300005578 Bacteria 1068
98 Ga0068856_100025810 3300005614 Bacteria 5729
99 Ga0068856_100086186 3300005614 Bacteria 3120
100 Ga0068856_100148450 3300005614 Bacteria 2352
101 Ga0068856_100311845 3300005614 Bacteria 1591
102 Ga0070702_100046334 3300005615 Bacteria 2464
103 Ga0068852_100000992 3300005616 Bacteria 18727
104 Ga0068852_100096015 3300005616 Bacteria 2663
105 Ga0068859_100122134 3300005617 Bacteria 2671
106 Ga0068859_100194959 3300005617 Bacteria 2110
107 Ga0068859_100547393 3300005617 Bacteria 1252
108 Ga0068864_100036796 3300005618 Bacteria 4174
109 Ga0068864_100737224 3300005618 Bacteria 965
110 Ga0068863_100108873 3300005841 Bacteria 2637
111 Ga0068858_100060572 3300005842 Bacteria 3498
112 Ga0068860_100256270 3300005843 Bacteria 1705
113 Ga0068860_100283396 3300005843 Bacteria 1620
114 Ga0081455_10294659 3300005937 Bacteria 1166
115 Ga0081539_10076269 3300005985 Bacteria 1777
116 Ga0097621_100027712 3300006237 Bacteria 4458
117 Ga0068871_100011802 3300006358 Bacteria 6421
118 Ga0068871_100040808 3300006358 Bacteria 3718
119 Ga0068871_100107840 3300006358 Bacteria 2340
120 Ga0068871_100107873 3300006358 Bacteria 2339
121 Ga0097620_100122135 3300006931 Bacteria 2671
122 Ga0097620_100194969 3300006931 Bacteria 2110
123 Ga0097620_100547356 3300006931 Bacteria 1252
124 Ga0111539_10203434 3300009094 Bacteria 2308
125 Ga0111539_10357412 3300009094 Bacteria 1700
126 Ga0105245_10031655 3300009098 Bacteria 4682
127 Ga0105243_10241428 3300009148 Bacteria 1608
128 Ga0105241_10008151 3300009174 Bacteria 7716
129 Ga0105242_10372630 3300009176 Bacteria 1325
130 Ga0105248_10002448 3300009177 Bacteria 20617
131 Ga0105248_10010251 3300009177 Bacteria 10317
132 Ga0105248_10011642 3300009177 Bacteria 9692
133 Ga0105248_10015484 3300009177 Bacteria 8407
134 Ga0105248_10023918 3300009177 Bacteria 6791
135 Ga0105248_10043344 3300009177 Bacteria 5045
136 Ga0105248_10143588 3300009177 Bacteria 2693
137 Ga0105237_10035322 3300009545 Bacteria 5058
138 Ga0105238_10071669 3300009551 Bacteria 3463
139 Ga0157373_10024138 3300013100 Bacteria 4407
140 Ga0157371_10000558 3300013102 Bacteria 44161
141 Ga0157371_10012501 3300013102 Bacteria 6487
142 Ga0157371_10148624 3300013102 Bacteria 1671
143 Ga0157370_10002072 3300013104 Bacteria 24554
144 Ga0157370_10030834 3300013104 Bacteria 5252
145 Ga0157370_10037433 3300013104 Bacteria 4703
146 Ga0157370_10091021 3300013104 Bacteria 2864
147 Ga0157369_10002493 3300013105 Bacteria 22063
148 Ga0157369_10120803 3300013105 Bacteria 2780
149 Ga0157369_10155369 3300013105 Bacteria 2417
150 Ga0157369_10456680 3300013105 Bacteria 1323
151 Ga0157374_10011026 3300013296 Bacteria 7805
152 Ga0157374_10401798 3300013296 Bacteria 1367
153 Ga0163162_10008489 3300013306 Bacteria 10023
154 Ga0163162_10118073 3300013306 Bacteria 2754
155 Ga0163162_10869976 3300013306 Bacteria 1016
156 Ga0157372_10008481 3300013307 Bacteria 10908
157 Ga0157375_10009672 3300013308 Bacteria 8477
158 Ga0157375_10024673 3300013308 Bacteria 5570
159 Ga0163163_10003869 3300014325 Bacteria 12754
160 Ga0157380_10042814 3300014326 Bacteria 3542
161 Ga0157380_10124985 3300014326 Bacteria 2185
162 Ga0157380_10700492 3300014326 Bacteria 1018
163 Ga0157379_10337349 3300014968 Bacteria 1378
164 Ga0157376_10125371 3300014969 Bacteria 2283
165 Ga0163161_10012455 3300017792 Bacteria 5905
166 Ga0206356_11219040 3300020070 Bacteria 1024
167 Ga0207656_10009144 3300025321 Bacteria 3673
168 Ga0207680_10038288 3300025903 Bacteria 2775
169 Ga0207647_10007320 3300025904 Bacteria 7984
170 Ga0207647_10020576 3300025904 Bacteria 4421
171 Ga0207647_10024281 3300025904 Bacteria 3999
172 Ga0207705_10000190 3300025909 Bacteria 62546
173 Ga0207705_10011826 3300025909 Bacteria 6306
174 Ga0207705_10020917 3300025909 Bacteria 4668
175 Ga0207705_10040193 3300025909 Bacteria 3353
176 Ga0207705_10042965 3300025909 Bacteria 3245
177 Ga0207705_10101543 3300025909 Bacteria 2116
178 Ga0207705_10224883 3300025909 Bacteria 1426
179 Ga0207705_10341149 3300025909 Bacteria 1153
180 Ga0207705_10373692 3300025909 Bacteria 1101
181 Ga0207684_10240692 3300025910 Bacteria 1561
182 Ga0207654_10066570 3300025911 Bacteria 2125
183 Ga0207707_10093926 3300025912 Bacteria 2620
184 Ga0207695_10008696 3300025913 Bacteria 12665
185 Ga0207660_10000522 3300025917 Bacteria 25663
186 Ga0207660_10017605 3300025917 Bacteria 4751
187 Ga0207660_10058623 3300025917 Bacteria 2762
188 Ga0207660_10061826 3300025917 Bacteria 2696
189 Ga0207657_10000407 3300025919 Bacteria 45521
190 Ga0207657_10000434 3300025919 Bacteria 44542
191 Ga0207657_10001170 3300025919 Bacteria 27822
192 Ga0207657_10002570 3300025919 Bacteria 19633
193 Ga0207657_10006672 3300025919 Bacteria 11938
194 Ga0207657_10170292 3300025919 Bacteria 1765
195 Ga0207649_10042736 3300025920 Bacteria 2766
196 Ga0207649_10055038 3300025920 Bacteria 2479
197 Ga0207652_10000034 3300025921 Bacteria 138571
198 Ga0207652_10077579 3300025921 Bacteria 2899
199 Ga0207681_10061720 3300025923 Bacteria 2578
200 Ga0207681_10117097 3300025923 Bacteria 1948
201 Ga0207681_10125934 3300025923 Bacteria 1886
202 Ga0207694_10014383 3300025924 Bacteria 5964
203 Ga0207650_10063173 3300025925 Bacteria 2768
204 Ga0207650_10208603 3300025925 Bacteria 1568
205 Ga0207659_10043018 3300025926 Bacteria 3170
206 Ga0207659_10090676 3300025926 Bacteria 2282
207 Ga0207700_10020634 3300025928 Bacteria 4480
208 Ga0207664_10328956 3300025929 Bacteria 1349
209 Ga0207644_10003259 3300025931 Bacteria 10480
210 Ga0207644_10039361 3300025931 Bacteria 3336
211 Ga0207644_10039509 3300025931 Bacteria 3331
212 Ga0207690_10009186 3300025932 Bacteria 5869
213 Ga0207690_10269093 3300025932 Bacteria 1323
214 Ga0207706_10000299 3300025933 Bacteria 53751
215 Ga0207706_10000614 3300025933 Bacteria 37833
216 Ga0207706_10059977 3300025933 Bacteria 3351
217 Ga0207706_10091405 3300025933 Bacteria 2676
218 Ga0207670_10503583 3300025936 Bacteria 983
219 Ga0207691_10008543 3300025940 Bacteria 9832
220 Ga0207691_10183139 3300025940 Bacteria 1829
221 Ga0207711_10004361 3300025941 Bacteria 12073
222 Ga0207711_10006081 3300025941 Bacteria 10197
223 Ga0207661_10052199 3300025944 Bacteria 3266
224 Ga0207661_10071601 3300025944 Bacteria 2833
225 Ga0207679_10005366 3300025945 Bacteria 8037
226 Ga0207679_10019153 3300025945 Bacteria 4595
227 Ga0207679_10149681 3300025945 Bacteria 1898
228 Ga0207667_10001479 3300025949 Bacteria 29480
229 Ga0207667_10006989 3300025949 Bacteria 13637
230 Ga0207667_10007585 3300025949 Bacteria 13014
231 Ga0207651_10012721 3300025960 Bacteria 4777
232 Ga0207651_10036190 3300025960 Bacteria 3220
233 Ga0207640_10041384 3300025981 Bacteria 2930
234 Ga0207640_10231127 3300025981 Bacteria 1423
235 Ga0207640_10411793 3300025981 Bacteria 1104
236 Ga0207658_10019175 3300025986 Bacteria 4729
237 Ga0207658_10115260 3300025986 Bacteria 2132
238 Ga0207703_10015301 3300026035 Bacteria 5984
239 Ga0207639_10006339 3300026041 Bacteria 8033
240 Ga0207639_10448822 3300026041 Bacteria 1170
241 Ga0207678_10000117 3300026067 Bacteria 65678
242 Ga0207678_10007320 3300026067 Bacteria 9777
243 Ga0207678_10012837 3300026067 Bacteria 7354
244 Ga0207702_10004609 3300026078 Bacteria 12211
245 Ga0207702_10116007 3300026078 Bacteria 2389
246 Ga0207702_10357253 3300026078 Bacteria 1399
247 Ga0207641_10025094 3300026088 Bacteria 4913
248 Ga0207641_10173856 3300026088 Bacteria 1968
249 Ga0207676_10005862 3300026095 Bacteria 8678
250 Ga0207674_10001687 3300026116 Bacteria 28359
251 Ga0207674_10190371 3300026116 Bacteria 2001
252 Ga0207674_10306574 3300026116 Bacteria 1537
253 Ga0207683_10000846 3300026121 Bacteria 28093
254 Ga0207683_10380499 3300026121 Bacteria 1297
255 Ga0207698_10000739 3300026142 Bacteria 18966
256 Ga0207698_10003349 3300026142 Bacteria 9648
257 Ga0207698_10009108 3300026142 Bacteria 6309
258 Ga0209974_10005013 3300027876 Bacteria 4682
259 Ga0268266_10021666 3300028379 Bacteria 5476
260 Ga0268264_10401319 3300028381 Bacteria 1317
261 Ga0316182_1092962 3300030745 Bacteria 3541
262 Ga0307408_100001159 3300031548 Bacteria 20050
263 Ga0307408_100094117 3300031548 Bacteria 2268
264 Ga0307408_100115450 3300031548 Bacteria 2071
265 Ga0307405_10000240 3300031731 Bacteria 19933
266 Ga0307405_10050728 3300031731 Bacteria 2571
267 Ga0307413_10000456 3300031824 Bacteria 13342
268 Ga0307413_10000616 3300031824 Bacteria 11983
269 Ga0307413_10006414 3300031824 Bacteria 5367
270 Ga0307413_10012285 3300031824 Bacteria 4255
271 Ga0307413_10041811 3300031824 Bacteria 2687
272 Ga0307410_10000393 3300031852 Bacteria 17209
273 Ga0307410_10002578 3300031852 Bacteria 8796
274 Ga0307410_10005302 3300031852 Bacteria 6807
275 Ga0307410_10006997 3300031852 Bacteria 6138
276 Ga0307410_10026850 3300031852 Bacteria 3630
277 Ga0307410_10074428 3300031852 Bacteria 2365
278 Ga0307410_10178721 3300031852 Bacteria 1605
279 Ga0307410_10253780 3300031852 Bacteria 1368
280 Ga0307406_10011286 3300031901 Bacteria 5066
281 Ga0307406_10026141 3300031901 Bacteria 3502
282 Ga0307406_10072428 3300031901 Bacteria 2262
283 Ga0307407_10000541 3300031903 Bacteria 11794
284 Ga0307407_10043037 3300031903 Bacteria 2536
285 Ga0307407_10068400 3300031903 Bacteria 2103
286 Ga0307407_10243127 3300031903 Bacteria 1229
287 Ga0307412_10000248 3300031911 Bacteria 35008
288 Ga0307412_10102221 3300031911 Bacteria 2029
289 Ga0307412_10553028 3300031911 Bacteria 967
290 Ga0307409_100000418 3300031995 Bacteria 18065
291 Ga0307409_100006369 3300031995 Bacteria 6927
292 Ga0307409_100011560 3300031995 Bacteria 5575
293 Ga0307409_100012525 3300031995 Bacteria 5409
294 Ga0307409_100022018 3300031995 Bacteria 4384
295 Ga0307409_100075857 3300031995 Bacteria 2694
296 Ga0307409_100189691 3300031995 Bacteria 1828
297 Ga0307409_100257083 3300031995 Bacteria 1600
298 Ga0307416_100001974 3300032002 Bacteria 11501
299 Ga0307416_100035228 3300032002 Bacteria 3820
300 Ga0307416_100058866 3300032002 Bacteria 3118
301 Ga0307416_100248520 3300032002 Bacteria 1729
302 Ga0307416_100302028 3300032002 Bacteria 1592
303 Ga0307414_10002328 3300032004 Bacteria 9923
304 Ga0307414_10002750 3300032004 Bacteria 9260
305 Ga0307414_10008907 3300032004 Bacteria 5731
306 Ga0307414_10040931 3300032004 Bacteria 3133
307 Ga0307414_10048965 3300032004 Bacteria 2919
308 Ga0307414_10138674 3300032004 Bacteria 1900
309 Ga0307414_10215197 3300032004 Bacteria 1573
310 Ga0307414_10259620 3300032004 Bacteria 1449
311 Ga0307414_10292787 3300032004 Bacteria 1373
312 Ga0307411_10001520 3300032005 Bacteria 9552
313 Ga0307411_10001702 3300032005 Bacteria 9227
314 Ga0307411_10003799 3300032005 Bacteria 7101
315 Ga0307411_10006302 3300032005 Bacteria 5924
316 Ga0307411_10028080 3300032005 Bacteria 3415
317 Ga0307411_10076736 3300032005 Bacteria 2285
318 Ga0307411_10186315 3300032005 Bacteria 1580
319 Ga0307411_10243908 3300032005 Bacteria 1408
320 Ga0307415_100000898 3300032126 Bacteria 13619
321 Ga0307415_100014987 3300032126 Bacteria 4575
322 Ga0307415_100115216 3300032126 Bacteria 2003
323 Ga0373923_0014336 3300035111 Bacteria 2977
324 Ga0373956_0097029 3300035119 Bacteria 1364
325 Ga0373955_0002116 3300035172 Bacteria 8574
326 Ga0373935_0180907 3300035692 Bacteria 1448
327 Ga0373933_0039863 3300035724 Bacteria 2764
328 Ga0373937_0009792 3300036401 Bacteria 8356
329 Ga0395899_0000737 3300037312 Bacteria 32666
330 Ga0395899_0002732 3300037312 Bacteria 14223
331 Ga0395899_0031691 3300037312 Bacteria 3972
332 Ga0395899_0084479 3300037312 Bacteria 2307
333 Ga0395899_0123738 3300037312 Bacteria 1851
334 Ga0395899_0290832 3300037312 Bacteria 1108
335 Ga0395899_0484478 3300037312 Bacteria 805
336 Ga0395900_0000364 3300037418 Bacteria 65068
337 Ga0395900_0002957 3300037418 Bacteria 18497
338 Ga0395900_0003165 3300037418 Bacteria 17843
339 Ga0395900_0023430 3300037418 Bacteria 6319
340 Ga0395900_0057239 3300037418 Bacteria 4013
341 Ga0395900_0078313 3300037418 Bacteria 3396
342 Ga0395900_0158149 3300037418 Bacteria 2313
343 Ga0395900_0451059 3300037418 Bacteria 1242
344 Ga0395900_0517033 3300037418 Bacteria 1142
345 Ga0395898_0001674 3300037466 Bacteria 29720
346 Ga0395898_0008082 3300037466 Bacteria 11141
347 Ga0395898_0018496 3300037466 Bacteria 7102
348 Ga0395898_0093627 3300037466 Bacteria 2887
349 Ga0395898_0212151 3300037466 Bacteria 1847
350 Ga0395905_0002780 3300037471 Bacteria 19161
351 Ga0395905_0005143 3300037471 Bacteria 13426
352 Ga0395905_0011712 3300037471 Bacteria 8466
353 Ga0395905_0029605 3300037471 Bacteria 5160
354 Ga0395905_0042896 3300037471 Bacteria 4244
355 Ga0395905_0074702 3300037471 Bacteria 3177
356 Ga0395905_0090102 3300037471 Bacteria 2875
357 Ga0395905_0136771 3300037471 Bacteria 2305
358 Ga0395905_0268194 3300037471 Bacteria 1593
359 Ga0395905_0348627 3300037471 Bacteria 1372
360 Ga0395901_0000209 3300038443 Bacteria 73635
361 Ga0395901_0002161 3300038443 Bacteria 20073
362 Ga0395901_0002401 3300038443 Bacteria 19031
363 Ga0395901_0014467 3300038443 Bacteria 8027
364 Ga0395901_0022448 3300038443 Bacteria 6468
365 Ga0395901_0098750 3300038443 Bacteria 3061
366 Ga0395901_0642934 3300038443 Bacteria 1065
367 Ga0439465_0041537 3300041413 Bacteria 1489
368 Ga0439443_001025 3300042003 Bacteria 2891
369 Ga0439432_008855 3300042006 Bacteria 3519
370 Ga0450917_000869 3300042120 Bacteria 2217
371 Ga0450905_001715 3300042142 Bacteria 2800
372 Ga0450889_000026 3300042144 Bacteria 12524
373 Ga0466969_0001727 3300044656 Bacteria 11674
374 Ga0466963_0004881 3300044694 Bacteria 7818
375 Ga0466963_0032354 3300044694 Bacteria 3386
376 Ga0466963_0064543 3300044694 Bacteria 2453
377 Ga0466971_0051275 3300044719 Bacteria 1857
378 Ga0466970_0202183 3300044765 Bacteria 1105
379 Ga0466957_0011026 3300044842 Bacteria 5199
380 Ga0466957_0048022 3300044842 Bacteria 2594
381 Ga0466957_0105413 3300044842 Bacteria 1782
382 Ga0466960_0074885 3300044901 Bacteria 1693
383 Ga0466958_0036087 3300045836 Bacteria 2957
384 Ga0466967_0154008 3300045976 Bacteria 2151
385 Ga0466967_0419278 3300045976 Bacteria 1304
386 Ga0495629_0122483 3300046459 Bacteria 1812
387 Ga0495663_0000437 3300046525 Bacteria 15256
388 Ga0495663_0009014 3300046525 Bacteria 2765
389 Ga0495598_0048456 3300046537 Bacteria 1270
390 Ga0495621_0001033 3300046539 Bacteria 7136
391 Ga0495621_0019838 3300046539 Bacteria 2199
392 Ga0495633_0005156 3300046558 Bacteria 8093
393 Ga0495623_0055787 3300046679 Bacteria 2489
394 Ga0495669_0104725 3300046684 Bacteria 1316
395 Ga0495670_0073900 3300046691 Bacteria 1728
396 Ga0495670_0082648 3300046691 Bacteria 1637
397 Ga0495677_0014545 3300047445 Bacteria 2864
398 Ga0495602_0009401 3300048088 Bacteria 10171
399 Ga0496100_0039974 3300048903 Bacteria 2981
400 Ga0496101_0481677 3300048904 Bacteria 980
401 Ga0496102_0058941 3300048905 Bacteria 3509
402 Ga0496102_0071624 3300048905 Bacteria 3183
403 Ga0496103_0033555 3300048906 Bacteria 3136
404 Ga0496104_0098901 3300048907 Bacteria 2793
405 Ga0496105_0206810 3300048908 Bacteria 1601
406 Ga0496106_0231527 3300048909 Bacteria 1475
407 Ga0496107_0002340 3300048910 Bacteria 12240
408 Ga0496107_0561029 3300048910 Bacteria 845
409 Ga0496108_0004508 3300048911 Bacteria 11220
410 Ga0496108_0094661 3300048911 Bacteria 2542
411 Ga0496109_0005202 3300048912 Bacteria 10866
412 Ga0496109_0031197 3300048912 Bacteria 4781
413 Ga0496109_0082081 3300048912 Bacteria 2970
414 Ga0496110_0033843 3300048913 Bacteria 4423
415 Ga0496110_0058217 3300048913 Bacteria 3403
416 Ga0496111_0088347 3300048914 Bacteria 2270
417 Ga0496112_0038183 3300048915 Bacteria 4689
418 Ga0496112_0096320 3300048915 Bacteria 2929
419 Ga0496113_0016797 3300048916 Bacteria 5063
420 Ga0496114_0011945 3300048917 Bacteria 6949
421 Ga0496114_0154271 3300048917 Bacteria 1993
422 Ga0496115_0082760 3300048918 Bacteria 2615
423 Ga0496126_0134508 3300048929 Bacteria 2134
424 Ga0501270_001859 3300049767 Bacteria 2092
425 nmdc:mga08y16_11359_c1 3300050511 Bacteria 9357
426 nmdc:mga0rr50_148155_c1 3300050513 Bacteria 1894
427 Ga0466962_0155566 3300061719 Bacteria 1110
428 Ga0307513_10229936
429 JGI24735J21928_10038908
430 Ga0070658_10000716
431 Ga0070658_10006789
432 Ga0070658_10015929
433 Ga0070658_10019746
434 Ga0070658_10030877
435 Ga0070658_10034315
436 Ga0070658_10037800
437 Ga0070658_10067826
438 Ga0070658_10088557
439 Ga0070658_10185352
440 Ga0070658_10361932
441 Ga0070683_100004410
442 Ga0070683_100256159
443 Ga0070670_100013283
444 Ga0070670_100144782
445 Ga0070666_10028403
446 Ga0070680_100000683
447 Ga0070680_100038807
448 Ga0070680_100068084
449 Ga0070680_100153152
450 Ga0070680_100196956
451 Ga0070682_100031482
452 Ga0070682_100479931
453 Ga0068868_100024230
454 Ga0070660_100000116
455 Ga0070660_100000212
456 Ga0070660_100002966
457 Ga0070660_100012361
458 Ga0070660_100016827
459 Ga0070660_100054211
460 Ga0070660_100152809
461 Ga0070660_100167702
462 Ga0070660_100211971
463 Ga0070691_10014120
464 Ga0070661_100033054
465 Ga0070661_100058327
466 Ga0070661_100089363
467 Ga0070661_100126103
468 Ga0070661_100357267
469 Ga0070668_100056363
470 Ga0070669_100012623
471 Ga0070675_100102200
472 Ga0070671_100015323
473 Ga0070671_100048903
474 Ga0070671_100105660
475 Ga0070671_100412295
476 Ga0070673_100015784
477 Ga0070673_100111029
478 Ga0070659_100189262
479 Ga0070659_100207936
480 Ga0070667_100004843
481 Ga0070714_100008795
482 Ga0070714_100111818
483 Ga0070713_100016703
484 Ga0070663_100010506
485 Ga0070663_100018786
486 Ga0070663_100029561
487 Ga0070663_100216614
488 Ga0070663_100231764
489 Ga0070678_100014387
490 Ga0070678_100061255
491 Ga0070662_100001195
492 Ga0070662_100003219
493 Ga0070681_10095129
494 Ga0070681_10215233
495 Ga0070681_10438626
496 Ga0070706_100292441
497 Ga0070679_100011164
498 Ga0070679_100014712
499 Ga0070679_100065088
500 Ga0070679_100159144
501 Ga0070679_100280127
502 Ga0070684_100025317
503 Ga0070684_100128358
504 Ga0070672_100012806
505 Ga0070672_100028979
506 Ga0070672_100118009
507 Ga0070686_100528108
508 Ga0070695_100074433
509 Ga0070696_100014446
510 Ga0070665_100023460
511 Ga0068855_100000079
512 Ga0068855_100039788
513 Ga0068855_100114300
514 Ga0068855_100144965
515 Ga0068855_100232768
516 Ga0070664_100004847
517 Ga0070664_100043752
518 Ga0070664_100159522
519 Ga0070664_100166026
520 Ga0068857_100016959
521 Ga0068857_100168334
522 Ga0068854_100002329
523 Ga0068854_100054595
524 Ga0068854_100456844
525 Ga0068856_100025810
526 Ga0068856_100086186
527 Ga0068856_100148450
528 Ga0068856_100311845
529 Ga0070702_100046334
530 Ga0068852_100000992
531 Ga0068852_100096015
532 Ga0068859_100122134
533 Ga0068859_100194959
534 Ga0068859_100547393
535 Ga0068864_100036796
536 Ga0068864_100737224
537 Ga0068863_100108873
538 Ga0068858_100060572
539 Ga0068860_100256270
540 Ga0068860_100283396
541 Ga0081455_10294659
542 Ga0081539_10076269
543 Ga0097621_100027712
544 Ga0068871_100011802
545 Ga0068871_100040808
546 Ga0068871_100107840
547 Ga0068871_100107873
548 Ga0097620_100122135
549 Ga0097620_100194969
550 Ga0097620_100547356
551 Ga0111539_10203434
552 Ga0111539_10357412
553 Ga0105245_10031655
554 Ga0105243_10241428
555 Ga0105241_10008151
556 Ga0105242_10372630
557 Ga0105248_10002448
558 Ga0105248_10010251
559 Ga0105248_10011642
560 Ga0105248_10015484
561 Ga0105248_10023918
562 Ga0105248_10043344
563 Ga0105248_10143588
564 Ga0105237_10035322
565 Ga0105238_10071669
566 Ga0157373_10024138
567 Ga0157371_10000558
568 Ga0157371_10012501
569 Ga0157371_10148624
570 Ga0157370_10002072
571 Ga0157370_10030834
572 Ga0157370_10037433
573 Ga0157370_10091021
574 Ga0157369_10002493
575 Ga0157369_10120803
576 Ga0157369_10155369
577 Ga0157369_10456680
578 Ga0157374_10011026
579 Ga0157374_10401798
580 Ga0163162_10008489
581 Ga0163162_10118073
582 Ga0163162_10869976
583 Ga0157372_10008481
584 Ga0157375_10009672
585 Ga0157375_10024673
586 Ga0163163_10003869
587 Ga0157380_10042814
588 Ga0157380_10124985
589 Ga0157380_10700492
590 Ga0157379_10337349
591 Ga0157376_10125371
592 Ga0163161_10012455
593 Ga0206356_11219040
594 Ga0207656_10009144
595 Ga0207680_10038288
596 Ga0207647_10007320
597 Ga0207647_10020576
598 Ga0207647_10024281
599 Ga0207705_10000190
600 Ga0207705_10011826
601 Ga0207705_10020917
602 Ga0207705_10040193
603 Ga0207705_10042965
604 Ga0207705_10101543
605 Ga0207705_10224883
606 Ga0207705_10341149
607 Ga0207705_10373692
608 Ga0207684_10240692
609 Ga0207654_10066570
610 Ga0207707_10093926
611 Ga0207695_10008696
612 Ga0207660_10000522
613 Ga0207660_10017605
614 Ga0207660_10058623
615 Ga0207660_10061826
616 Ga0207657_10000407
617 Ga0207657_10000434
618 Ga0207657_10001170
619 Ga0207657_10002570
620 Ga0207657_10006672
621 Ga0207657_10170292
622 Ga0207649_10042736
623 Ga0207649_10055038
624 Ga0207652_10000034
625 Ga0207652_10077579
626 Ga0207681_10061720
627 Ga0207681_10117097
628 Ga0207681_10125934
629 Ga0207694_10014383
630 Ga0207650_10063173
631 Ga0207650_10208603
632 Ga0207659_10043018
633 Ga0207659_10090676
634 Ga0207700_10020634
635 Ga0207664_10328956
636 Ga0207644_10003259
637 Ga0207644_10039361
638 Ga0207644_10039509
639 Ga0207690_10009186
640 Ga0207690_10269093
641 Ga0207706_10000299
642 Ga0207706_10000614
643 Ga0207706_10059977
644 Ga0207706_10091405
645 Ga0207670_10503583
646 Ga0207691_10008543
647 Ga0207691_10183139
648 Ga0207711_10004361
649 Ga0207711_10006081
650 Ga0207661_10052199
651 Ga0207661_10071601
652 Ga0207679_10005366
653 Ga0207679_10019153
654 Ga0207679_10149681
655 Ga0207667_10001479
656 Ga0207667_10006989
657 Ga0207667_10007585
658 Ga0207651_10012721
659 Ga0207651_10036190
660 Ga0207640_10041384
661 Ga0207640_10231127
662 Ga0207640_10411793
663 Ga0207658_10019175
664 Ga0207658_10115260
665 Ga0207703_10015301
666 Ga0207639_10006339
667 Ga0207639_10448822
668 Ga0207678_10000117
669 Ga0207678_10007320
670 Ga0207678_10012837
671 Ga0207702_10004609
672 Ga0207702_10116007
673 Ga0207702_10357253
674 Ga0207641_10025094
675 Ga0207641_10173856
676 Ga0207676_10005862
677 Ga0207674_10001687
678 Ga0207674_10190371
679 Ga0207674_10306574
680 Ga0207683_10000846
681 Ga0207683_10380499
682 Ga0207698_10000739
683 Ga0207698_10003349
684 Ga0207698_10009108
685 Ga0209974_10005013
686 Ga0268266_10021666
687 Ga0268264_10401319
688 Ga0316182_1092962
689 Ga0307408_100001159
690 Ga0307408_100094117
691 Ga0307408_100115450
692 Ga0307405_10000240
693 Ga0307405_10050728
694 Ga0307413_10000456
695 Ga0307413_10000616
696 Ga0307413_10006414
697 Ga0307413_10012285
698 Ga0307413_10041811
699 Ga0307410_10000393
700 Ga0307410_10002578
701 Ga0307410_10005302
702 Ga0307410_10006997
703 Ga0307410_10026850
704 Ga0307410_10074428
705 Ga0307410_10178721
706 Ga0307410_10253780
707 Ga0307406_10011286
708 Ga0307406_10026141
709 Ga0307406_10072428
710 Ga0307407_10000541
711 Ga0307407_10043037
712 Ga0307407_10068400
713 Ga0307407_10243127
714 Ga0307412_10000248
715 Ga0307412_10102221
716 Ga0307412_10553028
717 Ga0307409_100000418
718 Ga0307409_100006369
719 Ga0307409_100011560
720 Ga0307409_100012525
721 Ga0307409_100022018
722 Ga0307409_100075857
723 Ga0307409_100189691
724 Ga0307409_100257083
725 Ga0307416_100001974
726 Ga0307416_100035228
727 Ga0307416_100058866
728 Ga0307416_100248520
729 Ga0307416_100302028
730 Ga0307414_10002328
731 Ga0307414_10002750
732 Ga0307414_10008907
733 Ga0307414_10040931
734 Ga0307414_10048965
735 Ga0307414_10138674
736 Ga0307414_10215197
737 Ga0307414_10259620
738 Ga0307414_10292787
739 Ga0307411_10001520
740 Ga0307411_10001702
741 Ga0307411_10003799
742 Ga0307411_10006302
743 Ga0307411_10028080
744 Ga0307411_10076736
745 Ga0307411_10186315
746 Ga0307411_10243908
747 Ga0307415_100000898
748 Ga0307415_100014987
749 Ga0307415_100115216
750 Ga0373923_0014336
751 Ga0373956_0097029
752 Ga0373955_0002116
753 Ga0373935_0180907
754 Ga0373933_0039863
755 Ga0373937_0009792
756 Ga0395899_0000737
757 Ga0395899_0002732
758 Ga0395899_0031691
759 Ga0395899_0084479
760 Ga0395899_0123738
761 Ga0395899_0290832
762 Ga0395899_0484478
763 Ga0395900_0000364
764 Ga0395900_0002957
765 Ga0395900_0003165
766 Ga0395900_0023430
767 Ga0395900_0057239
768 Ga0395900_0078313
769 Ga0395900_0158149
770 Ga0395900_0451059
771 Ga0395900_0517033
772 Ga0395898_0001674
773 Ga0395898_0008082
774 Ga0395898_0018496
775 Ga0395898_0093627
776 Ga0395898_0212151
777 Ga0395905_0002780
778 Ga0395905_0005143
779 Ga0395905_0011712
780 Ga0395905_0029605
781 Ga0395905_0042896
782 Ga0395905_0074702
783 Ga0395905_0090102
784 Ga0395905_0136771
785 Ga0395905_0268194
786 Ga0395905_0348627
787 Ga0395901_0000209
788 Ga0395901_0002161
789 Ga0395901_0002401
790 Ga0395901_0014467
791 Ga0395901_0022448
792 Ga0395901_0098750
793 Ga0395901_0642934
794 Ga0439465_0041537
795 Ga0439443_001025
796 Ga0439432_008855
797 Ga0450917_000869
798 Ga0450905_001715
799 Ga0450889_000026
800 Ga0466969_0001727
801 Ga0466963_0004881
802 Ga0466963_0032354
803 Ga0466963_0064543
804 Ga0466971_0051275
805 Ga0466970_0202183
806 Ga0466957_0011026
807 Ga0466957_0048022
808 Ga0466957_0105413
809 Ga0466960_0074885
810 Ga0466958_0036087
811 Ga0466967_0154008
812 Ga0466967_0419278
813 Ga0495629_0122483
814 Ga0495663_0000437
815 Ga0495663_0009014
816 Ga0495598_0048456
817 Ga0495621_0001033
818 Ga0495621_0019838
819 Ga0495633_0005156
820 Ga0495623_0055787
821 Ga0495669_0104725
822 Ga0495670_0073900
823 Ga0495670_0082648
824 Ga0495677_0014545
825 Ga0495602_0009401
826 Ga0496100_0039974
827 Ga0496101_0481677
828 Ga0496102_0058941
829 Ga0496102_0071624
830 Ga0496103_0033555
831 Ga0496104_0098901
832 Ga0496105_0206810
833 Ga0496106_0231527
834 Ga0496107_0002340
835 Ga0496107_0561029
836 Ga0496108_0004508
837 Ga0496108_0094661
838 Ga0496109_0005202
839 Ga0496109_0031197
840 Ga0496109_0082081
841 Ga0496110_0033843
842 Ga0496110_0058217
843 Ga0496111_0088347
844 Ga0496112_0038183
845 Ga0496112_0096320
846 Ga0496113_0016797
847 Ga0496114_0011945
848 Ga0496114_0154271
849 Ga0496115_0082760
850 Ga0496126_0134508
851 Ga0501270_001859
852 nmdc:mga08y16_11359_c1
853 nmdc:mga0rr50_148155_c1
854 Ga0466962_0155566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14602

Hexapep_2

Hexapeptide repeat of succinyl-transferase

126

153

0.93

PF14805

THDPS_N_2

Tetrahydrodipicolinate N-succinyltransferase N-terminal

4

69

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lcn-assembly1.cif.gz_A crystal structure of serine acetyltransferase from planctomyces limnophilus at 2.15a 0.9224 128 182
3mc4-assembly1.cif.gz_A crystal structure of ww/rsp5/wwp domain: bacterial transferase hexapeptide repeat: serine o-acetyltransferase from brucella melitensis 0.8606 128 207
3mqh-assembly2.cif.gz_D crystal structure of the 3-n-acetyl transferase wlbb from bordetella petrii in complex with coa and udp-3-amino-2-acetamido-2,3-dideoxy glucuronic acid 0.8429 124 198
7ojq-assembly1.cif.gz_B crystal structure of pseudomonas aeruginosa lpxa in complex with compound 7 0.8346 126 198
4e6u-assembly1.cif.gz_A structure of lpxa from acinetobacter baumannii at 1.4a resolution (p63 form) 0.8319 126 198
ID Description Score Start End Superfamily
3eg4A01 Mainly Alpha;Orthogonal Bundle;Tetrahydrodipicolinate-N-succinyltransferase; Chain A, domain 1;Tetrahydrodipicolinate-N-succinyltransferase, N-terminal domain 0.9923 3 70 1.10.166.10
3tk8C01 Mainly Alpha;Orthogonal Bundle;Tetrahydrodipicolinate-N-succinyltransferase; Chain A, domain 1;Tetrahydrodipicolinate-N-succinyltransferase, N-terminal domain 0.9656 3 70 1.10.166.10
3tk8A01 Mainly Alpha;Orthogonal Bundle;Tetrahydrodipicolinate-N-succinyltransferase; Chain A, domain 1;Tetrahydrodipicolinate-N-succinyltransferase, N-terminal domain 0.9634 1 70 1.10.166.10
3eg4A01 Mainly Alpha;Orthogonal Bundle;Tetrahydrodipicolinate-N-succinyltransferase; Chain A, domain 1;Tetrahydrodipicolinate-N-succinyltransferase, N-terminal domain 0.9507 3 70 1.10.166.10
6amyA01 Mainly Alpha;Orthogonal Bundle;Tetrahydrodipicolinate-N-succinyltransferase; Chain A, domain 1;Tetrahydrodipicolinate-N-succinyltransferase, N-terminal domain 0.9426 4 70 1.10.166.10
ID Description Score Start End GO Terms
AF-A0A2M7Y8I7-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase 0.9937 3 58 GO:0016740
AF-A0A357L102-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase 0.9705 1 58 GO:0016740
AF-A0A432JFU5-F1-model_v4 deleted 0.9703 3 70
AF-A0A3D5STC6-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase (EC 2.3.1.117) 0.9698 132 203 GO:0008666
AF-A0A6L8I4G4-F1-model_v4 2,3,4,5-tetrahydropyridine-2,6-dicarboxylate N-succinyltransferase 0.9667 1 68 GO:0016740

Map