F441445

General Info

Members Datasets Scaffolds Average Seq Length
427 186 854 189

Family's Representative Sequence

Representative Sequence 3300013100|Ga0157373_10581719|Ga0157373_105817191
Length 206
Sequence MPDNLQTSCVKDWSYTMKMIMLAVLLATASFAVMAQQPNAPAERRVALTDTAVALDAAGASALEGSLRTTALNGTPDSPVTNIRMVVKNSSAIAYAFASGLVTFYDASGVRCGEGLFKADALAVGEAFETDTPGIRIRCSPATWRIIATNLLPRVAPVIGTVAPASPTAMNLFISIDGEEHPLQIDRPLVLTMGNVQRTIVVRSTP

Samples

Sample ID Description Type Environment
1 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
138 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
139 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
140 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
141 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
142 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
143 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
144 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
145 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
146 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
150 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
151 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
155 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
156 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
157 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
160 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
161 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
162 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
163 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
164 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
165 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
166 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
167 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
168 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
169 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
170 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
171 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
172 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
173 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
174 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
175 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
176 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
177 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
178 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
179 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
180 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
181 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
182 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
185 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
186 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.17
Rhizosphere 98.59
Stem 0
Stem Tuber 0
Unclassified 19.44

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157373_10581719 3300013100 Bacteria 814
2 SwRhRL2b_contig_857298 2162886007 Unclassified 2835
3 MBSR1b_contig_1582499 2162886012 Unclassified 1102
4 LJNas_1008245 3300000546 Bacteria 1120
5 rootL2_10107163 3300003322 Bacteria 1850
6 Ga0065704_10112007 3300005289 Bacteria 1903
7 Ga0065712_10131312 3300005290 Bacteria 1546
8 Ga0065715_10003942 3300005293 Bacteria 4276
9 Ga0065715_10100287 3300005293 Bacteria 3319
10 Ga0065715_10110824 3300005293 Bacteria 2601
11 Ga0065715_10115244 3300005293 Bacteria 2421
12 Ga0065715_10161873 3300005293 Bacteria 1621
13 Ga0065707_10008010 3300005295 Bacteria 4656
14 Ga0065707_10010179 3300005295 Bacteria 2713
15 Ga0065707_10155316 3300005295 Bacteria 1615
16 Ga0065707_10181368 3300005295 Bacteria 1416
17 Ga0065707_10288440 3300005295 Bacteria 1027
18 Ga0065707_10311975 3300005295 Unclassified 983
19 Ga0070676_10465969 3300005328 Unclassified 891
20 Ga0070676_10547533 3300005328 Bacteria 828
21 Ga0070690_100001462 3300005330 Bacteria 12338
22 Ga0070690_100037649 3300005330 Unclassified 3050
23 Ga0070670_100000167 3300005331 Bacteria 59452
24 Ga0070670_100027475 3300005331 Bacteria 4895
25 Ga0070670_100043366 3300005331 Bacteria 3866
26 Ga0070670_100125350 3300005331 Bacteria 2217
27 Ga0070670_100142997 3300005331 Bacteria 2069
28 Ga0070677_10051296 3300005333 Unclassified 1669
29 Ga0068869_100005642 3300005334 Bacteria 7889
30 Ga0068869_100017990 3300005334 Bacteria 4803
31 Ga0068869_100242362 3300005334 Bacteria 1437
32 Ga0070666_10084621 3300005335 Unclassified 2171
33 Ga0070682_100000091 3300005337 Bacteria 82460
34 Ga0070682_100003864 3300005337 Bacteria 8315
35 Ga0068868_100004335 3300005338 Bacteria 9945
36 Ga0068868_100767675 3300005338 Bacteria 867
37 Ga0070689_100001217 3300005340 Bacteria 16325
38 Ga0070687_100424922 3300005343 Unclassified 877
39 Ga0070661_100103616 3300005344 Bacteria 2119
40 Ga0070692_10007822 3300005345 Bacteria 4734
41 Ga0070692_10082437 3300005345 Bacteria 1734
42 Ga0070669_100003470 3300005353 Bacteria 11365
43 Ga0070669_100051769 3300005353 Bacteria 3003
44 Ga0070669_100076712 3300005353 Unclassified 2481
45 Ga0070669_100611731 3300005353 Unclassified 914
46 Ga0070675_100704559 3300005354 Bacteria 920
47 Ga0070675_100725983 3300005354 Unclassified 906
48 Ga0070671_100138132 3300005355 Bacteria 2056
49 Ga0070671_100139916 3300005355 Bacteria 2042
50 Ga0070671_100154094 3300005355 Bacteria 1941
51 Ga0070673_100107280 3300005364 Bacteria 2310
52 Ga0070673_100456806 3300005364 Bacteria 1150
53 Ga0070667_100148418 3300005367 Unclassified 2058
54 Ga0070701_10019163 3300005438 Bacteria 3229
55 Ga0070705_100014834 3300005440 Bacteria 4018
56 Ga0070705_100023106 3300005440 Bacteria 3334
57 Ga0070705_100179557 3300005440 Bacteria 1433
58 Ga0070700_100000426 3300005441 Bacteria 21450
59 Ga0070700_100028499 3300005441 Bacteria 3323
60 Ga0070700_100168133 3300005441 Unclassified 1516
61 Ga0070694_100006153 3300005444 Bacteria 7287
62 Ga0070694_100070932 3300005444 Bacteria 2400
63 Ga0070694_100265325 3300005444 Bacteria 1304
64 Ga0070708_100000200 3300005445 Bacteria 43782
65 Ga0070708_100127257 3300005445 Bacteria 2356
66 Ga0070708_100228445 3300005445 Bacteria 1746
67 Ga0070662_100019796 3300005457 Bacteria 4575
68 Ga0070681_10010542 3300005458 Bacteria 9126
69 Ga0070681_10171836 3300005458 Bacteria 2089
70 Ga0068867_100046314 3300005459 Bacteria 3194
71 Ga0068867_100180508 3300005459 Bacteria 1678
72 Ga0068867_100549249 3300005459 Unclassified 1000
73 Ga0068867_101220091 3300005459 Bacteria 691
74 Ga0070706_100037183 3300005467 Unclassified 4496
75 Ga0070706_100216180 3300005467 Bacteria 1789
76 Ga0070706_100224909 3300005467 Bacteria 1752
77 Ga0070707_100019896 3300005468 Bacteria 6327
78 Ga0070707_100120784 3300005468 Unclassified 2544
79 Ga0070707_100333590 3300005468 Bacteria 1473
80 Ga0070707_100472880 3300005468 Bacteria 1215
81 Ga0070698_100014024 3300005471 Bacteria 8475
82 Ga0070698_100020440 3300005471 Bacteria 6940
83 Ga0070698_100035506 3300005471 Bacteria 5155
84 Ga0070698_100100641 3300005471 Bacteria 2862
85 Ga0070698_100118085 3300005471 Bacteria 2614
86 Ga0070698_100226635 3300005471 Bacteria 1802
87 Ga0070699_100001150 3300005518 Bacteria 24554
88 Ga0070699_100005202 3300005518 Bacteria 11438
89 Ga0070699_100005753 3300005518 Bacteria 10849
90 Ga0070699_100010950 3300005518 Bacteria 7843
91 Ga0070699_100784620 3300005518 Bacteria 872
92 Ga0070679_100471082 3300005530 Bacteria 1200
93 Ga0070697_100000095 3300005536 Bacteria 74109
94 Ga0070697_100000143 3300005536 Bacteria 57751
95 Ga0070697_100001663 3300005536 Bacteria 16961
96 Ga0070697_100053768 3300005536 Bacteria 3273
97 Ga0070697_100095666 3300005536 Bacteria 2463
98 Ga0070697_100115285 3300005536 Bacteria 2243
99 Ga0070697_100183193 3300005536 Bacteria 1775
100 Ga0068853_100092750 3300005539 Bacteria 2657
101 Ga0068853_100868113 3300005539 Bacteria 866
102 Ga0070672_100608253 3300005543 Unclassified 952
103 Ga0070686_100005596 3300005544 Bacteria 6960
104 Ga0070695_100033514 3300005545 Bacteria 3214
105 Ga0070695_100073673 3300005545 Bacteria 2242
106 Ga0070695_100268391 3300005545 Bacteria 1249
107 Ga0070695_100322251 3300005545 Bacteria 1149
108 Ga0070695_100533232 3300005545 Bacteria 913
109 Ga0070696_100014281 3300005546 Bacteria 5328
110 Ga0070696_100022019 3300005546 Bacteria 4327
111 Ga0070696_100031000 3300005546 Bacteria 3663
112 Ga0070696_100117419 3300005546 Bacteria 1922
113 Ga0070696_100120300 3300005546 Bacteria 1900
114 Ga0070696_100471715 3300005546 Unclassified 994
115 Ga0070693_100016751 3300005547 Bacteria 3799
116 Ga0070693_100053069 3300005547 Bacteria 2326
117 Ga0070693_100080032 3300005547 Bacteria 1946
118 Ga0070693_100222725 3300005547 Bacteria 1237
119 Ga0070704_100015986 3300005549 Bacteria 4729
120 Ga0070704_100057907 3300005549 Bacteria 2758
121 Ga0070704_100073198 3300005549 Bacteria 2495
122 Ga0070704_100118387 3300005549 Unclassified 2029
123 Ga0070704_100128017 3300005549 Bacteria 1963
124 Ga0070704_100345707 3300005549 Bacteria 1254
125 Ga0070704_100377780 3300005549 Bacteria 1203
126 Ga0070664_100097159 3300005564 Unclassified 2557
127 Ga0070664_100351367 3300005564 Unclassified 1341
128 Ga0070664_100648030 3300005564 Bacteria 981
129 Ga0068857_100240745 3300005577 Bacteria 1656
130 Ga0068857_100335148 3300005577 Bacteria 1399
131 Ga0068857_100702769 3300005577 Bacteria 961
132 Ga0068857_100747051 3300005577 Bacteria 932
133 Ga0068854_100083347 3300005578 Unclassified 2364
134 Ga0068854_100109096 3300005578 Unclassified 2085
135 Ga0068854_100112342 3300005578 Bacteria 2057
136 Ga0070702_100399652 3300005615 Bacteria 983
137 Ga0070702_100560529 3300005615 Bacteria 850
138 Ga0068852_100960129 3300005616 Bacteria 873
139 Ga0068859_100000994 3300005617 Bacteria 29030
140 Ga0068859_100028450 3300005617 Bacteria 5603
141 Ga0068859_100384161 3300005617 Bacteria 1500
142 Ga0068859_100633085 3300005617 Bacteria 1162
143 Ga0068859_101623979 3300005617 Unclassified 714
144 Ga0068864_100002379 3300005618 Bacteria 15560
145 Ga0068864_100034350 3300005618 Bacteria 4313
146 Ga0068864_100409145 3300005618 Bacteria 1290
147 Ga0068864_101171098 3300005618 Bacteria 767
148 Ga0068866_10073292 3300005718 Unclassified 1817
149 Ga0068861_100002995 3300005719 Bacteria 11149
150 Ga0068861_100009256 3300005719 Bacteria 6796
151 Ga0068861_100086596 3300005719 Unclassified 2463
152 Ga0068861_101111691 3300005719 Unclassified 760
153 Ga0068861_101506031 3300005719 Unclassified 660
154 Ga0068861_101613878 3300005719 Unclassified 639
155 Ga0068851_10358627 3300005834 Unclassified 850
156 Ga0068851_10560513 3300005834 Unclassified 691
157 Ga0068870_10097032 3300005840 Bacteria 1658
158 Ga0068863_100045138 3300005841 Bacteria 4182
159 Ga0068863_100187703 3300005841 Bacteria 1986
160 Ga0068863_100460094 3300005841 Bacteria 1249
161 Ga0068863_100934309 3300005841 Bacteria 868
162 Ga0068863_101107559 3300005841 Bacteria 796
163 Ga0068863_101250799 3300005841 Unclassified 749
164 Ga0068858_100045661 3300005842 Bacteria 4061
165 Ga0068858_100128373 3300005842 Bacteria 2376
166 Ga0068860_100007591 3300005843 Bacteria 10853
167 Ga0068860_100052345 3300005843 Bacteria 3883
168 Ga0068860_100180044 3300005843 Bacteria 2043
169 Ga0068860_100385062 3300005843 Bacteria 1385
170 Ga0068862_100007480 3300005844 Bacteria 9055
171 Ga0068862_100022081 3300005844 Bacteria 5323
172 Ga0068862_100399643 3300005844 Bacteria 1285
173 Ga0068862_100938614 3300005844 Bacteria 852
174 Ga0081540_1064367 3300005983 Bacteria 1730
175 Ga0097621_100002148 3300006237 Unclassified 13491
176 Ga0097621_100013473 3300006237 Bacteria 6096
177 Ga0068871_100001307 3300006358 Bacteria 16665
178 Ga0068871_100070584 3300006358 Unclassified 2871
179 Ga0068871_100219189 3300006358 Bacteria 1648
180 Ga0075428_101048580 3300006844 Unclassified 862
181 Ga0075430_100681626 3300006846 Bacteria 847
182 Ga0075430_100734745 3300006846 Bacteria 814
183 Ga0097620_100000994 3300006931 Bacteria 29030
184 Ga0097620_100028454 3300006931 Bacteria 5603
185 Ga0097620_100384148 3300006931 Bacteria 1500
186 Ga0097620_100632925 3300006931 Bacteria 1162
187 Ga0097620_101623981 3300006931 Unclassified 714
188 Ga0105251_10092133 3300009011 Bacteria 1391
189 Ga0105251_10182602 3300009011 Bacteria 945
190 Ga0105240_10134719 3300009093 Bacteria 2959
191 Ga0105240_11225576 3300009093 Bacteria 794
192 Ga0111539_10001706 3300009094 Bacteria 29249
193 Ga0111539_10552705 3300009094 Unclassified 1341
194 Ga0111539_10751822 3300009094 Bacteria 1135
195 Ga0111539_10911004 3300009094 Bacteria 1022
196 Ga0105245_10203122 3300009098 Bacteria 1904
197 Ga0105245_10639304 3300009098 Bacteria 1093
198 Ga0105245_10760329 3300009098 Bacteria 1005
199 Ga0105245_11014389 3300009098 Unclassified 875
200 Ga0105247_10239441 3300009101 Bacteria 1236
201 Ga0114129_10016614 3300009147 Bacteria 10483
202 Ga0114129_10019683 3300009147 Bacteria 9607
203 Ga0114129_10315016 3300009147 Unclassified 2082
204 Ga0114129_10415008 3300009147 Bacteria 1772
205 Ga0105243_10031138 3300009148 Bacteria 4112
206 Ga0105243_10227183 3300009148 Bacteria 1654
207 Ga0105243_10431284 3300009148 Unclassified 1232
208 Ga0105243_11030988 3300009148 Bacteria 827
209 Ga0105243_11174752 3300009148 Bacteria 779
210 Ga0105243_11412780 3300009148 Bacteria 717
211 Ga0105241_10014689 3300009174 Bacteria 5730
212 Ga0105241_10089170 3300009174 Bacteria 2430
213 Ga0105241_10599434 3300009174 Bacteria 995
214 Ga0105242_10102634 3300009176 Unclassified 2425
215 Ga0105242_10201048 3300009176 Bacteria 1770
216 Ga0105242_10264532 3300009176 Unclassified 1555
217 Ga0105242_10815291 3300009176 Bacteria 925
218 Ga0105248_10005745 3300009177 Bacteria 13628
219 Ga0105248_10007586 3300009177 Bacteria 11917
220 Ga0105248_10055904 3300009177 Bacteria 4427
221 Ga0105248_10537007 3300009177 Bacteria 1319
222 Ga0105248_11156494 3300009177 Bacteria 875
223 Ga0105237_10010011 3300009545 Bacteria 10116
224 Ga0105249_10022747 3300009553 Bacteria 5618
225 Ga0105249_10440230 3300009553 Bacteria 1340
226 Ga0105249_10780768 3300009553 Bacteria 1018
227 Ga0105249_11700844 3300009553 Unclassified 703
228 Ga0105239_10090020 3300010375 Bacteria 3385
229 Ga0105239_10792870 3300010375 Bacteria 1085
230 Ga0105246_10503782 3300011119 Bacteria 1029
231 Ga0157373_10172582 3300013100 Bacteria 1521
232 Ga0157374_10104763 3300013296 Bacteria 2716
233 Ga0157378_10028910 3300013297 Bacteria 4892
234 Ga0157378_10047076 3300013297 Bacteria 3834
235 Ga0157378_10669538 3300013297 Unclassified 1055
236 Ga0157378_10807389 3300013297 Unclassified 964
237 Ga0163162_10001376 3300013306 Bacteria 22623
238 Ga0163162_10034058 3300013306 Bacteria 5067
239 Ga0163162_10197667 3300013306 Bacteria 2140
240 Ga0163162_12076556 3300013306 Unclassified 652
241 Ga0157372_10511201 3300013307 Bacteria 1400
242 Ga0157375_10076890 3300013308 Bacteria 3366
243 Ga0157375_10436471 3300013308 Unclassified 1475
244 Ga0157375_10810334 3300013308 Bacteria 1085
245 Ga0157375_10993296 3300013308 Unclassified 979
246 Ga0157375_11177889 3300013308 Unclassified 898
247 Ga0163163_10000298 3300014325 Bacteria 49128
248 Ga0163163_10000801 3300014325 Bacteria 26677
249 Ga0163163_10001930 3300014325 Bacteria 17559
250 Ga0163163_11135205 3300014325 Unclassified 844
251 Ga0163163_11244638 3300014325 Bacteria 807
252 Ga0163163_11443839 3300014325 Bacteria 749
253 Ga0157380_10000396 3300014326 Bacteria 26239
254 Ga0157380_10001184 3300014326 Bacteria 16877
255 Ga0157380_10007299 3300014326 Bacteria 7844
256 Ga0157377_10134735 3300014745 Unclassified 1512
257 Ga0157376_10301203 3300014969 Bacteria 1518
258 Ga0207710_10068740 3300025900 Bacteria 1620
259 Ga0207680_10069473 3300025903 Unclassified 2177
260 Ga0207645_10430086 3300025907 Bacteria 890
261 Ga0207643_10019904 3300025908 Bacteria 3680
262 Ga0207684_10004145 3300025910 Bacteria 13786
263 Ga0207684_10016257 3300025910 Bacteria 6388
264 Ga0207684_10057205 3300025910 Bacteria 3308
265 Ga0207707_10108457 3300025912 Bacteria 2427
266 Ga0207707_10119121 3300025912 Bacteria 2307
267 Ga0207671_10019254 3300025914 Bacteria 5222
268 Ga0207660_11072680 3300025917 Unclassified 657
269 Ga0207662_10430333 3300025918 Bacteria 899
270 Ga0207652_10671559 3300025921 Bacteria 926
271 Ga0207646_10145025 3300025922 Bacteria 2139
272 Ga0207681_10030220 3300025923 Bacteria 3530
273 Ga0207650_10000007 3300025925 Bacteria 530810
274 Ga0207650_10003287 3300025925 Bacteria 11130
275 Ga0207650_10070812 3300025925 Bacteria 2622
276 Ga0207650_10101083 3300025925 Bacteria 2219
277 Ga0207650_10215836 3300025925 Bacteria 1542
278 Ga0207650_10262648 3300025925 Bacteria 1401
279 Ga0207687_10416006 3300025927 Unclassified 1108
280 Ga0207687_10450505 3300025927 Bacteria 1067
281 Ga0207644_10114734 3300025931 Bacteria 2042
282 Ga0207644_10376825 3300025931 Bacteria 1157
283 Ga0207706_10016542 3300025933 Bacteria 6658
284 Ga0207709_10006997 3300025935 Bacteria 6304
285 Ga0207709_10351794 3300025935 Unclassified 1112
286 Ga0207709_10465617 3300025935 Bacteria 980
287 Ga0207670_10002610 3300025936 Bacteria 9480
288 Ga0207670_10357872 3300025936 Unclassified 1157
289 Ga0207704_10629641 3300025938 Bacteria 881
290 Ga0207691_10796990 3300025940 Unclassified 794
291 Ga0207711_10004633 3300025941 Bacteria 11686
292 Ga0207711_10008234 3300025941 Bacteria 8730
293 Ga0207711_10016776 3300025941 Bacteria 6081
294 Ga0207689_10006909 3300025942 Bacteria 9983
295 Ga0207689_10014349 3300025942 Bacteria 6740
296 Ga0207679_10641014 3300025945 Bacteria 960
297 Ga0207679_10836057 3300025945 Unclassified 840
298 Ga0207679_10956273 3300025945 Bacteria 785
299 Ga0207651_10013656 3300025960 Bacteria 4657
300 Ga0207651_10588241 3300025960 Bacteria 972
301 Ga0207651_10654163 3300025960 Unclassified 923
302 Ga0207651_10684704 3300025960 Bacteria 902
303 Ga0207712_10053408 3300025961 Unclassified 2835
304 Ga0207640_10018532 3300025981 Bacteria 4093
305 Ga0207640_10255371 3300025981 Unclassified 1363
306 Ga0207640_10738751 3300025981 Unclassified 847
307 Ga0207658_10512770 3300025986 Unclassified 1069
308 Ga0207703_10028921 3300026035 Bacteria 4374
309 Ga0207703_10372220 3300026035 Bacteria 1320
310 Ga0207639_10009780 3300026041 Bacteria 6627
311 Ga0207639_10671234 3300026041 Unclassified 960
312 Ga0207708_10000096 3300026075 Bacteria 67574
313 Ga0207708_10001571 3300026075 Bacteria 17065
314 Ga0207708_10072670 3300026075 Unclassified 2636
315 Ga0207708_10137300 3300026075 Bacteria 1916
316 Ga0207641_10063230 3300026088 Bacteria 3161
317 Ga0207641_10083937 3300026088 Bacteria 2772
318 Ga0207641_10136601 3300026088 Bacteria 2207
319 Ga0207641_10155641 3300026088 Bacteria 2073
320 Ga0207641_10273914 3300026088 Bacteria 1585
321 Ga0207641_11086728 3300026088 Bacteria 798
322 Ga0207648_10079805 3300026089 Bacteria 2854
323 Ga0207648_10356268 3300026089 Unclassified 1320
324 Ga0207648_10557806 3300026089 Bacteria 1053
325 Ga0207676_10005526 3300026095 Bacteria 8946
326 Ga0207676_10013310 3300026095 Bacteria 5909
327 Ga0207676_10113504 3300026095 Bacteria 2272
328 Ga0207676_10136674 3300026095 Bacteria 2092
329 Ga0207676_10522886 3300026095 Bacteria 1130
330 Ga0207676_11113259 3300026095 Bacteria 781
331 Ga0207674_10011190 3300026116 Bacteria 10086
332 Ga0207674_10130329 3300026116 Bacteria 2479
333 Ga0207674_10284531 3300026116 Bacteria 1602
334 Ga0207674_10514748 3300026116 Bacteria 1156
335 Ga0207675_100005590 3300026118 Bacteria 12033
336 Ga0207675_100040192 3300026118 Bacteria 4366
337 Ga0207675_100056971 3300026118 Unclassified 3645
338 Ga0207675_100321101 3300026118 Bacteria 1512
339 Ga0207675_100934654 3300026118 Unclassified 884
340 Ga0207698_10984133 3300026142 Bacteria 854
341 Ga0207428_10013108 3300027907 Bacteria 7259
342 Ga0207428_10080746 3300027907 Bacteria 2540
343 Ga0207428_10185699 3300027907 Bacteria 1569
344 Ga0268265_10016596 3300028380 Bacteria 5063
345 Ga0268265_10237363 3300028380 Unclassified 1606
346 Ga0268265_10592548 3300028380 Bacteria 1058
347 Ga0268265_10593979 3300028380 Bacteria 1057
348 Ga0268265_11753731 3300028380 Bacteria 627
349 Ga0268264_10457435 3300028381 Bacteria 1238
350 Ga0307408_100037624 3300031548 Bacteria 3409
351 Ga0307408_100316358 3300031548 Bacteria 1313
352 Ga0307408_100385156 3300031548 Bacteria 1200
353 Ga0307405_10003341 3300031731 Bacteria 7349
354 Ga0307413_10004984 3300031824 Bacteria 5857
355 Ga0307410_10222317 3300031852 Bacteria 1453
356 Ga0307406_10013913 3300031901 Bacteria 4619
357 Ga0307407_10133236 3300031903 Bacteria 1593
358 Ga0307407_10405830 3300031903 Bacteria 979
359 Ga0307409_100357021 3300031995 Bacteria 1381
360 Ga0307416_100199242 3300032002 Bacteria 1898
361 Ga0307414_10012176 3300032004 Bacteria 5074
362 Ga0307414_10124593 3300032004 Bacteria 1988
363 Ga0307411_10468949 3300032005 Bacteria 1057
364 Ga0307411_10598727 3300032005 Bacteria 947
365 Ga0307415_100008785 3300032126 Bacteria 5623
366 Ga0373951_0000344 3300035091 Bacteria 14204
367 Ga0395898_1061597 3300037466 Bacteria 744
368 Ga0395901_0551821 3300038443 Unclassified 1168
369 Ga0439434_0012937 3300042435 Bacteria 2473
370 Ga0439435_0222908 3300042436 Bacteria 628
371 Ga0453684_0493604 3300044712 Bacteria 1357
372 Ga0495580_0239617 3300046472 Bacteria 1244
373 Ga0495605_0210542 3300046474 Bacteria 844
374 Ga0495610_0115724 3300046512 Unclassified 1182
375 Ga0495663_0000086 3300046525 Bacteria 42201
376 Ga0495598_0000022 3300046537 Bacteria 24493
377 Ga0495598_0061192 3300046537 Bacteria 1162
378 Ga0495621_0003323 3300046539 Unclassified 4431
379 Ga0495621_0018123 3300046539 Bacteria 2283
380 Ga0495670_0254629 3300046691 Unclassified 936
381 Ga0495670_0523393 3300046691 Unclassified 645
382 Ga0495672_0013772 3300047320 Bacteria 5564
383 Ga0496106_0351156 3300048909 Unclassified 1185
384 Ga0496107_0628100 3300048910 Unclassified 793
385 Ga0496110_0170437 3300048913 Bacteria 1975
386 Ga0496112_0349252 3300048915 Bacteria 1422
387 Ga0496112_0524778 3300048915 Unclassified 1119
388 Ga0501291_000825 3300049514 Bacteria 3517
389 Ga0501291_002259 3300049514 Bacteria 2295
390 Ga0501295_018993 3300049518 Bacteria 1228
391 Ga0501296_000409 3300049519 Bacteria 4223
392 Ga0501298_000970 3300049521 Bacteria 4068
393 Ga0501299_001316 3300049522 Bacteria 3158
394 Ga0501041_0766065 3300049577 Unclassified 618
395 Ga0501202_005884 3300049652 Bacteria 2180
396 Ga0501216_009649 3300049660 Bacteria 1542
397 Ga0501217_019617 3300049661 Bacteria 1580
398 Ga0501217_046734 3300049661 Bacteria 1119
399 Ga0501223_012798 3300049663 Bacteria 1675
400 Ga0501230_027498 3300049667 Bacteria 1040
401 Ga0501235_002286 3300049669 Bacteria 4121
402 Ga0501235_007039 3300049669 Bacteria 2449
403 Ga0501235_056124 3300049669 Bacteria 918
404 Ga0501243_001378 3300049675 Bacteria 3479
405 Ga0501243_006294 3300049675 Bacteria 1797
406 Ga0501249_004747 3300049679 Bacteria 2768
407 Ga0501252_026985 3300049682 Unclassified 780
408 Ga0501260_030528 3300049689 Bacteria 619
409 Ga0501219_002082 3300049703 Bacteria 1618
410 Ga0501229_020205 3300049706 Bacteria 880
411 Ga0501234_005596 3300049707 Bacteria 1966
412 Ga0501268_004534 3300049765 Bacteria 1964
413 Ga0501279_021253 3300049775 Unclassified 926
414 Ga0501283_001184 3300049779 Bacteria 3442
415 Ga0501283_068792 3300049779 Bacteria 649
416 Ga0501212_000806 3300049851 Bacteria 3278
417 nmdc:mga05p37_141051_c1 3300050507 Bacteria 2953
418 nmdc:mga05p37_141638_c1 3300050507 Bacteria 2946
419 nmdc:mga05p37_285256_c1 3300050507 Bacteria 1967
420 nmdc:mga05p37_816880_c1 3300050507 Bacteria 1017
421 nmdc:mga08y16_27376_c1 3300050511 Bacteria 6007
422 nmdc:mga08y16_424125_c1 3300050511 Unclassified 1359
423 nmdc:mga08y16_49523_c1 3300050511 Bacteria 4397
424 nmdc:mga08y16_694719_c1 3300050511 Bacteria 1018
425 nmdc:mga0a205_150957_c1 3300050515 Bacteria 2223
426 Ga0501084_0555294 3300054114 Unclassified 970
427 Ga0501084_0657925 3300054114 Unclassified 884
428 Ga0157373_10581719
429 SwRhRL2b_contig_857298
430 MBSR1b_contig_1582499
431 LJNas_1008245
432 rootL2_10107163
433 Ga0065704_10112007
434 Ga0065712_10131312
435 Ga0065715_10003942
436 Ga0065715_10100287
437 Ga0065715_10110824
438 Ga0065715_10115244
439 Ga0065715_10161873
440 Ga0065707_10008010
441 Ga0065707_10010179
442 Ga0065707_10155316
443 Ga0065707_10181368
444 Ga0065707_10288440
445 Ga0065707_10311975
446 Ga0070676_10465969
447 Ga0070676_10547533
448 Ga0070690_100001462
449 Ga0070690_100037649
450 Ga0070670_100000167
451 Ga0070670_100027475
452 Ga0070670_100043366
453 Ga0070670_100125350
454 Ga0070670_100142997
455 Ga0070677_10051296
456 Ga0068869_100005642
457 Ga0068869_100017990
458 Ga0068869_100242362
459 Ga0070666_10084621
460 Ga0070682_100000091
461 Ga0070682_100003864
462 Ga0068868_100004335
463 Ga0068868_100767675
464 Ga0070689_100001217
465 Ga0070687_100424922
466 Ga0070661_100103616
467 Ga0070692_10007822
468 Ga0070692_10082437
469 Ga0070669_100003470
470 Ga0070669_100051769
471 Ga0070669_100076712
472 Ga0070669_100611731
473 Ga0070675_100704559
474 Ga0070675_100725983
475 Ga0070671_100138132
476 Ga0070671_100139916
477 Ga0070671_100154094
478 Ga0070673_100107280
479 Ga0070673_100456806
480 Ga0070667_100148418
481 Ga0070701_10019163
482 Ga0070705_100014834
483 Ga0070705_100023106
484 Ga0070705_100179557
485 Ga0070700_100000426
486 Ga0070700_100028499
487 Ga0070700_100168133
488 Ga0070694_100006153
489 Ga0070694_100070932
490 Ga0070694_100265325
491 Ga0070708_100000200
492 Ga0070708_100127257
493 Ga0070708_100228445
494 Ga0070662_100019796
495 Ga0070681_10010542
496 Ga0070681_10171836
497 Ga0068867_100046314
498 Ga0068867_100180508
499 Ga0068867_100549249
500 Ga0068867_101220091
501 Ga0070706_100037183
502 Ga0070706_100216180
503 Ga0070706_100224909
504 Ga0070707_100019896
505 Ga0070707_100120784
506 Ga0070707_100333590
507 Ga0070707_100472880
508 Ga0070698_100014024
509 Ga0070698_100020440
510 Ga0070698_100035506
511 Ga0070698_100100641
512 Ga0070698_100118085
513 Ga0070698_100226635
514 Ga0070699_100001150
515 Ga0070699_100005202
516 Ga0070699_100005753
517 Ga0070699_100010950
518 Ga0070699_100784620
519 Ga0070679_100471082
520 Ga0070697_100000095
521 Ga0070697_100000143
522 Ga0070697_100001663
523 Ga0070697_100053768
524 Ga0070697_100095666
525 Ga0070697_100115285
526 Ga0070697_100183193
527 Ga0068853_100092750
528 Ga0068853_100868113
529 Ga0070672_100608253
530 Ga0070686_100005596
531 Ga0070695_100033514
532 Ga0070695_100073673
533 Ga0070695_100268391
534 Ga0070695_100322251
535 Ga0070695_100533232
536 Ga0070696_100014281
537 Ga0070696_100022019
538 Ga0070696_100031000
539 Ga0070696_100117419
540 Ga0070696_100120300
541 Ga0070696_100471715
542 Ga0070693_100016751
543 Ga0070693_100053069
544 Ga0070693_100080032
545 Ga0070693_100222725
546 Ga0070704_100015986
547 Ga0070704_100057907
548 Ga0070704_100073198
549 Ga0070704_100118387
550 Ga0070704_100128017
551 Ga0070704_100345707
552 Ga0070704_100377780
553 Ga0070664_100097159
554 Ga0070664_100351367
555 Ga0070664_100648030
556 Ga0068857_100240745
557 Ga0068857_100335148
558 Ga0068857_100702769
559 Ga0068857_100747051
560 Ga0068854_100083347
561 Ga0068854_100109096
562 Ga0068854_100112342
563 Ga0070702_100399652
564 Ga0070702_100560529
565 Ga0068852_100960129
566 Ga0068859_100000994
567 Ga0068859_100028450
568 Ga0068859_100384161
569 Ga0068859_100633085
570 Ga0068859_101623979
571 Ga0068864_100002379
572 Ga0068864_100034350
573 Ga0068864_100409145
574 Ga0068864_101171098
575 Ga0068866_10073292
576 Ga0068861_100002995
577 Ga0068861_100009256
578 Ga0068861_100086596
579 Ga0068861_101111691
580 Ga0068861_101506031
581 Ga0068861_101613878
582 Ga0068851_10358627
583 Ga0068851_10560513
584 Ga0068870_10097032
585 Ga0068863_100045138
586 Ga0068863_100187703
587 Ga0068863_100460094
588 Ga0068863_100934309
589 Ga0068863_101107559
590 Ga0068863_101250799
591 Ga0068858_100045661
592 Ga0068858_100128373
593 Ga0068860_100007591
594 Ga0068860_100052345
595 Ga0068860_100180044
596 Ga0068860_100385062
597 Ga0068862_100007480
598 Ga0068862_100022081
599 Ga0068862_100399643
600 Ga0068862_100938614
601 Ga0081540_1064367
602 Ga0097621_100002148
603 Ga0097621_100013473
604 Ga0068871_100001307
605 Ga0068871_100070584
606 Ga0068871_100219189
607 Ga0075428_101048580
608 Ga0075430_100681626
609 Ga0075430_100734745
610 Ga0097620_100000994
611 Ga0097620_100028454
612 Ga0097620_100384148
613 Ga0097620_100632925
614 Ga0097620_101623981
615 Ga0105251_10092133
616 Ga0105251_10182602
617 Ga0105240_10134719
618 Ga0105240_11225576
619 Ga0111539_10001706
620 Ga0111539_10552705
621 Ga0111539_10751822
622 Ga0111539_10911004
623 Ga0105245_10203122
624 Ga0105245_10639304
625 Ga0105245_10760329
626 Ga0105245_11014389
627 Ga0105247_10239441
628 Ga0114129_10016614
629 Ga0114129_10019683
630 Ga0114129_10315016
631 Ga0114129_10415008
632 Ga0105243_10031138
633 Ga0105243_10227183
634 Ga0105243_10431284
635 Ga0105243_11030988
636 Ga0105243_11174752
637 Ga0105243_11412780
638 Ga0105241_10014689
639 Ga0105241_10089170
640 Ga0105241_10599434
641 Ga0105242_10102634
642 Ga0105242_10201048
643 Ga0105242_10264532
644 Ga0105242_10815291
645 Ga0105248_10005745
646 Ga0105248_10007586
647 Ga0105248_10055904
648 Ga0105248_10537007
649 Ga0105248_11156494
650 Ga0105237_10010011
651 Ga0105249_10022747
652 Ga0105249_10440230
653 Ga0105249_10780768
654 Ga0105249_11700844
655 Ga0105239_10090020
656 Ga0105239_10792870
657 Ga0105246_10503782
658 Ga0157373_10172582
659 Ga0157374_10104763
660 Ga0157378_10028910
661 Ga0157378_10047076
662 Ga0157378_10669538
663 Ga0157378_10807389
664 Ga0163162_10001376
665 Ga0163162_10034058
666 Ga0163162_10197667
667 Ga0163162_12076556
668 Ga0157372_10511201
669 Ga0157375_10076890
670 Ga0157375_10436471
671 Ga0157375_10810334
672 Ga0157375_10993296
673 Ga0157375_11177889
674 Ga0163163_10000298
675 Ga0163163_10000801
676 Ga0163163_10001930
677 Ga0163163_11135205
678 Ga0163163_11244638
679 Ga0163163_11443839
680 Ga0157380_10000396
681 Ga0157380_10001184
682 Ga0157380_10007299
683 Ga0157377_10134735
684 Ga0157376_10301203
685 Ga0207710_10068740
686 Ga0207680_10069473
687 Ga0207645_10430086
688 Ga0207643_10019904
689 Ga0207684_10004145
690 Ga0207684_10016257
691 Ga0207684_10057205
692 Ga0207707_10108457
693 Ga0207707_10119121
694 Ga0207671_10019254
695 Ga0207660_11072680
696 Ga0207662_10430333
697 Ga0207652_10671559
698 Ga0207646_10145025
699 Ga0207681_10030220
700 Ga0207650_10000007
701 Ga0207650_10003287
702 Ga0207650_10070812
703 Ga0207650_10101083
704 Ga0207650_10215836
705 Ga0207650_10262648
706 Ga0207687_10416006
707 Ga0207687_10450505
708 Ga0207644_10114734
709 Ga0207644_10376825
710 Ga0207706_10016542
711 Ga0207709_10006997
712 Ga0207709_10351794
713 Ga0207709_10465617
714 Ga0207670_10002610
715 Ga0207670_10357872
716 Ga0207704_10629641
717 Ga0207691_10796990
718 Ga0207711_10004633
719 Ga0207711_10008234
720 Ga0207711_10016776
721 Ga0207689_10006909
722 Ga0207689_10014349
723 Ga0207679_10641014
724 Ga0207679_10836057
725 Ga0207679_10956273
726 Ga0207651_10013656
727 Ga0207651_10588241
728 Ga0207651_10654163
729 Ga0207651_10684704
730 Ga0207712_10053408
731 Ga0207640_10018532
732 Ga0207640_10255371
733 Ga0207640_10738751
734 Ga0207658_10512770
735 Ga0207703_10028921
736 Ga0207703_10372220
737 Ga0207639_10009780
738 Ga0207639_10671234
739 Ga0207708_10000096
740 Ga0207708_10001571
741 Ga0207708_10072670
742 Ga0207708_10137300
743 Ga0207641_10063230
744 Ga0207641_10083937
745 Ga0207641_10136601
746 Ga0207641_10155641
747 Ga0207641_10273914
748 Ga0207641_11086728
749 Ga0207648_10079805
750 Ga0207648_10356268
751 Ga0207648_10557806
752 Ga0207676_10005526
753 Ga0207676_10013310
754 Ga0207676_10113504
755 Ga0207676_10136674
756 Ga0207676_10522886
757 Ga0207676_11113259
758 Ga0207674_10011190
759 Ga0207674_10130329
760 Ga0207674_10284531
761 Ga0207674_10514748
762 Ga0207675_100005590
763 Ga0207675_100040192
764 Ga0207675_100056971
765 Ga0207675_100321101
766 Ga0207675_100934654
767 Ga0207698_10984133
768 Ga0207428_10013108
769 Ga0207428_10080746
770 Ga0207428_10185699
771 Ga0268265_10016596
772 Ga0268265_10237363
773 Ga0268265_10592548
774 Ga0268265_10593979
775 Ga0268265_11753731
776 Ga0268264_10457435
777 Ga0307408_100037624
778 Ga0307408_100316358
779 Ga0307408_100385156
780 Ga0307405_10003341
781 Ga0307413_10004984
782 Ga0307410_10222317
783 Ga0307406_10013913
784 Ga0307407_10133236
785 Ga0307407_10405830
786 Ga0307409_100357021
787 Ga0307416_100199242
788 Ga0307414_10012176
789 Ga0307414_10124593
790 Ga0307411_10468949
791 Ga0307411_10598727
792 Ga0307415_100008785
793 Ga0373951_0000344
794 Ga0395898_1061597
795 Ga0395901_0551821
796 Ga0439434_0012937
797 Ga0439435_0222908
798 Ga0453684_0493604
799 Ga0495580_0239617
800 Ga0495605_0210542
801 Ga0495610_0115724
802 Ga0495663_0000086
803 Ga0495598_0000022
804 Ga0495598_0061192
805 Ga0495621_0003323
806 Ga0495621_0018123
807 Ga0495670_0254629
808 Ga0495670_0523393
809 Ga0495672_0013772
810 Ga0496106_0351156
811 Ga0496107_0628100
812 Ga0496110_0170437
813 Ga0496112_0349252
814 Ga0496112_0524778
815 Ga0501291_000825
816 Ga0501291_002259
817 Ga0501295_018993
818 Ga0501296_000409
819 Ga0501298_000970
820 Ga0501299_001316
821 Ga0501041_0766065
822 Ga0501202_005884
823 Ga0501216_009649
824 Ga0501217_019617
825 Ga0501217_046734
826 Ga0501223_012798
827 Ga0501230_027498
828 Ga0501235_002286
829 Ga0501235_007039
830 Ga0501235_056124
831 Ga0501243_001378
832 Ga0501243_006294
833 Ga0501249_004747
834 Ga0501252_026985
835 Ga0501260_030528
836 Ga0501219_002082
837 Ga0501229_020205
838 Ga0501234_005596
839 Ga0501268_004534
840 Ga0501279_021253
841 Ga0501283_001184
842 Ga0501283_068792
843 Ga0501212_000806
844 nmdc:mga05p37_141051_c1
845 nmdc:mga05p37_141638_c1
846 nmdc:mga05p37_285256_c1
847 nmdc:mga05p37_816880_c1
848 nmdc:mga08y16_27376_c1
849 nmdc:mga08y16_424125_c1
850 nmdc:mga08y16_49523_c1
851 nmdc:mga08y16_694719_c1
852 nmdc:mga0a205_150957_c1
853 Ga0501084_0555294
854 Ga0501084_0657925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5m05-assembly1.cif.gz_A chicken smooth muscle myosin motor domain co-crystallized with the specific ck-571 inhibitor, mgadp form 0.762 83 105
7dhw-assembly1.cif.gz_A crystal structure of myosin-xi motor domain in complex with adp-alf4 0.7593 83 105
1br2-assembly6.cif.gz_F smooth muscle myosin motor domain complexed with mgadp.alf4 0.7533 83 105
4db1-assembly3.cif.gz_B cardiac human myosin s1dc, beta isoform complexed with mn-amppnp 0.7453 83 105
6fsa-assembly2.cif.gz_B beta-cardiac myosin post-rigor 0.7379 83 105
ID Description Score Start End Superfamily
af_A0A0R0GKZ3_34_156_3.30.420.10 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;Ribonuclease H-like superfamily/Ribonuclease H 0.8235 82 109 3.30.420.10
af_O08638_87_771_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.7841 83 107 3.40.850.10
1vomA01 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.6735 83 105 3.40.850.10
af_I1LBC5_694_798_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6418 67 117 2.60.40.10
2vzoB04 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6401 69 141 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A2V8QZX7-F1-model_v4 Uncharacterized protein 0.9153 20 129
AF-A0A2V8QZX7-F1-model_v4 Uncharacterized protein 0.8558 20 129
AF-A0A0U2YH85-F1-model_v4 Integron gene cassette protein 0.8107 2 149
AF-A0A3D5SH42-F1-model_v4 Uncharacterized protein 0.79 1 150
AF-A0A1G2QG90-F1-model_v4 Uncharacterized protein 0.7864 50 136 GO:0016020

Map