F441395

General Info

Members Datasets Scaffolds Average Seq Length
427 251 854 183

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100033513|Ga0068868_1000335134
Length 208
Sequence MLRSLLATVLLITTIFSAHAAADTAPAPVPGATTETLTLGGGCFWCLEAVFDELKGVSSVESGYAGGHVANPSYTQVSEGGTGHAEVVQITFDPRIVSRDVILQVFFTIHDPTTLNRQGNDVGEQYRSVAFYRSPEQKAAIEKAIAETDASGAWRGKAVTQVVPLVKFYKAEDYHQEYFKLHGTQPYCQLVVAPKVAKFRKVFHDRLK

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
53 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
58 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
134 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
135 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
136 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
137 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
138 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
139 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
140 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
141 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
142 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
143 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
144 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
150 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
151 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
152 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
153 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
154 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
155 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
156 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
157 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
158 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
170 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
171 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
172 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
173 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
174 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
175 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
176 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
177 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
178 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
179 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
180 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
181 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
182 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
183 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
187 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
188 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
189 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
190 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
191 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
192 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
193 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
194 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
206 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
209 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
212 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
226 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
231 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
240 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
241 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
242 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
247 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
248 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
249 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
250 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
251 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.36
Metatranscriptomes 1.64
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.58
Nodule 0
Rhizoplane 0.7
Rhizosphere 94.85
Stem 0
Stem Tuber 0
Unclassified 4.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100033513 3300005338 Bacteria 3959
2 rootL2_10251205 3300003322 Bacteria 2241
3 Ga0065712_10081169 3300005290 Bacteria 3032
4 Ga0065707_10171706 3300005295 Bacteria 1475
5 Ga0070658_10788420 3300005327 Bacteria 825
6 Ga0070683_100745969 3300005329 Bacteria 938
7 Ga0070690_100327837 3300005330 Bacteria 1105
8 Ga0070670_100874141 3300005331 Bacteria 814
9 Ga0068869_100217773 3300005334 Bacteria 1512
10 Ga0070666_10836702 3300005335 Bacteria 679
11 Ga0070666_10874242 3300005335 Bacteria 664
12 Ga0068868_100022426 3300005338 Bacteria 4764
13 Ga0070689_100165961 3300005340 Bacteria 1787
14 Ga0070687_100326882 3300005343 Bacteria 982
15 Ga0070668_100109160 3300005347 Bacteria 2201
16 Ga0070675_100044312 3300005354 Bacteria 3638
17 Ga0070674_100044859 3300005356 Bacteria 3018
18 Ga0070674_100566714 3300005356 Bacteria 955
19 Ga0070674_100943209 3300005356 Bacteria 754
20 Ga0070673_100064291 3300005364 Bacteria 2923
21 Ga0070673_100479095 3300005364 Bacteria 1123
22 Ga0070688_100226162 3300005365 Bacteria 1321
23 Ga0070659_100831916 3300005366 Bacteria 804
24 Ga0070713_100253509 3300005436 Unclassified 1606
25 Ga0070700_100090570 3300005441 Bacteria 1995
26 Ga0070700_100738245 3300005441 Bacteria 787
27 Ga0070694_100177431 3300005444 Bacteria 1574
28 Ga0070694_100274219 3300005444 Bacteria 1284
29 Ga0070708_100285451 3300005445 Bacteria 1553
30 Ga0070678_100006653 3300005456 Bacteria 6798
31 Ga0068867_100026133 3300005459 Bacteria 4191
32 Ga0068867_100379418 3300005459 Bacteria 1187
33 Ga0068867_100388453 3300005459 Bacteria 1174
34 Ga0070685_10367883 3300005466 Bacteria 987
35 Ga0070706_100061588 3300005467 Bacteria 3465
36 Ga0070706_100769560 3300005467 Unclassified 892
37 Ga0070707_100022165 3300005468 Bacteria 6005
38 Ga0070698_100039535 3300005471 Bacteria 4854
39 Ga0070698_100057650 3300005471 Bacteria 3930
40 Ga0070699_100002175 3300005518 Bacteria 17747
41 Ga0070699_100052609 3300005518 Unclassified 3523
42 Ga0070684_100139482 3300005535 Bacteria 2192
43 Ga0070697_100255418 3300005536 Bacteria 1499
44 Ga0068853_100314788 3300005539 Bacteria 1450
45 Ga0068853_100879144 3300005539 Bacteria 860
46 Ga0068853_100879919 3300005539 Bacteria 860
47 Ga0070672_100040621 3300005543 Bacteria 3570
48 Ga0070686_100252058 3300005544 Bacteria 1290
49 Ga0070695_100152031 3300005545 Bacteria 1616
50 Ga0070696_100016084 3300005546 Bacteria 5032
51 Ga0070696_100450973 3300005546 Bacteria 1015
52 Ga0070696_101357312 3300005546 Bacteria 605
53 Ga0070693_100157687 3300005547 Bacteria 1443
54 Ga0070693_100980875 3300005547 Bacteria 638
55 Ga0070665_100051360 3300005548 Bacteria 4135
56 Ga0070665_100296325 3300005548 Bacteria 1620
57 Ga0070704_100109896 3300005549 Bacteria 2096
58 Ga0068855_100176172 3300005563 Bacteria 2420
59 Ga0068855_100563299 3300005563 Bacteria 1232
60 Ga0070664_100610676 3300005564 Bacteria 1012
61 Ga0068857_100060718 3300005577 Bacteria 3358
62 Ga0068856_100646568 3300005614 Bacteria 1078
63 Ga0068852_100252029 3300005616 Bacteria 1691
64 Ga0068859_100117141 3300005617 Bacteria 2729
65 Ga0068859_100509443 3300005617 Bacteria 1298
66 Ga0068864_100169522 3300005618 Bacteria 1989
67 Ga0068863_100208581 3300005841 Bacteria 1881
68 Ga0068863_100213816 3300005841 Bacteria 1857
69 Ga0068863_100259169 3300005841 Bacteria 1681
70 Ga0068858_100036205 3300005842 Bacteria 4576
71 Ga0068858_101331530 3300005842 Bacteria 707
72 Ga0068858_101406757 3300005842 Bacteria 687
73 Ga0068860_100052396 3300005843 Bacteria 3882
74 Ga0068860_100057501 3300005843 Bacteria 3697
75 Ga0068860_101220361 3300005843 Unclassified 772
76 Ga0068860_101790737 3300005843 Bacteria 636
77 Ga0068862_101373401 3300005844 Bacteria 709
78 Ga0081455_10044394 3300005937 Bacteria 3878
79 Ga0081538_10019194 3300005981 Bacteria 5095
80 Ga0075365_10284780 3300006038 Bacteria 1163
81 Ga0075364_10186100 3300006051 Bacteria 1406
82 Ga0070715_10059386 3300006163 Bacteria 1673
83 Ga0070716_100071027 3300006173 Bacteria 2046
84 Ga0075427_10023042 3300006194 Bacteria 996
85 Ga0075366_10049828 3300006195 Bacteria 2486
86 Ga0075366_10079902 3300006195 Bacteria 1953
87 Ga0097621_100131480 3300006237 Bacteria 2131
88 Ga0097621_100263356 3300006237 Bacteria 1513
89 Ga0097621_101188955 3300006237 Bacteria 718
90 Ga0068871_100012371 3300006358 Bacteria 6287
91 Ga0068871_100444856 3300006358 Bacteria 1161
92 Ga0068871_100992205 3300006358 Bacteria 782
93 Ga0075428_100184011 3300006844 Unclassified 2261
94 Ga0075428_100292608 3300006844 Bacteria 1751
95 Ga0075430_100452220 3300006846 Unclassified 1060
96 Ga0075430_100512633 3300006846 Bacteria 990
97 Ga0075431_100040581 3300006847 Unclassified 4797
98 Ga0075431_100241517 3300006847 Bacteria 1837
99 Ga0075433_10371415 3300006852 Bacteria 1263
100 Ga0075434_100373850 3300006871 Bacteria 1446
101 Ga0075429_100048210 3300006880 Unclassified 3706
102 Ga0075429_100534046 3300006880 Bacteria 1028
103 Ga0068865_100093423 3300006881 Bacteria 2187
104 Ga0068865_100102864 3300006881 Bacteria 2094
105 Ga0068865_100257474 3300006881 Bacteria 1380
106 Ga0068865_100955950 3300006881 Bacteria 748
107 Ga0097620_100117149 3300006931 Bacteria 2729
108 Ga0097620_100509456 3300006931 Bacteria 1298
109 Ga0105240_10040786 3300009093 Bacteria 5932
110 Ga0105240_10126342 3300009093 Bacteria 3073
111 Ga0105240_11070887 3300009093 Bacteria 859
112 Ga0105245_10014030 3300009098 Bacteria 6977
113 Ga0105245_10428380 3300009098 Bacteria 1327
114 Ga0105245_10518034 3300009098 Bacteria 1211
115 Ga0105245_11009888 3300009098 Bacteria 876
116 Ga0105245_11113195 3300009098 Bacteria 836
117 Ga0114129_10024791 3300009147 Bacteria 8502
118 Ga0114129_10066551 3300009147 Bacteria 5027
119 Ga0114129_10587546 3300009147 Bacteria 1444
120 Ga0114129_11463139 3300009147 Bacteria 841
121 Ga0105243_10022744 3300009148 Bacteria 4767
122 Ga0105243_10039151 3300009148 Bacteria 3695
123 Ga0105241_10249756 3300009174 Bacteria 1503
124 Ga0105242_10037262 3300009176 Bacteria 3906
125 Ga0105242_10111720 3300009176 Bacteria 2331
126 Ga0105242_10370834 3300009176 Bacteria 1328
127 Ga0105242_10556479 3300009176 Bacteria 1101
128 Ga0105242_10593172 3300009176 Bacteria 1069
129 Ga0105248_10026200 3300009177 Bacteria 6487
130 Ga0105248_10392532 3300009177 Bacteria 1563
131 Ga0105248_10464749 3300009177 Bacteria 1426
132 Ga0105248_10712924 3300009177 Bacteria 1132
133 Ga0105237_10135111 3300009545 Bacteria 2461
134 Ga0105237_10273142 3300009545 Bacteria 1693
135 Ga0105238_10121144 3300009551 Bacteria 2595
136 Ga0105238_10540604 3300009551 Bacteria 1169
137 Ga0105249_10104536 3300009553 Bacteria 2669
138 Ga0105249_11359877 3300009553 Bacteria 782
139 Ga0105239_10069928 3300010375 Bacteria 3855
140 Ga0105246_10246788 3300011119 Bacteria 1415
141 Ga0105246_10307250 3300011119 Bacteria 1283
142 Ga0157371_10984192 3300013102 Bacteria 643
143 Ga0157369_10056387 3300013105 Bacteria 4240
144 Ga0157374_10060877 3300013296 Bacteria 3534
145 Ga0157374_10116276 3300013296 Bacteria 2577
146 Ga0157374_10472665 3300013296 Bacteria 1256
147 Ga0157378_10625299 3300013297 Bacteria 1090
148 Ga0157378_10944535 3300013297 Unclassified 895
149 Ga0157378_11224294 3300013297 Bacteria 791
150 Ga0163162_10139461 3300013306 Bacteria 2537
151 Ga0163162_10451244 3300013306 Bacteria 1418
152 Ga0163162_10519861 3300013306 Bacteria 1320
153 Ga0163162_10526183 3300013306 Bacteria 1312
154 Ga0157372_11948710 3300013307 Bacteria 675
155 Ga0157375_10067149 3300013308 Bacteria 3583
156 Ga0157375_10135075 3300013308 Bacteria 2589
157 Ga0157375_10423681 3300013308 Bacteria 1497
158 Ga0157375_11043691 3300013308 Bacteria 955
159 Ga0163163_10011300 3300014325 Bacteria 8093
160 Ga0157380_10212489 3300014326 Bacteria 1725
161 Ga0157380_10853899 3300014326 Bacteria 932
162 Ga0182008_10040485 3300014497 Bacteria 2327
163 Ga0157377_10406459 3300014745 Bacteria 929
164 Ga0157376_10166747 3300014969 Bacteria 2002
165 Ga0157376_10213705 3300014969 Bacteria 1782
166 Ga0157376_10432038 3300014969 Bacteria 1280
167 Ga0163161_10643155 3300017792 Bacteria 878
168 Ga0206356_10627600 3300020070 Bacteria 759
169 Ga0206356_11397387 3300020070 Bacteria 901
170 Ga0213876_10081848 3300021384 Bacteria 1708
171 Ga0207685_10056198 3300025905 Bacteria 1539
172 Ga0207685_10292081 3300025905 Bacteria 804
173 Ga0207705_10104790 3300025909 Bacteria 2084
174 Ga0207684_10150788 3300025910 Bacteria 2000
175 Ga0207695_10031858 3300025913 Bacteria 5776
176 Ga0207662_10305798 3300025918 Bacteria 1058
177 Ga0207646_10159873 3300025922 Bacteria 2032
178 Ga0207694_10398570 3300025924 Bacteria 1144
179 Ga0207650_10382021 3300025925 Bacteria 1163
180 Ga0207650_10898647 3300025925 Bacteria 752
181 Ga0207687_10032598 3300025927 Bacteria 3529
182 Ga0207687_10124530 3300025927 Bacteria 1933
183 Ga0207687_10674691 3300025927 Bacteria 876
184 Ga0207687_10737551 3300025927 Bacteria 838
185 Ga0207664_10140023 3300025929 Unclassified 2046
186 Ga0207690_10745478 3300025932 Bacteria 807
187 Ga0207706_10414847 3300025933 Bacteria 1166
188 Ga0207686_10299365 3300025934 Bacteria 1194
189 Ga0207686_10406692 3300025934 Bacteria 1038
190 Ga0207686_10434312 3300025934 Bacteria 1007
191 Ga0207670_10036831 3300025936 Bacteria 3185
192 Ga0207670_10071607 3300025936 Bacteria 2398
193 Ga0207670_10422696 3300025936 Bacteria 1069
194 Ga0207669_10016033 3300025937 Bacteria 3796
195 Ga0207669_10047395 3300025937 Bacteria 2546
196 Ga0207669_10060540 3300025937 Bacteria 2322
197 Ga0207704_10055130 3300025938 Bacteria 2428
198 Ga0207704_10322623 3300025938 Bacteria 1192
199 Ga0207665_10042045 3300025939 Bacteria 3054
200 Ga0207711_10018336 3300025941 Bacteria 5816
201 Ga0207711_10188393 3300025941 Bacteria 1879
202 Ga0207711_10286638 3300025941 Bacteria 1517
203 Ga0207689_10135507 3300025942 Bacteria 2027
204 Ga0207689_10468228 3300025942 Bacteria 1054
205 Ga0207679_10190165 3300025945 Bacteria 1706
206 Ga0207667_10565550 3300025949 Bacteria 1149
207 Ga0207667_11568677 3300025949 Bacteria 628
208 Ga0207651_10421647 3300025960 Bacteria 1139
209 Ga0207651_10973786 3300025960 Bacteria 757
210 Ga0207712_10055068 3300025961 Bacteria 2796
211 Ga0207668_10244526 3300025972 Bacteria 1454
212 Ga0207668_10407849 3300025972 Bacteria 1150
213 Ga0207677_10186410 3300026023 Bacteria 1637
214 Ga0207677_10258040 3300026023 Bacteria 1419
215 Ga0207703_10707387 3300026035 Unclassified 958
216 Ga0207703_11272035 3300026035 Bacteria 707
217 Ga0207639_10007760 3300026041 Bacteria 7332
218 Ga0207639_10561252 3300026041 Bacteria 1049
219 Ga0207678_10133336 3300026067 Bacteria 2119
220 Ga0207708_10049341 3300026075 Bacteria 3204
221 Ga0207708_11206057 3300026075 Bacteria 662
222 Ga0207702_11087358 3300026078 Bacteria 793
223 Ga0207641_10053810 3300026088 Bacteria 3414
224 Ga0207641_10550493 3300026088 Bacteria 1125
225 Ga0207648_10261993 3300026089 Bacteria 1543
226 Ga0207648_10273435 3300026089 Bacteria 1509
227 Ga0207648_10323893 3300026089 Bacteria 1385
228 Ga0207648_10410209 3300026089 Bacteria 1229
229 Ga0207648_10793630 3300026089 Bacteria 881
230 Ga0207676_10239259 3300026095 Bacteria 1628
231 Ga0207683_10014182 3300026121 Bacteria 6790
232 Ga0207683_10766675 3300026121 Bacteria 895
233 Ga0207698_10047265 3300026142 Bacteria 3259
234 Ga0207698_10353183 3300026142 Bacteria 1389
235 Ga0268266_10021559 3300028379 Bacteria 5488
236 Ga0268266_10501158 3300028379 Bacteria 1159
237 Ga0268264_10008088 3300028381 Bacteria 8748
238 Ga0268264_10017067 3300028381 Bacteria 5945
239 Ga0268264_11240799 3300028381 Bacteria 755
240 Ga0265318_10013142 3300028577 Bacteria 3509
241 Ga0265336_10143106 3300028666 Bacteria 712
242 Ga0265338_10088049 3300028800 Bacteria 2578
243 Ga0265320_10034249 3300031240 Bacteria 2585
244 Ga0265331_10019280 3300031250 Bacteria 3524
245 Ga0307408_100319218 3300031548 Bacteria 1308
246 Ga0307408_100949710 3300031548 Bacteria 790
247 Ga0316575_10002766 3300031665 Bacteria 5926
248 Ga0316579_10000119 3300031691 Bacteria 21344
249 Ga0265314_10030258 3300031711 Bacteria 4009
250 Ga0265342_10476339 3300031712 Bacteria 639
251 Ga0316576_10008961 3300031727 Bacteria 6429
252 Ga0316576_10167934 3300031727 Bacteria 1656
253 Ga0316578_10339098 3300031728 Bacteria 895
254 Ga0307405_10953757 3300031731 Bacteria 729
255 Ga0316577_10001882 3300031733 Bacteria 10136
256 Ga0307410_10456093 3300031852 Bacteria 1044
257 Ga0307410_10761859 3300031852 Bacteria 820
258 Ga0307406_10165396 3300031901 Unclassified 1595
259 Ga0307412_10389339 3300031911 Bacteria 1131
260 Ga0307409_100087632 3300031995 Bacteria 2538
261 Ga0307409_100345378 3300031995 Bacteria 1402
262 Ga0307416_100190848 3300032002 Bacteria 1932
263 Ga0307416_100518397 3300032002 Bacteria 1260
264 Ga0307416_100842141 3300032002 Bacteria 1015
265 Ga0307411_10031053 3300032005 Bacteria 3282
266 Ga0307415_100034194 3300032126 Bacteria 3307
267 Ga0307415_100055355 3300032126 Bacteria 2714
268 Ga0307415_100693275 3300032126 Bacteria 918
269 Ga0316583_10003021 3300032133 Bacteria 5910
270 Ga0316585_10000390 3300032137 Bacteria 10212
271 Ga0316585_10059401 3300032137 Unclassified 1234
272 Ga0316580_10000552 3300032139 Bacteria 8719
273 Ga0316593_10088793 3300032168 Bacteria 1087
274 Ga0316593_10191832 3300032168 Bacteria 753
275 Ga0316592_1034007 3300033524 Bacteria 1115
276 Ga0316588_1068235 3300033528 Bacteria 871
277 Ga0316596_1000414 3300033541 Bacteria 7119
278 Ga0373926_0073775 3300035083 Bacteria 1256
279 Ga0373954_0000522 3300035118 Bacteria 14412
280 Ga0373954_0190316 3300035118 Bacteria 1007
281 Ga0373956_0332043 3300035119 Bacteria 724
282 Ga0373955_0124039 3300035172 Bacteria 1503
283 Ga0373924_0065596 3300035410 Bacteria 1525
284 Ga0373931_0086776 3300035691 Bacteria 1737
285 Ga0373933_0115638 3300035724 Bacteria 1676
286 Ga0373933_0234347 3300035724 Bacteria 1180
287 Ga0373937_0101518 3300036401 Bacteria 2670
288 Ga0373937_0401253 3300036401 Bacteria 1301
289 Ga0373937_0613452 3300036401 Bacteria 1033
290 Ga0316582_0002995 3300036647 Bacteria 8139
291 Ga0316582_0015953 3300036647 Bacteria 4309
292 Ga0316584_0000321 3300036712 Bacteria 24545
293 Ga0316584_0160322 3300036712 Bacteria 1671
294 Ga0395905_0142975 3300037471 Bacteria 2250
295 Ga0316581_0000611 3300037588 Bacteria 7092
296 Ga0400490_13641 3300038726 Bacteria 1406
297 Ga0400488_33868 3300038741 Bacteria 2611
298 Ga0400487_17708 3300039110 Bacteria 1035
299 Ga0436365_0281666 3300039437 Bacteria 5560
300 Ga0436365_1177264 3300039437 Bacteria 11796
301 Ga0451807_1942880 3300041486 Bacteria 661
302 Ga0451853_1310019 3300041512 Bacteria 1864
303 Ga0451577_0235889 3300042876 Bacteria 1654
304 Ga0451577_0409746 3300042876 Bacteria 1230
305 Ga0451577_0462668 3300042876 Bacteria 1152
306 Ga0451577_1292881 3300042876 Bacteria 649
307 Ga0453683_0018474 3300044673 Bacteria 4476
308 Ga0453683_0259786 3300044673 Bacteria 1108
309 Ga0453684_0030426 3300044712 Bacteria 7628
310 Ga0453684_0031326 3300044712 Bacteria 7479
311 Ga0453684_0129110 3300044712 Bacteria 3035
312 Ga0453684_0131363 3300044712 Bacteria 3004
313 Ga0453684_1182869 3300044712 Bacteria 804
314 Ga0451576_0085798 3300045051 Bacteria 3275
315 Ga0451576_0712842 3300045051 Bacteria 1054
316 Ga0451576_1160738 3300045051 Bacteria 807
317 Ga0451576_1625882 3300045051 Bacteria 670
318 Ga0495592_0078189 3300046454 Bacteria 2396
319 Ga0495651_0041575 3300046462 Bacteria 3570
320 Ga0495653_0250821 3300046463 Bacteria 1175
321 Ga0495662_0006547 3300046476 Bacteria 5817
322 Ga0495664_0013619 3300046477 Unclassified 4613
323 Ga0495608_0048512 3300046511 Bacteria 2821
324 Ga0495608_0109624 3300046511 Bacteria 1775
325 Ga0495618_0093557 3300046514 Bacteria 1922
326 Ga0495618_0368270 3300046514 Bacteria 883
327 Ga0495628_0052287 3300046516 Bacteria 3227
328 Ga0495628_0079208 3300046516 Bacteria 2554
329 Ga0495630_0396638 3300046517 Bacteria 1057
330 Ga0495652_0036420 3300046529 Bacteria 4279
331 Ga0495652_0042810 3300046529 Bacteria 3904
332 Ga0495587_0051341 3300046536 Bacteria 2438
333 Ga0495587_0108884 3300046536 Unclassified 1592
334 Ga0495621_0019409 3300046539 Bacteria 2219
335 Ga0495645_0001229 3300046543 Bacteria 17476
336 Ga0495645_0001359 3300046543 Bacteria 16545
337 Ga0495667_0004542 3300046559 Bacteria 9368
338 Ga0495667_0096237 3300046559 Bacteria 1916
339 Ga0495667_0391558 3300046559 Bacteria 876
340 Ga0495635_0028058 3300046663 Bacteria 3913
341 Ga0495635_0080268 3300046663 Unclassified 2232
342 Ga0495657_0018727 3300046675 Bacteria 5003
343 Ga0495599_0013645 3300046678 Bacteria 5021
344 Ga0495599_0039551 3300046678 Bacteria 2963
345 Ga0495623_0006888 3300046679 Bacteria 7392
346 Ga0495623_0014449 3300046679 Bacteria 5110
347 Ga0495613_0203821 3300046689 Bacteria 1394
348 Ga0495600_0127649 3300046809 Unclassified 1653
349 Ga0495581_0194019 3300047315 Bacteria 1188
350 Ga0495604_0037085 3300047317 Bacteria 3841
351 Ga0495604_0103298 3300047317 Bacteria 2091
352 Ga0495674_0051574 3300047319 Bacteria 3626
353 Ga0495675_0135213 3300047444 Bacteria 1531
354 Ga0495602_0107696 3300048088 Bacteria 2271
355 Ga0495602_0528437 3300048088 Bacteria 821
356 Ga0495615_0010392 3300048090 Bacteria 1859
357 Ga0496114_0873456 3300048917 Bacteria 780
358 Ga0496115_0310723 3300048918 Bacteria 1291
359 Ga0501298_075415 3300049521 Bacteria 734
360 Ga0501031_0006033 3300049568 Bacteria 7905
361 Ga0501031_0018441 3300049568 Bacteria 4540
362 Ga0501032_0054458 3300049569 Bacteria 2692
363 Ga0501032_0138258 3300049569 Bacteria 1605
364 Ga0501034_0977859 3300049571 Bacteria 731
365 Ga0501036_0025718 3300049572 Bacteria 4968
366 Ga0501036_0205268 3300049572 Bacteria 1657
367 Ga0501037_0018250 3300049573 Bacteria 5169
368 Ga0501037_0459650 3300049573 Bacteria 867
369 Ga0501038_0009966 3300049574 Bacteria 8700
370 Ga0501038_0040342 3300049574 Bacteria 4078
371 Ga0501039_0003595 3300049575 Bacteria 11622
372 Ga0501039_0027751 3300049575 Bacteria 4353
373 Ga0501041_0018155 3300049577 Bacteria 4189
374 Ga0501041_0033172 3300049577 Bacteria 3122
375 Ga0501042_0001514 3300049578 Bacteria 13741
376 Ga0501042_0014326 3300049578 Bacteria 5411
377 Ga0501043_0056280 3300049579 Bacteria 3089
378 Ga0501046_0020325 3300049580 Bacteria 5494
379 Ga0501046_0055282 3300049580 Bacteria 3121
380 Ga0501048_0075747 3300049582 Bacteria 2374
381 Ga0501067_0044935 3300049583 Bacteria 2454
382 Ga0501068_0256875 3300049584 Bacteria 1114
383 Ga0501068_0324823 3300049584 Bacteria 987
384 Ga0501071_0035975 3300049587 Bacteria 3530
385 Ga0501075_0016271 3300049591 Bacteria 5355
386 Ga0501076_0057847 3300049592 Bacteria 3080
387 Ga0501076_0077972 3300049592 Bacteria 2658
388 Ga0501076_0236562 3300049592 Bacteria 1493
389 Ga0501077_0104862 3300049593 Bacteria 1791
390 Ga0501250_035693 3300049680 Bacteria 709
391 Ga0501079_0088693 3300049741 Bacteria 2395
392 Ga0501079_0295120 3300049741 Bacteria 1268
393 Ga0501080_0167515 3300049742 Bacteria 2027
394 Ga0501080_0248307 3300049742 Bacteria 1623
395 Ga0501080_0387517 3300049742 Bacteria 1258
396 Ga0501081_0200743 3300049743 Bacteria 1446
397 Ga0501081_0205085 3300049743 Bacteria 1431
398 Ga0501275_027735 3300049772 Bacteria 733
399 Ga0501035_0007475 3300049822 Bacteria 10206
400 Ga0501035_0161132 3300049822 Bacteria 1941
401 Ga0501044_0338585 3300049823 Bacteria 1426
402 Ga0501044_0827487 3300049823 Bacteria 804
403 nmdc:mga00v17_170467_c1 3300050491 Bacteria 1403
404 nmdc:mga0yw44_275228_c1 3300050492 Bacteria 1124
405 nmdc:mga0k408_4545_c1 3300050493 Bacteria 7366
406 nmdc:mga0k408_45858_c1 3300050493 Bacteria 2523
407 nmdc:mga05p37_1094811_c1 3300050507 Bacteria 835
408 nmdc:mga05p37_165110_c1 3300050507 Bacteria 2703
409 nmdc:mga05p37_6350_c1 3300050507 Bacteria 13926
410 nmdc:mga09592_16839_c1 3300050508 Bacteria 5982
411 nmdc:mga09592_179807_c1 3300050508 Bacteria 1830
412 nmdc:mga09592_8637_c1 3300050508 Bacteria 8287
413 nmdc:mga06r32_204315_c1 3300050510 Unclassified 1963
414 nmdc:mga06r32_215067_c1 3300050510 Bacteria 1910
415 nmdc:mga0n895_1170310_c1 3300050512 Bacteria 744
416 nmdc:mga08x19_334319_c1 3300050514 Bacteria 1056
417 nmdc:mga08x19_423507_c1 3300050514 Bacteria 935
418 nmdc:mga0a205_101087_c1 3300050515 Bacteria 2782
419 nmdc:mga0a205_446330_c1 3300050515 Bacteria 1154
420 nmdc:mga0sz30_10263_c1 3300050516 Bacteria 3586
421 Ga0495601_0002555 3300053077 Bacteria 10348
422 Ga0495601_0296990 3300053077 Bacteria 1053
423 Ga0500641_0281271 3300053096 Bacteria 689
424 Ga0500628_001008 3300053129 Bacteria 4919
425 Ga0501084_0288313 3300054114 Bacteria 1386
426 Ga0501084_0470036 3300054114 Bacteria 1063
427 Ga0530510_0193250 3300061734 Bacteria 1511
428 Ga0068868_100033513
429 rootL2_10251205
430 Ga0065712_10081169
431 Ga0065707_10171706
432 Ga0070658_10788420
433 Ga0070683_100745969
434 Ga0070690_100327837
435 Ga0070670_100874141
436 Ga0068869_100217773
437 Ga0070666_10836702
438 Ga0070666_10874242
439 Ga0068868_100022426
440 Ga0070689_100165961
441 Ga0070687_100326882
442 Ga0070668_100109160
443 Ga0070675_100044312
444 Ga0070674_100044859
445 Ga0070674_100566714
446 Ga0070674_100943209
447 Ga0070673_100064291
448 Ga0070673_100479095
449 Ga0070688_100226162
450 Ga0070659_100831916
451 Ga0070713_100253509
452 Ga0070700_100090570
453 Ga0070700_100738245
454 Ga0070694_100177431
455 Ga0070694_100274219
456 Ga0070708_100285451
457 Ga0070678_100006653
458 Ga0068867_100026133
459 Ga0068867_100379418
460 Ga0068867_100388453
461 Ga0070685_10367883
462 Ga0070706_100061588
463 Ga0070706_100769560
464 Ga0070707_100022165
465 Ga0070698_100039535
466 Ga0070698_100057650
467 Ga0070699_100002175
468 Ga0070699_100052609
469 Ga0070684_100139482
470 Ga0070697_100255418
471 Ga0068853_100314788
472 Ga0068853_100879144
473 Ga0068853_100879919
474 Ga0070672_100040621
475 Ga0070686_100252058
476 Ga0070695_100152031
477 Ga0070696_100016084
478 Ga0070696_100450973
479 Ga0070696_101357312
480 Ga0070693_100157687
481 Ga0070693_100980875
482 Ga0070665_100051360
483 Ga0070665_100296325
484 Ga0070704_100109896
485 Ga0068855_100176172
486 Ga0068855_100563299
487 Ga0070664_100610676
488 Ga0068857_100060718
489 Ga0068856_100646568
490 Ga0068852_100252029
491 Ga0068859_100117141
492 Ga0068859_100509443
493 Ga0068864_100169522
494 Ga0068863_100208581
495 Ga0068863_100213816
496 Ga0068863_100259169
497 Ga0068858_100036205
498 Ga0068858_101331530
499 Ga0068858_101406757
500 Ga0068860_100052396
501 Ga0068860_100057501
502 Ga0068860_101220361
503 Ga0068860_101790737
504 Ga0068862_101373401
505 Ga0081455_10044394
506 Ga0081538_10019194
507 Ga0075365_10284780
508 Ga0075364_10186100
509 Ga0070715_10059386
510 Ga0070716_100071027
511 Ga0075427_10023042
512 Ga0075366_10049828
513 Ga0075366_10079902
514 Ga0097621_100131480
515 Ga0097621_100263356
516 Ga0097621_101188955
517 Ga0068871_100012371
518 Ga0068871_100444856
519 Ga0068871_100992205
520 Ga0075428_100184011
521 Ga0075428_100292608
522 Ga0075430_100452220
523 Ga0075430_100512633
524 Ga0075431_100040581
525 Ga0075431_100241517
526 Ga0075433_10371415
527 Ga0075434_100373850
528 Ga0075429_100048210
529 Ga0075429_100534046
530 Ga0068865_100093423
531 Ga0068865_100102864
532 Ga0068865_100257474
533 Ga0068865_100955950
534 Ga0097620_100117149
535 Ga0097620_100509456
536 Ga0105240_10040786
537 Ga0105240_10126342
538 Ga0105240_11070887
539 Ga0105245_10014030
540 Ga0105245_10428380
541 Ga0105245_10518034
542 Ga0105245_11009888
543 Ga0105245_11113195
544 Ga0114129_10024791
545 Ga0114129_10066551
546 Ga0114129_10587546
547 Ga0114129_11463139
548 Ga0105243_10022744
549 Ga0105243_10039151
550 Ga0105241_10249756
551 Ga0105242_10037262
552 Ga0105242_10111720
553 Ga0105242_10370834
554 Ga0105242_10556479
555 Ga0105242_10593172
556 Ga0105248_10026200
557 Ga0105248_10392532
558 Ga0105248_10464749
559 Ga0105248_10712924
560 Ga0105237_10135111
561 Ga0105237_10273142
562 Ga0105238_10121144
563 Ga0105238_10540604
564 Ga0105249_10104536
565 Ga0105249_11359877
566 Ga0105239_10069928
567 Ga0105246_10246788
568 Ga0105246_10307250
569 Ga0157371_10984192
570 Ga0157369_10056387
571 Ga0157374_10060877
572 Ga0157374_10116276
573 Ga0157374_10472665
574 Ga0157378_10625299
575 Ga0157378_10944535
576 Ga0157378_11224294
577 Ga0163162_10139461
578 Ga0163162_10451244
579 Ga0163162_10519861
580 Ga0163162_10526183
581 Ga0157372_11948710
582 Ga0157375_10067149
583 Ga0157375_10135075
584 Ga0157375_10423681
585 Ga0157375_11043691
586 Ga0163163_10011300
587 Ga0157380_10212489
588 Ga0157380_10853899
589 Ga0182008_10040485
590 Ga0157377_10406459
591 Ga0157376_10166747
592 Ga0157376_10213705
593 Ga0157376_10432038
594 Ga0163161_10643155
595 Ga0206356_10627600
596 Ga0206356_11397387
597 Ga0213876_10081848
598 Ga0207685_10056198
599 Ga0207685_10292081
600 Ga0207705_10104790
601 Ga0207684_10150788
602 Ga0207695_10031858
603 Ga0207662_10305798
604 Ga0207646_10159873
605 Ga0207694_10398570
606 Ga0207650_10382021
607 Ga0207650_10898647
608 Ga0207687_10032598
609 Ga0207687_10124530
610 Ga0207687_10674691
611 Ga0207687_10737551
612 Ga0207664_10140023
613 Ga0207690_10745478
614 Ga0207706_10414847
615 Ga0207686_10299365
616 Ga0207686_10406692
617 Ga0207686_10434312
618 Ga0207670_10036831
619 Ga0207670_10071607
620 Ga0207670_10422696
621 Ga0207669_10016033
622 Ga0207669_10047395
623 Ga0207669_10060540
624 Ga0207704_10055130
625 Ga0207704_10322623
626 Ga0207665_10042045
627 Ga0207711_10018336
628 Ga0207711_10188393
629 Ga0207711_10286638
630 Ga0207689_10135507
631 Ga0207689_10468228
632 Ga0207679_10190165
633 Ga0207667_10565550
634 Ga0207667_11568677
635 Ga0207651_10421647
636 Ga0207651_10973786
637 Ga0207712_10055068
638 Ga0207668_10244526
639 Ga0207668_10407849
640 Ga0207677_10186410
641 Ga0207677_10258040
642 Ga0207703_10707387
643 Ga0207703_11272035
644 Ga0207639_10007760
645 Ga0207639_10561252
646 Ga0207678_10133336
647 Ga0207708_10049341
648 Ga0207708_11206057
649 Ga0207702_11087358
650 Ga0207641_10053810
651 Ga0207641_10550493
652 Ga0207648_10261993
653 Ga0207648_10273435
654 Ga0207648_10323893
655 Ga0207648_10410209
656 Ga0207648_10793630
657 Ga0207676_10239259
658 Ga0207683_10014182
659 Ga0207683_10766675
660 Ga0207698_10047265
661 Ga0207698_10353183
662 Ga0268266_10021559
663 Ga0268266_10501158
664 Ga0268264_10008088
665 Ga0268264_10017067
666 Ga0268264_11240799
667 Ga0265318_10013142
668 Ga0265336_10143106
669 Ga0265338_10088049
670 Ga0265320_10034249
671 Ga0265331_10019280
672 Ga0307408_100319218
673 Ga0307408_100949710
674 Ga0316575_10002766
675 Ga0316579_10000119
676 Ga0265314_10030258
677 Ga0265342_10476339
678 Ga0316576_10008961
679 Ga0316576_10167934
680 Ga0316578_10339098
681 Ga0307405_10953757
682 Ga0316577_10001882
683 Ga0307410_10456093
684 Ga0307410_10761859
685 Ga0307406_10165396
686 Ga0307412_10389339
687 Ga0307409_100087632
688 Ga0307409_100345378
689 Ga0307416_100190848
690 Ga0307416_100518397
691 Ga0307416_100842141
692 Ga0307411_10031053
693 Ga0307415_100034194
694 Ga0307415_100055355
695 Ga0307415_100693275
696 Ga0316583_10003021
697 Ga0316585_10000390
698 Ga0316585_10059401
699 Ga0316580_10000552
700 Ga0316593_10088793
701 Ga0316593_10191832
702 Ga0316592_1034007
703 Ga0316588_1068235
704 Ga0316596_1000414
705 Ga0373926_0073775
706 Ga0373954_0000522
707 Ga0373954_0190316
708 Ga0373956_0332043
709 Ga0373955_0124039
710 Ga0373924_0065596
711 Ga0373931_0086776
712 Ga0373933_0115638
713 Ga0373933_0234347
714 Ga0373937_0101518
715 Ga0373937_0401253
716 Ga0373937_0613452
717 Ga0316582_0002995
718 Ga0316582_0015953
719 Ga0316584_0000321
720 Ga0316584_0160322
721 Ga0395905_0142975
722 Ga0316581_0000611
723 Ga0400490_13641
724 Ga0400488_33868
725 Ga0400487_17708
726 Ga0436365_0281666
727 Ga0436365_1177264
728 Ga0451807_1942880
729 Ga0451853_1310019
730 Ga0451577_0235889
731 Ga0451577_0409746
732 Ga0451577_0462668
733 Ga0451577_1292881
734 Ga0453683_0018474
735 Ga0453683_0259786
736 Ga0453684_0030426
737 Ga0453684_0031326
738 Ga0453684_0129110
739 Ga0453684_0131363
740 Ga0453684_1182869
741 Ga0451576_0085798
742 Ga0451576_0712842
743 Ga0451576_1160738
744 Ga0451576_1625882
745 Ga0495592_0078189
746 Ga0495651_0041575
747 Ga0495653_0250821
748 Ga0495662_0006547
749 Ga0495664_0013619
750 Ga0495608_0048512
751 Ga0495608_0109624
752 Ga0495618_0093557
753 Ga0495618_0368270
754 Ga0495628_0052287
755 Ga0495628_0079208
756 Ga0495630_0396638
757 Ga0495652_0036420
758 Ga0495652_0042810
759 Ga0495587_0051341
760 Ga0495587_0108884
761 Ga0495621_0019409
762 Ga0495645_0001229
763 Ga0495645_0001359
764 Ga0495667_0004542
765 Ga0495667_0096237
766 Ga0495667_0391558
767 Ga0495635_0028058
768 Ga0495635_0080268
769 Ga0495657_0018727
770 Ga0495599_0013645
771 Ga0495599_0039551
772 Ga0495623_0006888
773 Ga0495623_0014449
774 Ga0495613_0203821
775 Ga0495600_0127649
776 Ga0495581_0194019
777 Ga0495604_0037085
778 Ga0495604_0103298
779 Ga0495674_0051574
780 Ga0495675_0135213
781 Ga0495602_0107696
782 Ga0495602_0528437
783 Ga0495615_0010392
784 Ga0496114_0873456
785 Ga0496115_0310723
786 Ga0501298_075415
787 Ga0501031_0006033
788 Ga0501031_0018441
789 Ga0501032_0054458
790 Ga0501032_0138258
791 Ga0501034_0977859
792 Ga0501036_0025718
793 Ga0501036_0205268
794 Ga0501037_0018250
795 Ga0501037_0459650
796 Ga0501038_0009966
797 Ga0501038_0040342
798 Ga0501039_0003595
799 Ga0501039_0027751
800 Ga0501041_0018155
801 Ga0501041_0033172
802 Ga0501042_0001514
803 Ga0501042_0014326
804 Ga0501043_0056280
805 Ga0501046_0020325
806 Ga0501046_0055282
807 Ga0501048_0075747
808 Ga0501067_0044935
809 Ga0501068_0256875
810 Ga0501068_0324823
811 Ga0501071_0035975
812 Ga0501075_0016271
813 Ga0501076_0057847
814 Ga0501076_0077972
815 Ga0501076_0236562
816 Ga0501077_0104862
817 Ga0501250_035693
818 Ga0501079_0088693
819 Ga0501079_0295120
820 Ga0501080_0167515
821 Ga0501080_0248307
822 Ga0501080_0387517
823 Ga0501081_0200743
824 Ga0501081_0205085
825 Ga0501275_027735
826 Ga0501035_0007475
827 Ga0501035_0161132
828 Ga0501044_0338585
829 Ga0501044_0827487
830 nmdc:mga00v17_170467_c1
831 nmdc:mga0yw44_275228_c1
832 nmdc:mga0k408_4545_c1
833 nmdc:mga0k408_45858_c1
834 nmdc:mga05p37_1094811_c1
835 nmdc:mga05p37_165110_c1
836 nmdc:mga05p37_6350_c1
837 nmdc:mga09592_16839_c1
838 nmdc:mga09592_179807_c1
839 nmdc:mga09592_8637_c1
840 nmdc:mga06r32_204315_c1
841 nmdc:mga06r32_215067_c1
842 nmdc:mga0n895_1170310_c1
843 nmdc:mga08x19_334319_c1
844 nmdc:mga08x19_423507_c1
845 nmdc:mga0a205_101087_c1
846 nmdc:mga0a205_446330_c1
847 nmdc:mga0sz30_10263_c1
848 Ga0495601_0002555
849 Ga0495601_0296990
850 Ga0500641_0281271
851 Ga0500628_001008
852 Ga0501084_0288313
853 Ga0501084_0470036
854 Ga0530510_0193250

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01625

PMSR

Peptide methionine sulfoxide reductase

36

189

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2j89-assembly1.cif.gz_A functional and structural aspects of poplar cytosolic and plastidial type a methionine sulfoxide reductases 0.9864 4 152
1ff3-assembly3.cif.gz_C structure of the peptide methionine sulfoxide reductase from escherichia coli 0.9738 4 150
7ot4-assembly1.cif.gz_A crystal structure of msra variant c198c206 from escherichia coli, oxidized 0.9736 4 153
4gwb-assembly1.cif.gz_A-2 crystal structure of putative peptide methionine sulfoxide reductase from sinorhizobium meliloti 1021 0.9736 5 158
1nwa-assembly1.cif.gz_A structure of mycobacterium tuberculosis methionine sulfoxide reductase a in complex with protein-bound methionine 0.9714 1 155
ID Description Score Start End Superfamily
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9888 5 151 3.30.1060.10
af_B6TNT5_14_185_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9713 4 155 3.30.1060.10
1ff3B00 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9705 4 152 3.30.1060.10
af_Q551H3_1_147_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9689 5 151 3.30.1060.10
af_P9WJM5_1_166_3.30.1060.10 Alpha Beta;2-Layer Sandwich;Peptide Methionine Sulfoxide Reductase; Chain A;Peptide methionine sulphoxide reductase MsrA 0.9635 1 158 3.30.1060.10
ID Description Score Start End GO Terms
AF-A0A533Q6U3-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9966 4 179 GO:0008113
GO:0033744
GO:0036211
AF-A0A843T3U7-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9954 2 179 GO:0008113
GO:0036211
AF-A0A3L7U7A3-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9953 2 178 GO:0008113
GO:0033744
GO:0036211
AF-Q7NVL7-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9948 5 179 GO:0008113
GO:0033744
GO:0036211
AF-A0A2E4VEQ8-F1-model_v4 Peptide methionine sulfoxide reductase MsrA (Protein-methionine-S-oxide reductase) (EC 1.8.4.11) (Peptide-methionine (S)-S-oxide reductase) (Peptide Met(O) reductase) 0.9947 4 179 GO:0008113
GO:0033744
GO:0036211

Map