F441377

General Info

Members Datasets Scaffolds Average Seq Length
427 174 854 345

Family's Representative Sequence

Representative Sequence 3300005295|Ga0065707_10008365|Ga0065707_100083653
Length 343
Sequence MKNIGLLILCSSLWISSAFAQAPFYQGKTIRVIVGTPPGNLYDLWARLTVEHMGKNIPGNPNFIVQNMPGAGHVVAVNYLYSNVKPDGLTIIGSVIPSLYLNQVIGRPEIQFDWAKFSWIGSPARGASQMYMRSDSPYKTIEDVRTAKEPPKCGATGVTGPDSYLPKLMQETVGAKFNIVTGYPGGTDIDLGVERGEIQCRAFTIEAFFGREPYHTWRKNSFVHHLFQTSKKRDARLPQTPTVFELMDQYKTPPSGRGLATVLVGADGMGRPMFGPPGLPADLLKTLRDAYAKTMADEQFRAEVKKRNYEFDPVVGEELQTLAKELTSQPPEVIERLKKVLGK

Samples

Sample ID Description Type Environment
1 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
37 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
42 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
43 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
47 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
58 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
59 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
60 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
61 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
93 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
94 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
96 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
97 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
107 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
108 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
109 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
110 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
111 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
112 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
113 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
114 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
115 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
116 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
117 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
118 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
119 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
120 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
121 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
122 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
123 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
124 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
125 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
126 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
127 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
128 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
129 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
130 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
131 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
132 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
133 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
134 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
135 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
136 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
137 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
138 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
139 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
140 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
141 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
142 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
143 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
144 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
145 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
146 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
147 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
148 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
149 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
150 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
151 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
152 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
153 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
154 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
155 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
156 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
157 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
159 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
160 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
161 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
162 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
163 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
164 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
165 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
166 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
167 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
168 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
169 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
170 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
171 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
172 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
173 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
174 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.87
Rhizosphere 98.13
Stem 0
Stem Tuber 0
Unclassified 27.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065707_10008365 3300005295 Bacteria 3409
2 Ga0065712_10068562 3300005290 Bacteria 9890
3 Ga0065715_10001163 3300005293 Bacteria 10957
4 Ga0065715_10005188 3300005293 Bacteria 4876
5 Ga0065715_10150452 3300005293 Unclassified 1735
6 Ga0065707_10182797 3300005295 Unclassified 1407
7 Ga0070677_10006398 3300005333 Bacteria 3912
8 Ga0068869_100279045 3300005334 Bacteria 1343
9 Ga0070666_10003558 3300005335 Bacteria 9445
10 Ga0070680_100244658 3300005336 Bacteria 1516
11 Ga0070660_100080230 3300005339 Bacteria 2560
12 Ga0070660_100151137 3300005339 Unclassified 1867
13 Ga0070689_100037345 3300005340 Bacteria 3714
14 Ga0070691_10053188 3300005341 Bacteria 1937
15 Ga0070669_100051249 3300005353 Bacteria 3016
16 Ga0070674_100233759 3300005356 Unclassified 1436
17 Ga0070673_100167685 3300005364 Bacteria 1872
18 Ga0070667_100038182 3300005367 Bacteria 4026
19 Ga0070703_10064948 3300005406 Bacteria 1204
20 Ga0070705_100012064 3300005440 Unclassified 4380
21 Ga0070694_100048401 3300005444 Bacteria 2860
22 Ga0070694_100057606 3300005444 Bacteria 2642
23 Ga0070694_100079471 3300005444 Bacteria 2277
24 Ga0070708_100054293 3300005445 Bacteria 3558
25 Ga0070662_100003561 3300005457 Bacteria 9717
26 Ga0070662_100088724 3300005457 Bacteria 2318
27 Ga0070681_10013883 3300005458 Bacteria 8017
28 Ga0070681_10037623 3300005458 Bacteria 4855
29 Ga0070681_10045477 3300005458 Bacteria 4391
30 Ga0068867_100145075 3300005459 Bacteria 1859
31 Ga0070706_100058308 3300005467 Unclassified 3564
32 Ga0070706_100227962 3300005467 Bacteria 1739
33 Ga0070707_100075568 3300005468 Unclassified 3250
34 Ga0070679_100024528 3300005530 Bacteria 5910
35 Ga0070697_100042068 3300005536 Unclassified 3698
36 Ga0070695_100013898 3300005545 Unclassified 4845
37 Ga0070695_100157978 3300005545 Bacteria 1589
38 Ga0070696_100039758 3300005546 Bacteria 3247
39 Ga0070693_100013298 3300005547 Bacteria 4189
40 Ga0070664_100019233 3300005564 Bacteria 5618
41 Ga0070664_100130076 3300005564 Bacteria 2211
42 Ga0070664_100326912 3300005564 Unclassified 1390
43 Ga0070702_100067223 3300005615 Bacteria 2105
44 Ga0068859_100187590 3300005617 Unclassified 2152
45 Ga0068866_10036581 3300005718 Bacteria 2406
46 Ga0068861_100226356 3300005719 Bacteria 1584
47 Ga0068858_100155304 3300005842 Bacteria 2153
48 Ga0081455_10000094 3300005937 Bacteria 96637
49 Ga0081455_10000426 3300005937 Bacteria 55338
50 Ga0081455_10048338 3300005937 Bacteria 3677
51 Ga0081455_10167563 3300005937 Bacteria 1677
52 Ga0081538_10006394 3300005981 Bacteria 10381
53 Ga0081538_10056146 3300005981 Bacteria 2309
54 Ga0081538_10062786 3300005981 Bacteria 2115
55 Ga0075432_10013499 3300006058 Bacteria 2775
56 Ga0070716_100091492 3300006173 Bacteria 1842
57 Ga0075427_10001989 3300006194 Bacteria 2695
58 Ga0097621_100111020 3300006237 Bacteria 2317
59 Ga0075428_100006770 3300006844 Bacteria 12751
60 Ga0075428_100040068 3300006844 Bacteria 5155
61 Ga0075430_100011049 3300006846 Bacteria 7649
62 Ga0075430_100039158 3300006846 Bacteria 4015
63 Ga0075430_100084147 3300006846 Unclassified 2664
64 Ga0075430_100088492 3300006846 Unclassified 2592
65 Ga0075430_100224157 3300006846 Unclassified 1559
66 Ga0075431_100022114 3300006847 Bacteria 6504
67 Ga0075431_100025640 3300006847 Bacteria 6043
68 Ga0075431_100058308 3300006847 Unclassified 3984
69 Ga0075431_100060947 3300006847 Unclassified 3893
70 Ga0075431_100080532 3300006847 Bacteria 3362
71 Ga0075431_100083338 3300006847 Bacteria 3301
72 Ga0075431_100201482 3300006847 Unclassified 2036
73 Ga0075431_100248856 3300006847 Bacteria 1806
74 Ga0075431_100251617 3300006847 Bacteria 1795
75 Ga0075431_100292377 3300006847 Unclassified 1648
76 Ga0075433_10033207 3300006852 Bacteria 4423
77 Ga0075433_10035398 3300006852 Bacteria 4293
78 Ga0075433_10035930 3300006852 Bacteria 4265
79 Ga0075433_10044330 3300006852 Bacteria 3864
80 Ga0075433_10067488 3300006852 Unclassified 3139
81 Ga0075433_10103166 3300006852 Unclassified 2526
82 Ga0075433_10173984 3300006852 Unclassified 1915
83 Ga0075433_10177287 3300006852 Unclassified 1896
84 Ga0075433_10195482 3300006852 Bacteria 1799
85 Ga0075433_10325490 3300006852 Bacteria 1359
86 Ga0075434_100002605 3300006871 Bacteria 15905
87 Ga0075434_100011393 3300006871 Bacteria 8387
88 Ga0075434_100016779 3300006871 Bacteria 7046
89 Ga0075434_100026668 3300006871 Bacteria 5663
90 Ga0075434_100042145 3300006871 Bacteria 4524
91 Ga0075434_100055645 3300006871 Unclassified 3931
92 Ga0075434_100056384 3300006871 Bacteria 3904
93 Ga0075434_100150761 3300006871 Unclassified 2345
94 Ga0075434_100162948 3300006871 Bacteria 2250
95 Ga0075434_100174685 3300006871 Bacteria 2168
96 Ga0075434_100293627 3300006871 Bacteria 1645
97 Ga0075434_100307877 3300006871 Bacteria 1604
98 Ga0075429_100009732 3300006880 Bacteria 8329
99 Ga0075429_100017832 3300006880 Bacteria 6139
100 Ga0075429_100049723 3300006880 Unclassified 3647
101 Ga0075429_100064918 3300006880 Unclassified 3178
102 Ga0075429_100067377 3300006880 Bacteria 3115
103 Ga0075429_100116259 3300006880 Bacteria 2338
104 Ga0075429_100163036 3300006880 Bacteria 1952
105 Ga0075429_100211881 3300006880 Bacteria 1697
106 Ga0075429_100327175 3300006880 Bacteria 1341
107 Ga0075436_100010817 3300006914 Bacteria 6261
108 Ga0075436_100015780 3300006914 Bacteria 5171
109 Ga0075436_100020082 3300006914 Bacteria 4585
110 Ga0075436_100036547 3300006914 Bacteria 3390
111 Ga0075436_100056684 3300006914 Bacteria 2706
112 Ga0075436_100057813 3300006914 Bacteria 2678
113 Ga0075436_100110729 3300006914 Bacteria 1916
114 Ga0097620_100187595 3300006931 Unclassified 2152
115 Ga0075435_100003173 3300007076 Bacteria 11116
116 Ga0075435_100015066 3300007076 Bacteria 5803
117 Ga0075435_100031336 3300007076 Unclassified 4187
118 Ga0075435_100060732 3300007076 Bacteria 3065
119 Ga0075435_100127251 3300007076 Bacteria 2130
120 Ga0075435_100250265 3300007076 Bacteria 1508
121 Ga0075435_100336331 3300007076 Unclassified 1294
122 Ga0111539_10013707 3300009094 Bacteria 10125
123 Ga0111539_10062952 3300009094 Bacteria 4390
124 Ga0111539_10134433 3300009094 Bacteria 2896
125 Ga0111539_10308840 3300009094 Unclassified 1840
126 Ga0105245_10236685 3300009098 Bacteria 1768
127 Ga0114129_10019413 3300009147 Bacteria 9679
128 Ga0114129_10044073 3300009147 Bacteria 6276
129 Ga0114129_10045186 3300009147 Bacteria 6192
130 Ga0114129_10047078 3300009147 Bacteria 6061
131 Ga0114129_10069812 3300009147 Unclassified 4898
132 Ga0114129_10086768 3300009147 Unclassified 4340
133 Ga0114129_10149465 3300009147 Unclassified 3197
134 Ga0114129_10233221 3300009147 Unclassified 2478
135 Ga0114129_10242442 3300009147 Bacteria 2423
136 Ga0114129_10267837 3300009147 Unclassified 2287
137 Ga0114129_10382922 3300009147 Unclassified 1857
138 Ga0114129_10443608 3300009147 Bacteria 1703
139 Ga0114129_10574611 3300009147 Unclassified 1463
140 Ga0105242_10069780 3300009176 Bacteria 2912
141 Ga0105237_10248423 3300009545 Bacteria 1781
142 Ga0105239_10177994 3300010375 Unclassified 2379
143 Ga0105239_10261673 3300010375 Bacteria 1944
144 Ga0105246_10005060 3300011119 Bacteria 8019
145 Ga0157373_10087195 3300013100 Unclassified 2199
146 Ga0157374_10035345 3300013296 Bacteria 4572
147 Ga0157378_10055127 3300013297 Unclassified 3540
148 Ga0157372_10093368 3300013307 Bacteria 3424
149 Ga0157375_10072106 3300013308 Bacteria 3469
150 Ga0157377_10077672 3300014745 Bacteria 1933
151 Ga0157376_10003110 3300014969 Bacteria 11404
152 Ga0207697_10002093 3300025315 Bacteria 10498
153 Ga0207682_10015350 3300025893 Bacteria 2982
154 Ga0207688_10013462 3300025901 Bacteria 4444
155 Ga0207647_10041689 3300025904 Bacteria 2885
156 Ga0207645_10000364 3300025907 Bacteria 37528
157 Ga0207684_10224681 3300025910 Unclassified 1620
158 Ga0207707_10026853 3300025912 Bacteria 5031
159 Ga0207707_10031443 3300025912 Bacteria 4644
160 Ga0207707_10054437 3300025912 Bacteria 3483
161 Ga0207657_10015059 3300025919 Bacteria 7511
162 Ga0207649_10051381 3300025920 Bacteria 2552
163 Ga0207649_10269996 3300025920 Bacteria 1232
164 Ga0207652_10044815 3300025921 Bacteria 3769
165 Ga0207681_10197293 3300025923 Bacteria 1543
166 Ga0207650_10019075 3300025925 Bacteria 4820
167 Ga0207659_10091968 3300025926 Bacteria 2267
168 Ga0207644_10030466 3300025931 Bacteria 3752
169 Ga0207690_10047992 3300025932 Bacteria 2836
170 Ga0207706_10001289 3300025933 Bacteria 25226
171 Ga0207706_10008125 3300025933 Bacteria 9685
172 Ga0207706_10016301 3300025933 Bacteria 6709
173 Ga0207670_10069339 3300025936 Bacteria 2432
174 Ga0207669_10028376 3300025937 Unclassified 3079
175 Ga0207704_10057696 3300025938 Bacteria 2386
176 Ga0207691_10018693 3300025940 Bacteria 6565
177 Ga0207679_10027114 3300025945 Bacteria 3958
178 Ga0207679_10153904 3300025945 Bacteria 1875
179 Ga0207651_10120123 3300025960 Bacteria 1991
180 Ga0207677_10256446 3300026023 Bacteria 1423
181 Ga0207678_10001294 3300026067 Bacteria 23168
182 Ga0207676_10318402 3300026095 Bacteria 1427
183 Ga0207676_10460025 3300026095 Unclassified 1201
184 Ga0207675_100173619 3300026118 Bacteria 2061
185 Ga0207683_10002491 3300026121 Bacteria 16059
186 Ga0209967_1008613 3300027364 Bacteria 1407
187 Ga0209983_1002815 3300027665 Bacteria 3759
188 Ga0209983_1007175 3300027665 Bacteria 2288
189 Ga0209983_1014473 3300027665 Bacteria 1626
190 Ga0209971_1017278 3300027682 Bacteria 1710
191 Ga0209998_10004280 3300027717 Unclassified 3040
192 Ga0209998_10018032 3300027717 Bacteria 1497
193 Ga0209974_10000823 3300027876 Bacteria 10655
194 Ga0209974_10004653 3300027876 Bacteria 4879
195 Ga0209974_10006913 3300027876 Unclassified 3933
196 Ga0209974_10013004 3300027876 Bacteria 2777
197 Ga0209974_10022107 3300027876 Bacteria 2106
198 Ga0209974_10032062 3300027876 Unclassified 1741
199 Ga0207428_10026679 3300027907 Unclassified 4818
200 Ga0207428_10063187 3300027907 Bacteria 2926
201 Ga0207428_10064761 3300027907 Bacteria 2885
202 Ga0207428_10272335 3300027907 Unclassified 1258
203 Ga0268264_10075179 3300028381 Bacteria 2872
204 Ga0307408_100008479 3300031548 Bacteria 6788
205 Ga0307408_100298020 3300031548 Bacteria 1349
206 Ga0307405_10006660 3300031731 Bacteria 5704
207 Ga0307413_10101563 3300031824 Bacteria 1902
208 Ga0307406_10073767 3300031901 Bacteria 2245
209 Ga0307406_10076064 3300031901 Bacteria 2217
210 Ga0307407_10043637 3300031903 Bacteria 2522
211 Ga0307407_10135784 3300031903 Bacteria 1580
212 Ga0307412_10007843 3300031911 Bacteria 6079
213 Ga0307412_10026527 3300031911 Bacteria 3602
214 Ga0307412_10125272 3300031911 Bacteria 1857
215 Ga0307409_100013935 3300031995 Bacteria 5203
216 Ga0307409_100156980 3300031995 Bacteria 1984
217 Ga0307409_100166411 3300031995 Bacteria 1935
218 Ga0307409_100241135 3300031995 Bacteria 1646
219 Ga0307416_100017190 3300032002 Bacteria 5051
220 Ga0307416_100029410 3300032002 Unclassified 4104
221 Ga0307416_100036174 3300032002 Bacteria 3783
222 Ga0307416_100044515 3300032002 Bacteria 3486
223 Ga0307416_100075873 3300032002 Bacteria 2815
224 Ga0307414_10009025 3300032004 Bacteria 5703
225 Ga0307414_10137532 3300032004 Unclassified 1907
226 Ga0307414_10199169 3300032004 Bacteria 1627
227 Ga0307411_10035593 3300032005 Bacteria 3111
228 Ga0307411_10057693 3300032005 Bacteria 2566
229 Ga0307411_10059840 3300032005 Unclassified 2527
230 Ga0307415_100005198 3300032126 Bacteria 6876
231 Ga0373932_0038875 3300035112 Bacteria 1362
232 Ga0373939_0034602 3300035114 Bacteria 1484
233 Ga0373941_0018836 3300035115 Bacteria 1913
234 Ga0373941_0030950 3300035115 Bacteria 1591
235 Ga0373942_0010986 3300035207 Bacteria 2139
236 Ga0373931_0003787 3300035691 Bacteria 6843
237 Ga0373931_0004277 3300035691 Bacteria 6504
238 Ga0373931_0042188 3300035691 Bacteria 2398
239 Ga0439455_0040843 3300042012 Bacteria 1187
240 Ga0439464_0023836 3300042439 Unclassified 1691
241 Ga0453684_0368164 3300044712 Unclassified 1616
242 Ga0451576_0095241 3300045051 Unclassified 3096
243 Ga0451576_0219297 3300045051 Bacteria 1986
244 Ga0451576_0293280 3300045051 Bacteria 1700
245 Ga0496100_0163867 3300048903 Bacteria 1596
246 Ga0496102_0069599 3300048905 Bacteria 3230
247 Ga0496109_0410639 3300048912 Unclassified 1279
248 Ga0496110_0294564 3300048913 Unclassified 1478
249 Ga0496112_0016439 3300048915 Bacteria 6932
250 Ga0496112_0018978 3300048915 Bacteria 6483
251 Ga0496112_0071858 3300048915 Unclassified 3420
252 Ga0496113_0031558 3300048916 Bacteria 3846
253 Ga0501292_003742 3300049515 Unclassified 2048
254 Ga0501031_0014867 3300049568 Bacteria 5057
255 Ga0501032_0009907 3300049569 Bacteria 6885
256 Ga0501032_0012277 3300049569 Bacteria 6128
257 Ga0501032_0148434 3300049569 Unclassified 1542
258 Ga0501033_0038592 3300049570 Unclassified 3569
259 Ga0501033_0131032 3300049570 Unclassified 1816
260 Ga0501033_0184306 3300049570 Bacteria 1495
261 Ga0501034_0054992 3300049571 Unclassified 4006
262 Ga0501034_0234944 3300049571 Unclassified 1781
263 Ga0501036_0034106 3300049572 Unclassified 4304
264 Ga0501036_0107036 3300049572 Bacteria 2364
265 Ga0501037_0015485 3300049573 Bacteria 5611
266 Ga0501037_0061585 3300049573 Bacteria 2736
267 Ga0501037_0069085 3300049573 Unclassified 2572
268 Ga0501037_0265601 3300049573 Bacteria 1198
269 Ga0501038_0084668 3300049574 Bacteria 2667
270 Ga0501038_0090855 3300049574 Unclassified 2558
271 Ga0501038_0130639 3300049574 Bacteria 2062
272 Ga0501039_0030435 3300049575 Bacteria 4162
273 Ga0501039_0133120 3300049575 Bacteria 1951
274 Ga0501039_0138076 3300049575 Bacteria 1915
275 Ga0501040_0022638 3300049576 Bacteria 4208
276 Ga0501040_0063595 3300049576 Unclassified 2539
277 Ga0501040_0077956 3300049576 Unclassified 2292
278 Ga0501040_0277068 3300049576 Bacteria 1198
279 Ga0501041_0031696 3300049577 Unclassified 3194
280 Ga0501041_0059096 3300049577 Unclassified 2347
281 Ga0501041_0127676 3300049577 Unclassified 1583
282 Ga0501042_0061530 3300049578 Unclassified 2682
283 Ga0501042_0196309 3300049578 Unclassified 1455
284 Ga0501042_0202895 3300049578 Bacteria 1430
285 Ga0501043_0015635 3300049579 Bacteria 5948
286 Ga0501043_0027537 3300049579 Bacteria 4461
287 Ga0501043_0034949 3300049579 Unclassified 3953
288 Ga0501046_0023856 3300049580 Bacteria 5025
289 Ga0501047_0079539 3300049581 Bacteria 3152
290 Ga0501047_0104548 3300049581 Unclassified 2712
291 Ga0501048_0042777 3300049582 Bacteria 3242
292 Ga0501048_0080660 3300049582 Unclassified 2295
293 Ga0501048_0125999 3300049582 Unclassified 1810
294 Ga0501068_0009090 3300049584 Bacteria 5546
295 Ga0501068_0030686 3300049584 Unclassified 3190
296 Ga0501069_0019205 3300049585 Unclassified 3693
297 Ga0501069_0024410 3300049585 Bacteria 3297
298 Ga0501069_0133834 3300049585 Bacteria 1420
299 Ga0501070_0004338 3300049586 Bacteria 12192
300 Ga0501070_0035298 3300049586 Bacteria 4179
301 Ga0501070_0090835 3300049586 Unclassified 2527
302 Ga0501071_0171436 3300049587 Bacteria 1624
303 Ga0501071_0184767 3300049587 Unclassified 1562
304 Ga0501071_0297620 3300049587 Bacteria 1223
305 Ga0501072_0119422 3300049588 Unclassified 2100
306 Ga0501072_0122203 3300049588 Bacteria 2074
307 Ga0501072_0245193 3300049588 Unclassified 1427
308 Ga0501073_0010224 3300049589 Bacteria 6893
309 Ga0501073_0032494 3300049589 Bacteria 3720
310 Ga0501073_0035768 3300049589 Unclassified 3528
311 Ga0501074_0009628 3300049590 Bacteria 7012
312 Ga0501074_0037064 3300049590 Bacteria 3534
313 Ga0501074_0046716 3300049590 Unclassified 3130
314 Ga0501075_0009315 3300049591 Bacteria 6872
315 Ga0501075_0074187 3300049591 Bacteria 2574
316 Ga0501075_0083621 3300049591 Unclassified 2417
317 Ga0501075_0101203 3300049591 Unclassified 2188
318 Ga0501075_0124537 3300049591 Bacteria 1962
319 Ga0501075_0127072 3300049591 Bacteria 1941
320 Ga0501076_0029312 3300049592 Bacteria 4279
321 Ga0501076_0033651 3300049592 Bacteria 4002
322 Ga0501076_0159189 3300049592 Unclassified 1839
323 Ga0501076_0169409 3300049592 Unclassified 1780
324 Ga0501077_0028826 3300049593 Bacteria 3528
325 Ga0501235_005219 3300049669 Bacteria 2825
326 Ga0501229_013294 3300049706 Unclassified 1057
327 Ga0501079_0029608 3300049741 Plasmid 4204
328 Ga0501079_0041782 3300049741 Bacteria 3540
329 Ga0501079_0050117 3300049741 Bacteria 3223
330 Ga0501080_0027140 3300049742 Bacteria 5325
331 Ga0501080_0044982 3300049742 Bacteria 4109
332 Ga0501080_0047324 3300049742 Bacteria 4003
333 Ga0501080_0109415 3300049742 Unclassified 2561
334 Ga0501081_0044925 3300049743 Bacteria 3033
335 Ga0501081_0052757 3300049743 Bacteria 2806
336 Ga0501081_0080905 3300049743 Bacteria 2274
337 Ga0501081_0136415 3300049743 Bacteria 1756
338 Ga0501083_0020613 3300049744 Unclassified 4584
339 Ga0501083_0020749 3300049744 Bacteria 4567
340 Ga0501083_0025866 3300049744 Bacteria 4062
341 Ga0501283_001707 3300049779 Unclassified 2854
342 Ga0501035_0020477 3300049822 Bacteria 6074
343 Ga0501035_0078721 3300049822 Bacteria 2911
344 Ga0501035_0227968 3300049822 Bacteria 1588
345 Ga0501044_0049348 3300049823 Bacteria 4345
346 Ga0501044_0059053 3300049823 Unclassified 3931
347 Ga0501044_0143181 3300049823 Unclassified 2378
348 Ga0501045_0042932 3300049824 Unclassified 3291
349 nmdc:mga05p37_100809_c2 3300050507 Bacteria 3227
350 nmdc:mga05p37_164360_c1 3300050507 Bacteria 2710
351 nmdc:mga05p37_171208_c1 3300050507 Unclassified 2648
352 nmdc:mga05p37_186737_c1 3300050507 Unclassified 2520
353 nmdc:mga05p37_191356_c1 3300050507 Bacteria 2484
354 nmdc:mga05p37_24634_c1 3300050507 Bacteria 7315
355 nmdc:mga05p37_36207_c1 3300050507 Bacteria 6056
356 nmdc:mga05p37_368448_c1 3300050507 Bacteria 1687
357 nmdc:mga05p37_3727_c1 3300050507 Bacteria 17834
358 nmdc:mga05p37_43929_c1 3300050507 Bacteria 5498
359 nmdc:mga05p37_460014_c1 3300050507 Bacteria 1471
360 nmdc:mga05p37_46197_c1 3300050507 Bacteria 5355
361 nmdc:mga05p37_509654_c1 3300050507 Unclassified 1379
362 nmdc:mga05p37_748023_c1 3300050507 Unclassified 1078
363 nmdc:mga09592_122898_c1 3300050508 Bacteria 2230
364 nmdc:mga09592_125122_c1 3300050508 Bacteria 2210
365 nmdc:mga09592_147348_c1 3300050508 Unclassified 2030
366 nmdc:mga09592_18901_c1 3300050508 Bacteria 5653
367 nmdc:mga09592_265319_c1 3300050508 Unclassified 1489
368 nmdc:mga09592_273331_c1 3300050508 Bacteria 1466
369 nmdc:mga09592_80742_c1 3300050508 Bacteria 2770
370 nmdc:mga0qj67_166453_c1 3300050509 Unclassified 1790
371 nmdc:mga0qj67_242396_c1 3300050509 Bacteria 1462
372 nmdc:mga0qj67_277041_c1 3300050509 Unclassified 1360
373 nmdc:mga0qj67_45437_c1 3300050509 Unclassified 3466
374 nmdc:mga0qj67_7192_c1 3300050509 Bacteria 8215
375 nmdc:mga0qj67_90818_c1 3300050509 Bacteria 2454
376 nmdc:mga0qj67_93883_c1 3300050509 Bacteria 2413
377 nmdc:mga06r32_119728_c1 3300050510 Unclassified 2596
378 nmdc:mga06r32_240772_c1 3300050510 Bacteria 1797
379 nmdc:mga06r32_387711_c1 3300050510 Bacteria 1380
380 nmdc:mga06r32_48714_c1 3300050510 Bacteria 4051
381 nmdc:mga06r32_50920_c1 3300050510 Unclassified 3962
382 nmdc:mga06r32_63050_c1 3300050510 Bacteria 3572
383 nmdc:mga08y16_13661_c1 3300050511 Bacteria 8550
384 nmdc:mga08y16_20470_c1 3300050511 Bacteria 6984
385 nmdc:mga08y16_394948_c1 3300050511 Unclassified 1416
386 nmdc:mga08y16_93936_c1 3300050511 Bacteria 3125
387 nmdc:mga08y16_98269_c1 3300050511 Bacteria 3048
388 nmdc:mga0n895_105681_c1 3300050512 Bacteria 2828
389 nmdc:mga0n895_208536_c1 3300050512 Bacteria 1985
390 nmdc:mga0n895_2374_c1 3300050512 Bacteria 14686
391 nmdc:mga0n895_41842_c1 3300050512 Bacteria 4456
392 nmdc:mga0n895_420030_c1 3300050512 Unclassified 1352
393 nmdc:mga0n895_85011_c1 3300050512 Bacteria 3158
394 nmdc:mga0rr50_2254_c1 3300050513 Bacteria 10829
395 nmdc:mga0rr50_286842_c1 3300050513 Bacteria 1375
396 nmdc:mga0rr50_31987_c1 3300050513 Bacteria 3743
397 nmdc:mga0rr50_33153_c1 3300050513 Bacteria 3687
398 nmdc:mga0rr50_49071_c1 3300050513 Bacteria 3124
399 nmdc:mga0rr50_9482_c1 3300050513 Bacteria 6122
400 nmdc:mga08x19_14889_c1 3300050514 Bacteria 4724
401 nmdc:mga08x19_151161_c1 3300050514 Unclassified 1572
402 nmdc:mga08x19_25246_c1 3300050514 Bacteria 3700
403 nmdc:mga08x19_37588_c1 3300050514 Bacteria 3073
404 nmdc:mga0a205_11968_c1 3300050515 Bacteria 8013
405 nmdc:mga0a205_1259_c2 3300050515 Bacteria 7113
406 nmdc:mga0a205_130104_c1 3300050515 Bacteria 2418
407 nmdc:mga0a205_202287_c1 3300050515 Unclassified 1876
408 nmdc:mga0a205_294152_c1 3300050515 Unclassified 1498
409 nmdc:mga0a205_35491_c1 3300050515 Unclassified 4788
410 nmdc:mga0a205_42478_c1 3300050515 Bacteria 4381
411 nmdc:mga0a205_59860_c1 3300050515 Bacteria 3679
412 Ga0501084_0025093 3300054114 Unclassified 4972
413 Ga0501084_0039302 3300054114 Bacteria 3958
414 Ga0501084_0091388 3300054114 Unclassified 2555
415 Ga0501084_0341259 3300054114 Bacteria 1265
416 Ga0590071_007016 3300059421 Bacteria 2666
417 Ga0590075_029397 3300059424 Bacteria 1389
418 Ga0590077_014067 3300059426 Bacteria 1665
419 Ga0590077_018586 3300059426 Bacteria 1468
420 Ga0501082_0054455 3300060353 Bacteria 3448
421 Ga0501082_0072311 3300060353 Unclassified 2970
422 Ga0501082_0111645 3300060353 Bacteria 2366
423 Ga0501082_0138467 3300060353 Bacteria 2112
424 Ga0530510_0032030 3300061734 Unclassified 3780
425 Ga0530510_0074203 3300061734 Unclassified 2470
426 Ga0530510_0093706 3300061734 Bacteria 2193
427 Ga0530510_0111799 3300061734 Bacteria 2001
428 Ga0065707_10008365
429 Ga0065712_10068562
430 Ga0065715_10001163
431 Ga0065715_10005188
432 Ga0065715_10150452
433 Ga0065707_10182797
434 Ga0070677_10006398
435 Ga0068869_100279045
436 Ga0070666_10003558
437 Ga0070680_100244658
438 Ga0070660_100080230
439 Ga0070660_100151137
440 Ga0070689_100037345
441 Ga0070691_10053188
442 Ga0070669_100051249
443 Ga0070674_100233759
444 Ga0070673_100167685
445 Ga0070667_100038182
446 Ga0070703_10064948
447 Ga0070705_100012064
448 Ga0070694_100048401
449 Ga0070694_100057606
450 Ga0070694_100079471
451 Ga0070708_100054293
452 Ga0070662_100003561
453 Ga0070662_100088724
454 Ga0070681_10013883
455 Ga0070681_10037623
456 Ga0070681_10045477
457 Ga0068867_100145075
458 Ga0070706_100058308
459 Ga0070706_100227962
460 Ga0070707_100075568
461 Ga0070679_100024528
462 Ga0070697_100042068
463 Ga0070695_100013898
464 Ga0070695_100157978
465 Ga0070696_100039758
466 Ga0070693_100013298
467 Ga0070664_100019233
468 Ga0070664_100130076
469 Ga0070664_100326912
470 Ga0070702_100067223
471 Ga0068859_100187590
472 Ga0068866_10036581
473 Ga0068861_100226356
474 Ga0068858_100155304
475 Ga0081455_10000094
476 Ga0081455_10000426
477 Ga0081455_10048338
478 Ga0081455_10167563
479 Ga0081538_10006394
480 Ga0081538_10056146
481 Ga0081538_10062786
482 Ga0075432_10013499
483 Ga0070716_100091492
484 Ga0075427_10001989
485 Ga0097621_100111020
486 Ga0075428_100006770
487 Ga0075428_100040068
488 Ga0075430_100011049
489 Ga0075430_100039158
490 Ga0075430_100084147
491 Ga0075430_100088492
492 Ga0075430_100224157
493 Ga0075431_100022114
494 Ga0075431_100025640
495 Ga0075431_100058308
496 Ga0075431_100060947
497 Ga0075431_100080532
498 Ga0075431_100083338
499 Ga0075431_100201482
500 Ga0075431_100248856
501 Ga0075431_100251617
502 Ga0075431_100292377
503 Ga0075433_10033207
504 Ga0075433_10035398
505 Ga0075433_10035930
506 Ga0075433_10044330
507 Ga0075433_10067488
508 Ga0075433_10103166
509 Ga0075433_10173984
510 Ga0075433_10177287
511 Ga0075433_10195482
512 Ga0075433_10325490
513 Ga0075434_100002605
514 Ga0075434_100011393
515 Ga0075434_100016779
516 Ga0075434_100026668
517 Ga0075434_100042145
518 Ga0075434_100055645
519 Ga0075434_100056384
520 Ga0075434_100150761
521 Ga0075434_100162948
522 Ga0075434_100174685
523 Ga0075434_100293627
524 Ga0075434_100307877
525 Ga0075429_100009732
526 Ga0075429_100017832
527 Ga0075429_100049723
528 Ga0075429_100064918
529 Ga0075429_100067377
530 Ga0075429_100116259
531 Ga0075429_100163036
532 Ga0075429_100211881
533 Ga0075429_100327175
534 Ga0075436_100010817
535 Ga0075436_100015780
536 Ga0075436_100020082
537 Ga0075436_100036547
538 Ga0075436_100056684
539 Ga0075436_100057813
540 Ga0075436_100110729
541 Ga0097620_100187595
542 Ga0075435_100003173
543 Ga0075435_100015066
544 Ga0075435_100031336
545 Ga0075435_100060732
546 Ga0075435_100127251
547 Ga0075435_100250265
548 Ga0075435_100336331
549 Ga0111539_10013707
550 Ga0111539_10062952
551 Ga0111539_10134433
552 Ga0111539_10308840
553 Ga0105245_10236685
554 Ga0114129_10019413
555 Ga0114129_10044073
556 Ga0114129_10045186
557 Ga0114129_10047078
558 Ga0114129_10069812
559 Ga0114129_10086768
560 Ga0114129_10149465
561 Ga0114129_10233221
562 Ga0114129_10242442
563 Ga0114129_10267837
564 Ga0114129_10382922
565 Ga0114129_10443608
566 Ga0114129_10574611
567 Ga0105242_10069780
568 Ga0105237_10248423
569 Ga0105239_10177994
570 Ga0105239_10261673
571 Ga0105246_10005060
572 Ga0157373_10087195
573 Ga0157374_10035345
574 Ga0157378_10055127
575 Ga0157372_10093368
576 Ga0157375_10072106
577 Ga0157377_10077672
578 Ga0157376_10003110
579 Ga0207697_10002093
580 Ga0207682_10015350
581 Ga0207688_10013462
582 Ga0207647_10041689
583 Ga0207645_10000364
584 Ga0207684_10224681
585 Ga0207707_10026853
586 Ga0207707_10031443
587 Ga0207707_10054437
588 Ga0207657_10015059
589 Ga0207649_10051381
590 Ga0207649_10269996
591 Ga0207652_10044815
592 Ga0207681_10197293
593 Ga0207650_10019075
594 Ga0207659_10091968
595 Ga0207644_10030466
596 Ga0207690_10047992
597 Ga0207706_10001289
598 Ga0207706_10008125
599 Ga0207706_10016301
600 Ga0207670_10069339
601 Ga0207669_10028376
602 Ga0207704_10057696
603 Ga0207691_10018693
604 Ga0207679_10027114
605 Ga0207679_10153904
606 Ga0207651_10120123
607 Ga0207677_10256446
608 Ga0207678_10001294
609 Ga0207676_10318402
610 Ga0207676_10460025
611 Ga0207675_100173619
612 Ga0207683_10002491
613 Ga0209967_1008613
614 Ga0209983_1002815
615 Ga0209983_1007175
616 Ga0209983_1014473
617 Ga0209971_1017278
618 Ga0209998_10004280
619 Ga0209998_10018032
620 Ga0209974_10000823
621 Ga0209974_10004653
622 Ga0209974_10006913
623 Ga0209974_10013004
624 Ga0209974_10022107
625 Ga0209974_10032062
626 Ga0207428_10026679
627 Ga0207428_10063187
628 Ga0207428_10064761
629 Ga0207428_10272335
630 Ga0268264_10075179
631 Ga0307408_100008479
632 Ga0307408_100298020
633 Ga0307405_10006660
634 Ga0307413_10101563
635 Ga0307406_10073767
636 Ga0307406_10076064
637 Ga0307407_10043637
638 Ga0307407_10135784
639 Ga0307412_10007843
640 Ga0307412_10026527
641 Ga0307412_10125272
642 Ga0307409_100013935
643 Ga0307409_100156980
644 Ga0307409_100166411
645 Ga0307409_100241135
646 Ga0307416_100017190
647 Ga0307416_100029410
648 Ga0307416_100036174
649 Ga0307416_100044515
650 Ga0307416_100075873
651 Ga0307414_10009025
652 Ga0307414_10137532
653 Ga0307414_10199169
654 Ga0307411_10035593
655 Ga0307411_10057693
656 Ga0307411_10059840
657 Ga0307415_100005198
658 Ga0373932_0038875
659 Ga0373939_0034602
660 Ga0373941_0018836
661 Ga0373941_0030950
662 Ga0373942_0010986
663 Ga0373931_0003787
664 Ga0373931_0004277
665 Ga0373931_0042188
666 Ga0439455_0040843
667 Ga0439464_0023836
668 Ga0453684_0368164
669 Ga0451576_0095241
670 Ga0451576_0219297
671 Ga0451576_0293280
672 Ga0496100_0163867
673 Ga0496102_0069599
674 Ga0496109_0410639
675 Ga0496110_0294564
676 Ga0496112_0016439
677 Ga0496112_0018978
678 Ga0496112_0071858
679 Ga0496113_0031558
680 Ga0501292_003742
681 Ga0501031_0014867
682 Ga0501032_0009907
683 Ga0501032_0012277
684 Ga0501032_0148434
685 Ga0501033_0038592
686 Ga0501033_0131032
687 Ga0501033_0184306
688 Ga0501034_0054992
689 Ga0501034_0234944
690 Ga0501036_0034106
691 Ga0501036_0107036
692 Ga0501037_0015485
693 Ga0501037_0061585
694 Ga0501037_0069085
695 Ga0501037_0265601
696 Ga0501038_0084668
697 Ga0501038_0090855
698 Ga0501038_0130639
699 Ga0501039_0030435
700 Ga0501039_0133120
701 Ga0501039_0138076
702 Ga0501040_0022638
703 Ga0501040_0063595
704 Ga0501040_0077956
705 Ga0501040_0277068
706 Ga0501041_0031696
707 Ga0501041_0059096
708 Ga0501041_0127676
709 Ga0501042_0061530
710 Ga0501042_0196309
711 Ga0501042_0202895
712 Ga0501043_0015635
713 Ga0501043_0027537
714 Ga0501043_0034949
715 Ga0501046_0023856
716 Ga0501047_0079539
717 Ga0501047_0104548
718 Ga0501048_0042777
719 Ga0501048_0080660
720 Ga0501048_0125999
721 Ga0501068_0009090
722 Ga0501068_0030686
723 Ga0501069_0019205
724 Ga0501069_0024410
725 Ga0501069_0133834
726 Ga0501070_0004338
727 Ga0501070_0035298
728 Ga0501070_0090835
729 Ga0501071_0171436
730 Ga0501071_0184767
731 Ga0501071_0297620
732 Ga0501072_0119422
733 Ga0501072_0122203
734 Ga0501072_0245193
735 Ga0501073_0010224
736 Ga0501073_0032494
737 Ga0501073_0035768
738 Ga0501074_0009628
739 Ga0501074_0037064
740 Ga0501074_0046716
741 Ga0501075_0009315
742 Ga0501075_0074187
743 Ga0501075_0083621
744 Ga0501075_0101203
745 Ga0501075_0124537
746 Ga0501075_0127072
747 Ga0501076_0029312
748 Ga0501076_0033651
749 Ga0501076_0159189
750 Ga0501076_0169409
751 Ga0501077_0028826
752 Ga0501235_005219
753 Ga0501229_013294
754 Ga0501079_0029608
755 Ga0501079_0041782
756 Ga0501079_0050117
757 Ga0501080_0027140
758 Ga0501080_0044982
759 Ga0501080_0047324
760 Ga0501080_0109415
761 Ga0501081_0044925
762 Ga0501081_0052757
763 Ga0501081_0080905
764 Ga0501081_0136415
765 Ga0501083_0020613
766 Ga0501083_0020749
767 Ga0501083_0025866
768 Ga0501283_001707
769 Ga0501035_0020477
770 Ga0501035_0078721
771 Ga0501035_0227968
772 Ga0501044_0049348
773 Ga0501044_0059053
774 Ga0501044_0143181
775 Ga0501045_0042932
776 nmdc:mga05p37_100809_c2
777 nmdc:mga05p37_164360_c1
778 nmdc:mga05p37_171208_c1
779 nmdc:mga05p37_186737_c1
780 nmdc:mga05p37_191356_c1
781 nmdc:mga05p37_24634_c1
782 nmdc:mga05p37_36207_c1
783 nmdc:mga05p37_368448_c1
784 nmdc:mga05p37_3727_c1
785 nmdc:mga05p37_43929_c1
786 nmdc:mga05p37_460014_c1
787 nmdc:mga05p37_46197_c1
788 nmdc:mga05p37_509654_c1
789 nmdc:mga05p37_748023_c1
790 nmdc:mga09592_122898_c1
791 nmdc:mga09592_125122_c1
792 nmdc:mga09592_147348_c1
793 nmdc:mga09592_18901_c1
794 nmdc:mga09592_265319_c1
795 nmdc:mga09592_273331_c1
796 nmdc:mga09592_80742_c1
797 nmdc:mga0qj67_166453_c1
798 nmdc:mga0qj67_242396_c1
799 nmdc:mga0qj67_277041_c1
800 nmdc:mga0qj67_45437_c1
801 nmdc:mga0qj67_7192_c1
802 nmdc:mga0qj67_90818_c1
803 nmdc:mga0qj67_93883_c1
804 nmdc:mga06r32_119728_c1
805 nmdc:mga06r32_240772_c1
806 nmdc:mga06r32_387711_c1
807 nmdc:mga06r32_48714_c1
808 nmdc:mga06r32_50920_c1
809 nmdc:mga06r32_63050_c1
810 nmdc:mga08y16_13661_c1
811 nmdc:mga08y16_20470_c1
812 nmdc:mga08y16_394948_c1
813 nmdc:mga08y16_93936_c1
814 nmdc:mga08y16_98269_c1
815 nmdc:mga0n895_105681_c1
816 nmdc:mga0n895_208536_c1
817 nmdc:mga0n895_2374_c1
818 nmdc:mga0n895_41842_c1
819 nmdc:mga0n895_420030_c1
820 nmdc:mga0n895_85011_c1
821 nmdc:mga0rr50_2254_c1
822 nmdc:mga0rr50_286842_c1
823 nmdc:mga0rr50_31987_c1
824 nmdc:mga0rr50_33153_c1
825 nmdc:mga0rr50_49071_c1
826 nmdc:mga0rr50_9482_c1
827 nmdc:mga08x19_14889_c1
828 nmdc:mga08x19_151161_c1
829 nmdc:mga08x19_25246_c1
830 nmdc:mga08x19_37588_c1
831 nmdc:mga0a205_11968_c1
832 nmdc:mga0a205_1259_c2
833 nmdc:mga0a205_130104_c1
834 nmdc:mga0a205_202287_c1
835 nmdc:mga0a205_294152_c1
836 nmdc:mga0a205_35491_c1
837 nmdc:mga0a205_42478_c1
838 nmdc:mga0a205_59860_c1
839 Ga0501084_0025093
840 Ga0501084_0039302
841 Ga0501084_0091388
842 Ga0501084_0341259
843 Ga0590071_007016
844 Ga0590075_029397
845 Ga0590077_014067
846 Ga0590077_018586
847 Ga0501082_0054455
848 Ga0501082_0072311
849 Ga0501082_0111645
850 Ga0501082_0138467
851 Ga0530510_0032030
852 Ga0530510_0074203
853 Ga0530510_0093706
854 Ga0530510_0111799

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

46

338

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.8225 30 343
2qpq-assembly2.cif.gz_B structure of bug27 from bordetella pertussis 0.8194 27 343
4x9t-assembly1.cif.gz_A crystal structure of a tctc solute binding protein from polaromonas (bpro_3516, target efi-510338), no ligand 0.812 29 343
8hk9-assembly2.cif.gz_A apo-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis 0.8097 30 343
7ndr-assembly1.cif.gz_E crystal structure of tphc in an open conformation 0.8034 29 343
ID Description Score Start End Superfamily
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.8315 27 124 3.40.190.150
4x9tA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.8219 27 343 3.40.190.150
4x9tA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.8037 27 343 3.40.190.150
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.7708 128 246 3.40.190.10
2f5xC01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.7695 27 340 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A351SVB7-F1-model_v4 ABC transporter substrate-binding protein 0.9686 130 342
AF-A0A2S6QCV2-F1-model_v4 Tripartite tricarboxylate transporter family receptor 0.9669 26 343
AF-A0A7C3P1A0-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9603 125 344
AF-A0A534V8G1-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.958 21 342
AF-A0A534SC71-F1-model_v4 Uncharacterized protein 0.9567 193 343

Map